


| Basic Information | |
|---|---|
| Family ID | F033785 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 176 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MDQLILKRASASRLSGEWNDDDYDVLADGAVVGRIMKA |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 176 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 53.12 % |
| % of genes near scaffold ends (potentially truncated) | 58.52 % |
| % of genes from short scaffolds (< 2000 bps) | 68.18 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.659 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (33.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.136 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.818 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 24.24% Coil/Unstructured: 75.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 176 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 12.50 |
| PF00994 | MoCF_biosynth | 1.70 |
| PF06035 | Peptidase_C93 | 1.70 |
| PF02735 | Ku | 1.70 |
| PF09509 | Hypoth_Ymh | 1.14 |
| PF03401 | TctC | 0.57 |
| PF00072 | Response_reg | 0.57 |
| PF13458 | Peripla_BP_6 | 0.57 |
| PF13432 | TPR_16 | 0.57 |
| PF00034 | Cytochrom_C | 0.57 |
| PF12399 | BCA_ABC_TP_C | 0.57 |
| PF12800 | Fer4_4 | 0.57 |
| PF01609 | DDE_Tnp_1 | 0.57 |
| PF02586 | SRAP | 0.57 |
| PF01722 | BolA | 0.57 |
| PF17201 | Cache_3-Cache_2 | 0.57 |
| PF00005 | ABC_tran | 0.57 |
| PF07536 | HWE_HK | 0.57 |
| PF05974 | DUF892 | 0.57 |
| PF00580 | UvrD-helicase | 0.57 |
| PF00313 | CSD | 0.57 |
| PF04909 | Amidohydro_2 | 0.57 |
| PF13560 | HTH_31 | 0.57 |
| PF04828 | GFA | 0.57 |
| PF14534 | DUF4440 | 0.57 |
| PF10108 | DNA_pol_B_exo2 | 0.57 |
| PF13936 | HTH_38 | 0.57 |
| PF07726 | AAA_3 | 0.57 |
| PF01068 | DNA_ligase_A_M | 0.57 |
| PF03592 | Terminase_2 | 0.57 |
| PF13185 | GAF_2 | 0.57 |
| PF13796 | Sensor | 0.57 |
| COG ID | Name | Functional Category | % Frequency in 176 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 12.50 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 1.70 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 1.70 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.57 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.57 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.57 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.57 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.57 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.57 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.57 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.57 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.57 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.57 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.57 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.57 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.57 |
| COG4251 | Bacteriophytochrome (light-regulated signal transduction histidine kinase) | Signal transduction mechanisms [T] | 0.57 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.57 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.57 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.66 % |
| Unclassified | root | N/A | 40.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000597|AF_2010_repII_A1DRAFT_10043969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1176 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1015379 | Not Available | 1075 | Open in IMG/M |
| 3300000956|JGI10216J12902_101579924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1135 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100935683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300004268|Ga0066398_10107014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 656 | Open in IMG/M |
| 3300004463|Ga0063356_102490528 | Not Available | 793 | Open in IMG/M |
| 3300005163|Ga0066823_10015476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1130 | Open in IMG/M |
| 3300005332|Ga0066388_102182152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300005332|Ga0066388_102183765 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300005332|Ga0066388_106432076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300005332|Ga0066388_108759084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 502 | Open in IMG/M |
| 3300005364|Ga0070673_101199755 | Not Available | 711 | Open in IMG/M |
| 3300005471|Ga0070698_100860460 | Not Available | 852 | Open in IMG/M |
| 3300005713|Ga0066905_101111726 | Not Available | 702 | Open in IMG/M |
| 3300005764|Ga0066903_100673704 | Not Available | 1815 | Open in IMG/M |
| 3300005764|Ga0066903_101788857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1173 | Open in IMG/M |
| 3300005764|Ga0066903_103244363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 879 | Open in IMG/M |
| 3300005764|Ga0066903_103259389 | Not Available | 877 | Open in IMG/M |
| 3300005764|Ga0066903_104422027 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300005764|Ga0066903_105303422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300005764|Ga0066903_105389365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300005764|Ga0066903_105507882 | Not Available | 667 | Open in IMG/M |
| 3300005764|Ga0066903_105705837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 654 | Open in IMG/M |
| 3300006576|Ga0074047_11580297 | Not Available | 526 | Open in IMG/M |
| 3300006791|Ga0066653_10130212 | Not Available | 1194 | Open in IMG/M |
| 3300006904|Ga0075424_101992740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300009792|Ga0126374_10047178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2158 | Open in IMG/M |
| 3300009792|Ga0126374_10394891 | Not Available | 964 | Open in IMG/M |
| 3300010046|Ga0126384_10999049 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010047|Ga0126382_11885889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300010358|Ga0126370_10611116 | Not Available | 943 | Open in IMG/M |
| 3300010359|Ga0126376_12408026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300010359|Ga0126376_12454438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300010360|Ga0126372_10528740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1115 | Open in IMG/M |
| 3300010361|Ga0126378_11411007 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300010366|Ga0126379_12526679 | Not Available | 612 | Open in IMG/M |
| 3300010398|Ga0126383_10502396 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300010398|Ga0126383_11152871 | Not Available | 865 | Open in IMG/M |
| 3300010398|Ga0126383_11413069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300010398|Ga0126383_12736736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300010398|Ga0126383_13304670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300012205|Ga0137362_11147685 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → Gimesia fumaroli | 660 | Open in IMG/M |
| 3300012211|Ga0137377_10423036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300012354|Ga0137366_10625743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300012358|Ga0137368_10291348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300012358|Ga0137368_10571311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300012362|Ga0137361_11269666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300012961|Ga0164302_10527491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
| 3300012971|Ga0126369_11245837 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300016270|Ga0182036_10985494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300016294|Ga0182041_10189866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1626 | Open in IMG/M |
| 3300016319|Ga0182033_10063608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2565 | Open in IMG/M |
| 3300016319|Ga0182033_10965192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 757 | Open in IMG/M |
| 3300016319|Ga0182033_11068076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 720 | Open in IMG/M |
| 3300016341|Ga0182035_10235733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1469 | Open in IMG/M |
| 3300016357|Ga0182032_10334827 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300016357|Ga0182032_10485952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1013 | Open in IMG/M |
| 3300016404|Ga0182037_10328201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1239 | Open in IMG/M |
| 3300016404|Ga0182037_10762014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 832 | Open in IMG/M |
| 3300016404|Ga0182037_11276997 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300016445|Ga0182038_10449713 | Not Available | 1090 | Open in IMG/M |
| 3300016445|Ga0182038_10775129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 839 | Open in IMG/M |
| 3300018468|Ga0066662_11535387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
| 3300021372|Ga0213877_10232454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300021439|Ga0213879_10191885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300021560|Ga0126371_11483373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 807 | Open in IMG/M |
| 3300021560|Ga0126371_11838956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300021560|Ga0126371_12906248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300025922|Ga0207646_10463908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Tardiphaga → unclassified Tardiphaga → Tardiphaga sp. vice352 | 1142 | Open in IMG/M |
| 3300026551|Ga0209648_10479958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300028720|Ga0307317_10256111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300028784|Ga0307282_10002570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6660 | Open in IMG/M |
| 3300028878|Ga0307278_10346656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 655 | Open in IMG/M |
| 3300028884|Ga0307308_10394532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 663 | Open in IMG/M |
| 3300031170|Ga0307498_10435837 | Not Available | 523 | Open in IMG/M |
| 3300031543|Ga0318516_10132650 | Not Available | 1425 | Open in IMG/M |
| 3300031549|Ga0318571_10346527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300031572|Ga0318515_10190821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300031572|Ga0318515_10194432 | Not Available | 1086 | Open in IMG/M |
| 3300031573|Ga0310915_10655333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 742 | Open in IMG/M |
| 3300031573|Ga0310915_10839341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300031640|Ga0318555_10327182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 830 | Open in IMG/M |
| 3300031668|Ga0318542_10077712 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300031668|Ga0318542_10651057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300031668|Ga0318542_10690711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
| 3300031681|Ga0318572_10069404 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300031681|Ga0318572_10185921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Gha | 1210 | Open in IMG/M |
| 3300031682|Ga0318560_10626696 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300031682|Ga0318560_10754647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300031713|Ga0318496_10141991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1308 | Open in IMG/M |
| 3300031719|Ga0306917_11180333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 595 | Open in IMG/M |
| 3300031736|Ga0318501_10029729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2403 | Open in IMG/M |
| 3300031748|Ga0318492_10376829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300031763|Ga0318537_10380974 | Not Available | 520 | Open in IMG/M |
| 3300031770|Ga0318521_10614197 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300031770|Ga0318521_10801075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
| 3300031770|Ga0318521_11003813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300031771|Ga0318546_10572943 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300031780|Ga0318508_1014918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1815 | Open in IMG/M |
| 3300031782|Ga0318552_10067284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1725 | Open in IMG/M |
| 3300031793|Ga0318548_10247496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300031796|Ga0318576_10222284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 889 | Open in IMG/M |
| 3300031821|Ga0318567_10236679 | Not Available | 1024 | Open in IMG/M |
| 3300031833|Ga0310917_10503291 | Not Available | 824 | Open in IMG/M |
| 3300031846|Ga0318512_10155922 | Not Available | 1103 | Open in IMG/M |
| 3300031890|Ga0306925_11430049 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300031910|Ga0306923_10031434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5734 | Open in IMG/M |
| 3300031910|Ga0306923_11845605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300031912|Ga0306921_10105729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3266 | Open in IMG/M |
| 3300031941|Ga0310912_10778715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300031941|Ga0310912_11048199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 624 | Open in IMG/M |
| 3300031945|Ga0310913_10262697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1214 | Open in IMG/M |
| 3300031945|Ga0310913_10554574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga calopogonii | 815 | Open in IMG/M |
| 3300031946|Ga0310910_10080247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2375 | Open in IMG/M |
| 3300031959|Ga0318530_10191175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 838 | Open in IMG/M |
| 3300032001|Ga0306922_10153947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2459 | Open in IMG/M |
| 3300032043|Ga0318556_10079194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1638 | Open in IMG/M |
| 3300032043|Ga0318556_10334279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300032044|Ga0318558_10203355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 966 | Open in IMG/M |
| 3300032059|Ga0318533_11337420 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 523 | Open in IMG/M |
| 3300032063|Ga0318504_10189299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300032076|Ga0306924_10436921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1496 | Open in IMG/M |
| 3300032261|Ga0306920_100632053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1582 | Open in IMG/M |
| 3300032261|Ga0306920_100665737 | Not Available | 1536 | Open in IMG/M |
| 3300032261|Ga0306920_102073752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300032261|Ga0306920_103798848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300032261|Ga0306920_103831500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 549 | Open in IMG/M |
| 3300033289|Ga0310914_11300936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 629 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 33.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.18% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.57% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.57% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A1DRAFT_100439694 | 3300000597 | Forest Soil | VDELILKRAAASRPSGEWSDDDYDVVCEGAVVGRIMKAAAAPAGQPW |
| AP72_2010_repI_A100DRAFT_10153791 | 3300000837 | Forest Soil | MDALILKRAPASRLSGEWSDDDYDVLADGRVVGRIMKAA |
| JGI1027J12803_1070161414 | 3300000955 | Soil | MEKDYLVLKRAPASRPSGEWNDDDYDVLADGVVVGRIFKVH |
| JGI10216J12902_1015799241 | 3300000956 | Soil | MSSLILKSASASRPSGEWNDDDYDVLADGAVVGRI |
| JGIcombinedJ26739_1009356831 | 3300002245 | Forest Soil | LDKDYLTLKRASRAARQATGDDDFDVLADGAIVGRILKVH |
| Ga0066398_101070141 | 3300004268 | Tropical Forest Soil | MDKDYLILKRASTSRSSGEWNDDDYDVLADGAIVGRIMKAAAV |
| Ga0063356_1024905282 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSTLILKRASANRRSGQWSDNDYDVLADGVVVGRIMKAAAKPADASW |
| Ga0066823_100154761 | 3300005163 | Soil | LDKDYLTLKRASASRPSGDCNDDDFDVLADGVVVGRIMKAAA |
| Ga0066388_1021821523 | 3300005332 | Tropical Forest Soil | VLDNLQLVLKRASASRSSGEWDDDDFDVLADGVVVGRIMKAAAVP |
| Ga0066388_1021837652 | 3300005332 | Tropical Forest Soil | MDKDYLVLKRAPTSRSSGEWSDDDYDVLADGDVVGRIFKVHAAPVG |
| Ga0066388_1064320762 | 3300005332 | Tropical Forest Soil | MGQLVLKRASASRLSGEWNDDDYDVLCEDAVVGRIMKAAAAPLASVEA* |
| Ga0066388_1087590842 | 3300005332 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWSDDDFDVLADGVVVARNSR* |
| Ga0070673_1011997551 | 3300005364 | Switchgrass Rhizosphere | MSTLILKRASANRRSGQWSDNDYDVLAGGVVVGRIMKAAAKPAD |
| Ga0070710_108591151 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKDYLVLKRASASRTSGEWREDDFDVLADGVVVGRIMKAEAAPVG |
| Ga0070706_1003278081 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQLVLKRASASRPSGHWYDDDYDVLCEGEVVGRIMKAAAAPVGQPWL |
| Ga0070698_1008604601 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ASQLRTMLILKRSSANRASSEWNDDDYDVLAEGGVVGRI* |
| Ga0066692_107776042 | 3300005555 | Soil | MDKDYLALKRASASRPSGEWGENDYDVLSDGVVVGRIVKAAA |
| Ga0066905_1011117263 | 3300005713 | Tropical Forest Soil | MDKDYLILKRASTSRSSGEWSDDDYDVLADGLVVGRAAAL* |
| Ga0066905_1015692071 | 3300005713 | Tropical Forest Soil | MEKDYLILKRASASRPSGEWNEDDYDVLAEGVVVGRIMK |
| Ga0066903_1006737041 | 3300005764 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVVADGAVVGLS* |
| Ga0066903_1017888572 | 3300005764 | Tropical Forest Soil | MDKDYLVLKRASLSRPSGKWNDDDFDVLADGVVIGRIMKAAASPVIRK* |
| Ga0066903_1032443631 | 3300005764 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVVGRILKVHGRP* |
| Ga0066903_1032593892 | 3300005764 | Tropical Forest Soil | MDQLALKRATASRLSGEWSDDDYDVLAEGIVVGSIM* |
| Ga0066903_1044220271 | 3300005764 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLADGDVVGRIF |
| Ga0066903_1049336232 | 3300005764 | Tropical Forest Soil | MEKDYLTLKPASASRPSGQWSDDDYDVIADGVVVGRIFNAK |
| Ga0066903_1053034223 | 3300005764 | Tropical Forest Soil | MDKDYLTLKRASASRPSGEWSDDDYDVLADGVVVGRIF |
| Ga0066903_1053893652 | 3300005764 | Tropical Forest Soil | VDQLVLKRAAASRLSGEWSEDDYDVLAGGIVVGRIMKSAAAPVG* |
| Ga0066903_1055078821 | 3300005764 | Tropical Forest Soil | MDTDYLALKRASASRLSGEWSDDDYDVLCEGAVVGRIMKTAAAPVG |
| Ga0066903_1057058372 | 3300005764 | Tropical Forest Soil | MGQLILKGANASRSSGEWSDDDYDVLAEGIVVGRIMKAAAARVGT |
| Ga0066903_1069450352 | 3300005764 | Tropical Forest Soil | MDKDYLLLTRASASRPSGDWNDDDFDVRVNGEVVGRIMKVHAA |
| Ga0066903_1071299061 | 3300005764 | Tropical Forest Soil | VTHLIIKRASASRLSGDDDFDVLAAGAVVSRIFKVHAAPVGT |
| Ga0066903_1077717283 | 3300005764 | Tropical Forest Soil | MDKDYLTLKRASASRPSGEWSDDDYDVLADGEVVGR |
| Ga0074047_115802972 | 3300006576 | Soil | MTQLVLKRASASRSSGQWSDGDYDVLVDGEKVGRIMKAAAKPAD |
| Ga0066653_101302123 | 3300006791 | Soil | MTGLTLKCASASRPSGEWNDDDYDVLAEGAVVRIFKANAAVGSPWM* |
| Ga0066665_110938361 | 3300006796 | Soil | LDKDYLTLKRASASRPSGDWNDDDFDVLADGVVVGRIMKA |
| Ga0075424_1019927401 | 3300006904 | Populus Rhizosphere | VTSQSLILKRASASRPSGEWSDDDFDVTADGVVVGRIMKAMAT |
| Ga0066710_1031622173 | 3300009012 | Grasslands Soil | LILKRGSASRPSGEWNDDDYDVLADGVVVGRIMKAAASPV |
| Ga0066709_1007298283 | 3300009137 | Grasslands Soil | MTLILKPASASRPSGEWNDDDYDVLADGVVVGRIFKVHA |
| Ga0075423_127937491 | 3300009162 | Populus Rhizosphere | MDKDYLTLKRASASRPSGWDNDDYDVLADGVVVGRIMETA |
| Ga0126374_100471782 | 3300009792 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVNGRP* |
| Ga0126374_103948911 | 3300009792 | Tropical Forest Soil | MDKDYLILKRASASRSSGEWSEGDYDVMCEGAVVGRIMKAAAAP |
| Ga0126384_109990492 | 3300010046 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLADGDVVGRIFKVHAAPVG |
| Ga0126384_111761711 | 3300010046 | Tropical Forest Soil | VDQLILKRASATRLPGKWSEDDYDVLCEGAVVGRIMKAAAPLSSVEE* |
| Ga0126382_118858892 | 3300010047 | Tropical Forest Soil | MGQLVLKRASASRPSGEWSDDDYDVLCEGAVVGRIMKAARRRGIREI* |
| Ga0126370_106111161 | 3300010358 | Tropical Forest Soil | MGQLILKRATDSRLSDEWSEDDYDVLCEGAVVGRIMKAAAAP |
| Ga0126376_124080263 | 3300010359 | Tropical Forest Soil | VDQLVLKHAAASRLSGEWSDDDYDVLCEGAVVGRIMK |
| Ga0126376_124544381 | 3300010359 | Tropical Forest Soil | MDKGYLVLKRASASRPSGQWNDDDYDVVANGTVVGRIL |
| Ga0126372_105287401 | 3300010360 | Tropical Forest Soil | MDKDYLVLKRASTSRSAGEWNDDDFDVLADGDVVGRIFKVHAA |
| Ga0126378_114110071 | 3300010361 | Tropical Forest Soil | MDKDYLVLKRASASRLSGEWSDDDFDVLAEGILVGRIMKAAAAPLGTPW |
| Ga0126379_102272071 | 3300010366 | Tropical Forest Soil | MGQLILKRATDSRLSGEWSEDDYDVLCEGAVVGRIMKAAAA |
| Ga0126379_125266792 | 3300010366 | Tropical Forest Soil | MTTLLLKRASASRPSGEWHDADYDVLAEGVVVGRIMKA |
| Ga0126381_1021599052 | 3300010376 | Tropical Forest Soil | MDQLILKRTWRSSGKWADDDYDVLADGVVVGRIFKGRRRL |
| Ga0126381_1041405773 | 3300010376 | Tropical Forest Soil | MGQLILKRATDSRLSGEWSEDDYDVLCEGAVVGRIMKAAAAPVG |
| Ga0126383_105023963 | 3300010398 | Tropical Forest Soil | MGQLILKRATDSRLSDEWSEDDYDVLCEGAVVGRIMKA |
| Ga0126383_111528711 | 3300010398 | Tropical Forest Soil | MGQLVLKRASASRLSGEWSDDDYDVLCDGAVVGRMRNAAAAPVRTPTH |
| Ga0126383_113621761 | 3300010398 | Tropical Forest Soil | MLKRASASRPSGEWNEDDFDVHADGAVVGRIMKVHAAP |
| Ga0126383_114130692 | 3300010398 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGKWNDDDYDVLADGVVNGRP* |
| Ga0126383_127367362 | 3300010398 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWGDDDYDVVADGAVVGRILKAAAAPVG* |
| Ga0126383_133046703 | 3300010398 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVVG |
| Ga0137362_111476851 | 3300012205 | Vadose Zone Soil | MLMLKRASASRPSREWKDDDYDVLADGIVVGRIMKVTRY |
| Ga0137379_106158771 | 3300012209 | Vadose Zone Soil | VASILILKRALASRPSGQWNDDDFDVLAAGAVVGRIMKVHAA |
| Ga0137377_104230361 | 3300012211 | Vadose Zone Soil | MDQLILKRANASRPSGHWSDDDYDVLCEGEVVGRIIKTAAAPS* |
| Ga0137366_106257431 | 3300012354 | Vadose Zone Soil | MGQLVLKRASASRPSGHWYEDDYDVLCEGEVVGRIMKAAAAPVGQPWL |
| Ga0137368_102913482 | 3300012358 | Vadose Zone Soil | MGKLVLKRASASRLSGEWSDDDYDVLCEDEVVGRIMKAAAAPVGQPWLWTR* |
| Ga0137368_105713112 | 3300012358 | Vadose Zone Soil | MAVLILKHASASRISGEWNDDDYDVLADGAVVGRIM |
| Ga0137361_112696662 | 3300012362 | Vadose Zone Soil | MAQLMLKRASSSRPSGEWSDDDYDVLADGIVVGRIM* |
| Ga0126375_106985321 | 3300012948 | Tropical Forest Soil | LDKDYLTLKPASASRRSGDWNDDDFDVLADGVVVGRIMK |
| Ga0164302_105274911 | 3300012961 | Soil | LDKDYLTLKRASASRLSGDWNDDDFDVLADGVVVGRIMK |
| Ga0126369_111696091 | 3300012971 | Tropical Forest Soil | MIQLILKRAPTSRPSGAWNEDDYDVLADGVVVGRIFKAAASP |
| Ga0126369_112458372 | 3300012971 | Tropical Forest Soil | MDKDYLVLKRASASRSSGVWKDDDFDVLADGVVVGRIM |
| Ga0164304_102569612 | 3300012986 | Soil | MEKDYLTLKRASTSRPSGEWNDDDFEVLAEGVVVGRTPAIAPRSKK* |
| Ga0182036_109854942 | 3300016270 | Soil | MSQLVLKRGAASRLSGEWNDDDYDVLCEGAVVVRIM |
| Ga0182041_101898663 | 3300016294 | Soil | MLIFKRASASRSSGKWNDDDFDVLADGVVVGRIMN |
| Ga0182033_100636082 | 3300016319 | Soil | MDKDYLILKRAPASRPSGEWNDDDYDVLADGAVNGRP |
| Ga0182033_109651921 | 3300016319 | Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVVGRILKV |
| Ga0182033_110680761 | 3300016319 | Soil | MDKDYLVLKRASASRLSGEWNDDDFDVLCGGVVVGRIMQ |
| Ga0182035_102357333 | 3300016341 | Soil | MSSLVLKRAWASRSSGEWNDGDFDVLADGTIVGRIMKAA |
| Ga0182032_103348272 | 3300016357 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLAGGVVVGRILK |
| Ga0182032_104859522 | 3300016357 | Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVNGRP |
| Ga0182032_105317443 | 3300016357 | Soil | LDKDYLTLKRASASRPSDDWNDDDFDVLADGVVVGRITKA |
| Ga0182040_116977961 | 3300016387 | Soil | MDKDYLTLKRTSASRPSGEWGDDDYDVLAEGIVVGRIM |
| Ga0182037_103282011 | 3300016404 | Soil | MDKDYLVLKRASASRSSGEWSDDDYDVLAGGVVVGRILKSAAAP |
| Ga0182037_107620143 | 3300016404 | Soil | MSSLVLKRASASRSSGEWNDGDFDVLADGTIVGRIMKAA |
| Ga0182037_110085643 | 3300016404 | Soil | LDKDYLTLRRASASRPSGDWNDDDFDVLADGVVVGRIT |
| Ga0182037_112769972 | 3300016404 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLADGDVVGRIFKV |
| Ga0182038_104497131 | 3300016445 | Soil | MDQLIPKRASASRLSGEWSDDDYDVLAEGIVVGRI |
| Ga0182038_107751293 | 3300016445 | Soil | VSSLVVKRAWASRSAGEWNDDDFDVLADGVVVGRIMKAAAVPVGMS |
| Ga0066662_115353872 | 3300018468 | Grasslands Soil | MTQLILKRASASRPSGHWYDDDYDVLCEGEVVGRIIKTAAAPS |
| Ga0213877_102324541 | 3300021372 | Bulk Soil | MGRPLDKDYLILKRVSASPSSGEWNDDDYDVLADGAVVGRIVKVH |
| Ga0210384_104761332 | 3300021432 | Soil | VTTLVLKRASASRSAGEWKDDDYDSLADGVVVGRIFNSAASP |
| Ga0213879_101918852 | 3300021439 | Bulk Soil | MEKDYLVLKRASASRPPGEWNDDDYDVLAEGVVIGSIRKR |
| Ga0126371_114833732 | 3300021560 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLANGAVVGRILKVHAAPVG |
| Ga0126371_118389563 | 3300021560 | Tropical Forest Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVVGRILKVH |
| Ga0126371_129062482 | 3300021560 | Tropical Forest Soil | MGQLVLKRASASRLSGEWNDDDYDVLCEDAVVGRIMKAAAAPLASVEA |
| Ga0207646_104639081 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VTSLLLKRASASRSSGEWSESDYDVLADGVVIGGKR |
| Ga0209648_104799583 | 3300026551 | Grasslands Soil | MTQLVLKRASASPSGEWGEDDYDVLADGVVVGRIFHAAASPE |
| Ga0209648_108383901 | 3300026551 | Grasslands Soil | LILKRASASRLSGEWKDDDYDVIADGAVVGRIMKGAAAP |
| Ga0307317_102561111 | 3300028720 | Soil | VARLILKRANASRPSGGWSDDDYDVLADGVVVGRIM |
| Ga0307282_100025701 | 3300028784 | Soil | MTQLVLKRASASRSSGQWSDDDYDVLVDGEKVGRI |
| Ga0307278_103466561 | 3300028878 | Soil | MLKRASASRSSGEWNDDDFDVHADGAVVGRIMKVHAAPEGS |
| Ga0307308_103945321 | 3300028884 | Soil | MTQLVLKRASASRSSGEWSDDDYDVLADGVVVGRIMKAAAKPADAS |
| Ga0307498_104358371 | 3300031170 | Soil | MTQLVLKRASLSRSSGEWSDDDYDVLAEGVVVGRIMKAAA |
| Ga0318516_101326502 | 3300031543 | Soil | MDKDYLILKRASTSRSSGEWSDDDYDVLADGLVVGRAAAL |
| Ga0318534_103230841 | 3300031544 | Soil | MDQLILKHASASRSSGEWSEDDNDVLCEDAVVGRIM |
| Ga0318541_102929541 | 3300031545 | Soil | MKKDYLALKRASASRLSGEWSDDDYDVLAEGIVVG |
| Ga0318571_103465272 | 3300031549 | Soil | MSSLILKRASTSRPSGEWSDDDYDVLANSVVVGRIMK |
| Ga0318515_101908211 | 3300031572 | Soil | MDKDYLVLKRASASRSSGEWSDDDYDVLADGDVVGRIFKV |
| Ga0318515_101944321 | 3300031572 | Soil | MDALILKRASASRLSGEWSEDDYDVLCEGAVVGRIMKAAAAP |
| Ga0310915_106553331 | 3300031573 | Soil | MSSLVLKRGSTSRSRGEWNDDDFDVLADGVVVGRIMKAAAVPVGI |
| Ga0310915_108393413 | 3300031573 | Soil | MTQLVLKRASASRPSGEWGEDDYDVLADGAVVGRIMRAAAAP |
| Ga0318555_103271821 | 3300031640 | Soil | MSSLVLKRAWASRSSGEWNDGDFDVLADGTIVGRIMKAAAV |
| Ga0318542_100777125 | 3300031668 | Soil | MDKDYLVLKRASASRPSGEWNDDDFDVLTDGAVVGR |
| Ga0318542_105649681 | 3300031668 | Soil | MEKDYLILKRASASRPSGEWNEDDYDVLAEGVVVGRIMKVH |
| Ga0318542_106510571 | 3300031668 | Soil | MDKDYLVLKRASASRLSGEWSDDDYDVLADGVVVGRIMKAAVAPVGTPWL |
| Ga0318542_106907111 | 3300031668 | Soil | MDKDYLTLKRASASRSSGEWNDDDYDVLADGAVAGRILKVARR |
| Ga0318572_100694041 | 3300031681 | Soil | MDQLILKHASASRSSGEWSEDDNDVLCEDAVVDRIMKATAA |
| Ga0318572_101859211 | 3300031681 | Soil | MTSSGQRLLKRASASRPSGEWNDDDFDVLADGLVIGRI |
| Ga0318560_106266962 | 3300031682 | Soil | MDKDYLVLKRASASRSSGEWSDDDYDVLAEGDVVGRIFK |
| Ga0318560_107546472 | 3300031682 | Soil | MGQLILKSANASRPSGEWSDDDYDVLAEGIVVGRIMKAA |
| Ga0318496_101419911 | 3300031713 | Soil | MSSLVLKRAWASRSSGEWNDGDFDVLADGTIVGRIMKAAAVPVGMSW |
| Ga0306917_103523871 | 3300031719 | Soil | VDQLILKRASASRLSGEWNDDDYDVLADGAVVGRIMKAAAAPVA |
| Ga0306917_111803332 | 3300031719 | Soil | MDKDYLVLKRASTRESGKWNDDDYDVLADGAVNGRP |
| Ga0318493_108888532 | 3300031723 | Soil | VPARALKRASASRPSGEWNDDDYDVLADGVVVGRMA |
| Ga0318500_100370025 | 3300031724 | Soil | MSSLVLKRASASRQFGEWNDDDYDVLADATVVGRIM |
| Ga0318501_100297291 | 3300031736 | Soil | MSSLVLKRASASRQFGEWNDDDYDVLADATVVGRIHGVP |
| Ga0318502_106335842 | 3300031747 | Soil | MIIGASLILKQASASRSSGEWSEDDYEVLCEGAVVG |
| Ga0318492_103768291 | 3300031748 | Soil | MSSLVLKRASASRSSGEWNDGDFDVLADGTIVGRIMKAAAVPV |
| Ga0318537_103809741 | 3300031763 | Soil | MDKDYLVLKRASASRLSGEWSDDDYDVLAEGIVVGRIMK |
| Ga0318509_102712571 | 3300031768 | Soil | MALILKRASASRTSGEWNDDDYDVLADGVVVGRVMKAAAAP |
| Ga0318521_106141972 | 3300031770 | Soil | MDKDYLVLNRASTSRSSGEWNDDDFDVLADGDVVG |
| Ga0318521_108010751 | 3300031770 | Soil | MTLVLKRASASRPSGEWNDDDYDVLAEGIVVGRIMNAAA |
| Ga0318521_110038131 | 3300031770 | Soil | MDKARLILKRASASGPSDEWNDDDYDVLADGAVVGRRLANPN |
| Ga0318546_105729431 | 3300031771 | Soil | KDYLVLQRASASRLSGEWSDDDYDVLADGIVVGRIMKAAPRQ |
| Ga0318508_10149181 | 3300031780 | Soil | LTTWNQLVLKRAAASRSSGEWSDDDYDVLAGGIVVGRIMKA |
| Ga0318552_100672841 | 3300031782 | Soil | LTTWNQLVLKRAAASRSSGEWSDDDYDVLAGGIVVGRIMKAAADH |
| Ga0318548_102474962 | 3300031793 | Soil | MDKDYLALKRASASRPSGEWSDDDYDVLAEGKAVGRIFKSAASPV |
| Ga0318548_102500272 | 3300031793 | Soil | MDYLVLKRASASRPSGEWNEDDYDVLADGVVVGRIFK |
| Ga0318576_102222842 | 3300031796 | Soil | KDYLVLKRASASRLSGEWSDDDYDVLADGIVVGRIMKAAPRQ |
| Ga0318567_102366792 | 3300031821 | Soil | MGQLILNSANASRSSGEWSDDDYDVLADSAVVGRIMKAAAAPVGQP |
| Ga0310917_102779283 | 3300031833 | Soil | MDKDYLTLKRASASRSSGEWSDNDYDVLADGKAVGRIMK |
| Ga0310917_105032914 | 3300031833 | Soil | MTGLILKRASASRLSGEWNDEDVLCESEVVGRIMKAAAAPV |
| Ga0318512_101559221 | 3300031846 | Soil | MDKDYLALKRASASRPSGEWSDDDYDVLAEGKAVGRIFKSAA |
| Ga0306919_105099041 | 3300031879 | Soil | MDKDYLTLKRASASRPSGEWSDDDYDVLCEGAVVGR |
| Ga0306925_114300492 | 3300031890 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLAGGVVVGRILKSAAAPVGM |
| Ga0318520_103111671 | 3300031897 | Soil | VTQQLILKRASASRPSGEWNDDDYDVLADGVVVGRIMKAAD |
| Ga0306923_100314347 | 3300031910 | Soil | VDKDYLTLKRASASRLSGEWGDDDYDVLADGKVVGRIMKVHA |
| Ga0306923_118456051 | 3300031910 | Soil | MLKCASASRPSGEWNDDDYDVPADGIIVGRIMKAAAVPVGQSWLW |
| Ga0306921_101057291 | 3300031912 | Soil | MDKDYLVLKRASTSRSSGEWNDDDYDVLADGAVVGRI |
| Ga0310912_103159374 | 3300031941 | Soil | LLLKCAATSRPSGKWNDDDYDVLADGVIVGRIMKAAAG |
| Ga0310912_107787152 | 3300031941 | Soil | MSSLVLKRASASRPFGEWNDDDYDVLADASVVDRIMK |
| Ga0310912_110481993 | 3300031941 | Soil | MGQLILKSANASRSSGEWSDDDYDVLAEGIVVGRIM |
| Ga0310913_102626972 | 3300031945 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLADGDVVGRI |
| Ga0310913_105545741 | 3300031945 | Soil | MSSLVLKRASASRSSGEWTDDDFDVLADGVVVGRIMKA |
| Ga0310910_100802474 | 3300031946 | Soil | MSSLVLKRASASRSSGEWNDGDFDVLADGTIVGRIMKAAAVP |
| Ga0306926_102367551 | 3300031954 | Soil | MDKDYLTLKRASASRPSGEWGDDDYDVLAEGIVVGRIMQ |
| Ga0318530_101911753 | 3300031959 | Soil | MGQLILKSANASRPSGEWSDDDYDVLAEGIVVGRIMKAAADNYAFG |
| Ga0306922_101539471 | 3300032001 | Soil | MDQLILKRASASRLSGEWNDDDYDVLADGAVVGRIMKA |
| Ga0318556_100791945 | 3300032043 | Soil | LTTWNQLVLKRAAASRSSGEWSDDDYDVLAGGIVVGRIMKAAAAPVGQPWL |
| Ga0318556_103342792 | 3300032043 | Soil | MDKDYLALKRASASRPSGEWSDDDYDVLAEGKAVGRIFKSA |
| Ga0318558_102033551 | 3300032044 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLAGGVVIGRI |
| Ga0318532_100796051 | 3300032051 | Soil | MDKDYLVLKRASASRPSGERNDDDYDVLADGVVVGRIFK |
| Ga0318533_101594634 | 3300032059 | Soil | MALILKRASASRTSGEWNDDDYDVLADGVVVGRIMKAAA |
| Ga0318533_113374201 | 3300032059 | Soil | MDKDYLVLKRASTSRSSGEWNDDDFDVLADGAVVGRIM |
| Ga0318504_101892992 | 3300032063 | Soil | MDKDYLVLKRASTSRSSGEWSDDDYDVLADGDVVGRIFK |
| Ga0318510_100429644 | 3300032064 | Soil | LDKDYLTLKRASASRPSDDWNDDDFDVLADGVVVGRITK |
| Ga0306924_104369211 | 3300032076 | Soil | MDKDYLVLKRASASRSSGEWSDDDYDVLAGGVVVGRILKSAAAPVGMP |
| Ga0306924_119589161 | 3300032076 | Soil | MAPMAQLILKHASTSRSSGEWDDDDYDVLADGVVVGRIMKAAAVPV |
| Ga0318540_102977191 | 3300032094 | Soil | MDQLILKHASASRSSGEWSEDDNDVLCEDAVVDRIM |
| Ga0318540_106552571 | 3300032094 | Soil | LDKDYLTLKRASASRPSDDWNDDDFDVLANGVVVGRITKAAAVPV |
| Ga0306920_1006320534 | 3300032261 | Soil | MDKDYLVLKRASTSRSSGKWNDDDYDVLADGAVNGRP |
| Ga0306920_1006657374 | 3300032261 | Soil | MSSLVLKRASASRPSGEWNDDDYDVLADATVVGRIMKV |
| Ga0306920_1020737521 | 3300032261 | Soil | MSLLVLKRASASRLSGEWNDDDYDVLADGTVVDRIMKTAAASV |
| Ga0306920_1037988482 | 3300032261 | Soil | VTSLLLKRASASRPSGDWNDDDYDVLADGAVVGRI |
| Ga0306920_1038315001 | 3300032261 | Soil | MLKRASASRPSGEWSDDDYDVLCEGAAAGRIFKSAARPWA |
| Ga0310914_113009361 | 3300033289 | Soil | MGQLILNSANASRSSGEWSDDDYDVLADSAVVGRIMKAAAAPVGQPWLWT |
| Ga0318519_106708602 | 3300033290 | Soil | LDKDYLTLKRASASRPSGDWNDDDFHVLADGVVVGEHVEI |
| ⦗Top⦘ |