


| Basic Information | |
|---|---|
| Family ID | F033203 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 41 residues |
| Representative Sequence | EVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Number of Associated Samples | 146 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.88 % |
| % of genes from short scaffolds (< 2000 bps) | 91.01 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.764 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.292 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.348 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.247 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.84% β-sheet: 0.00% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF01738 | DLH | 6.74 |
| PF16156 | DUF4864 | 3.37 |
| PF02617 | ClpS | 2.81 |
| PF00857 | Isochorismatase | 2.81 |
| PF01402 | RHH_1 | 2.25 |
| PF02776 | TPP_enzyme_N | 2.25 |
| PF03401 | TctC | 1.69 |
| PF12697 | Abhydrolase_6 | 1.69 |
| PF00175 | NAD_binding_1 | 1.12 |
| PF13671 | AAA_33 | 1.12 |
| PF00296 | Bac_luciferase | 1.12 |
| PF07690 | MFS_1 | 1.12 |
| PF00083 | Sugar_tr | 1.12 |
| PF00089 | Trypsin | 1.12 |
| PF00072 | Response_reg | 0.56 |
| PF04392 | ABC_sub_bind | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF01979 | Amidohydro_1 | 0.56 |
| PF00034 | Cytochrom_C | 0.56 |
| PF13592 | HTH_33 | 0.56 |
| PF00903 | Glyoxalase | 0.56 |
| PF00909 | Ammonium_transp | 0.56 |
| PF01593 | Amino_oxidase | 0.56 |
| PF13532 | 2OG-FeII_Oxy_2 | 0.56 |
| PF01494 | FAD_binding_3 | 0.56 |
| PF13594 | Obsolete Pfam Family | 0.56 |
| PF05199 | GMC_oxred_C | 0.56 |
| PF11295 | DUF3096 | 0.56 |
| PF01909 | NTP_transf_2 | 0.56 |
| PF02224 | Cytidylate_kin | 0.56 |
| PF03992 | ABM | 0.56 |
| PF01850 | PIN | 0.56 |
| PF01161 | PBP | 0.56 |
| PF10049 | DUF2283 | 0.56 |
| PF04964 | Flp_Fap | 0.56 |
| PF14499 | DUF4437 | 0.56 |
| PF00694 | Aconitase_C | 0.56 |
| PF00484 | Pro_CA | 0.56 |
| PF03972 | MmgE_PrpD | 0.56 |
| PF07662 | Nucleos_tra2_C | 0.56 |
| PF03960 | ArsC | 0.56 |
| PF01977 | UbiD | 0.56 |
| PF00483 | NTP_transferase | 0.56 |
| PF07927 | HicA_toxin | 0.56 |
| PF13669 | Glyoxalase_4 | 0.56 |
| PF13618 | Gluconate_2-dh3 | 0.56 |
| PF03928 | HbpS-like | 0.56 |
| PF08734 | GYD | 0.56 |
| PF00565 | SNase | 0.56 |
| PF00300 | His_Phos_1 | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 2.81 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.81 |
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 2.81 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.69 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.12 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.12 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0283 | Cytidylate kinase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0288 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.56 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.56 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.56 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.56 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.56 |
| COG1972 | Nucleoside permease NupC | Nucleotide transport and metabolism [F] | 0.56 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.56 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.56 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.56 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.56 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.76 % |
| Unclassified | root | N/A | 11.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12719938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae | 1205 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10039374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1085 | Open in IMG/M |
| 3300000955|JGI1027J12803_108951238 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300000956|JGI10216J12902_121774351 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300001661|JGI12053J15887_10269452 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101071774 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300002568|C688J35102_119880554 | Not Available | 802 | Open in IMG/M |
| 3300004281|Ga0066397_10018921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1000 | Open in IMG/M |
| 3300004633|Ga0066395_10270791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 918 | Open in IMG/M |
| 3300005167|Ga0066672_10286157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium soli | 1068 | Open in IMG/M |
| 3300005172|Ga0066683_10253602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300005332|Ga0066388_101253289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
| 3300005332|Ga0066388_105924584 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005332|Ga0066388_106120657 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300005439|Ga0070711_100992414 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005471|Ga0070698_100486838 | Not Available | 1171 | Open in IMG/M |
| 3300005554|Ga0066661_10330023 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005561|Ga0066699_11287016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Holosporales → Candidatus Paracaedibacteraceae → Candidatus Odyssella → unclassified Candidatus Odyssella → Candidatus Odyssella sp. | 501 | Open in IMG/M |
| 3300005586|Ga0066691_10744744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005713|Ga0066905_100497956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1012 | Open in IMG/M |
| 3300005713|Ga0066905_101970421 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005764|Ga0066903_105457139 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 671 | Open in IMG/M |
| 3300005764|Ga0066903_105506753 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005764|Ga0066903_106182819 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300006047|Ga0075024_100861887 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006172|Ga0075018_10224686 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300006175|Ga0070712_100008551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6439 | Open in IMG/M |
| 3300006844|Ga0075428_100702021 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300006845|Ga0075421_102542160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 533 | Open in IMG/M |
| 3300006845|Ga0075421_102652185 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006969|Ga0075419_10215961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1274 | Open in IMG/M |
| 3300009089|Ga0099828_11720114 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300009100|Ga0075418_12730880 | Not Available | 539 | Open in IMG/M |
| 3300009143|Ga0099792_10573200 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009147|Ga0114129_13525543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 500 | Open in IMG/M |
| 3300009156|Ga0111538_11966538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 735 | Open in IMG/M |
| 3300009257|Ga0103869_10159264 | Not Available | 601 | Open in IMG/M |
| 3300009789|Ga0126307_10177534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1707 | Open in IMG/M |
| 3300009792|Ga0126374_11188804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
| 3300009792|Ga0126374_11421734 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300010039|Ga0126309_11246105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300010043|Ga0126380_10260471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1207 | Open in IMG/M |
| 3300010047|Ga0126382_10596461 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010047|Ga0126382_11390068 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300010329|Ga0134111_10104568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga massiliensis | 1089 | Open in IMG/M |
| 3300010336|Ga0134071_10074873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1576 | Open in IMG/M |
| 3300010359|Ga0126376_10456965 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300010359|Ga0126376_12101844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300010360|Ga0126372_11181895 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 788 | Open in IMG/M |
| 3300010362|Ga0126377_10127822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2357 | Open in IMG/M |
| 3300010362|Ga0126377_11416131 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010362|Ga0126377_13216170 | Not Available | 528 | Open in IMG/M |
| 3300010376|Ga0126381_100024510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7123 | Open in IMG/M |
| 3300010376|Ga0126381_102958900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 675 | Open in IMG/M |
| 3300010376|Ga0126381_103944771 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300010398|Ga0126383_10536602 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium BLR9 | 1234 | Open in IMG/M |
| 3300010398|Ga0126383_11447594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 777 | Open in IMG/M |
| 3300010398|Ga0126383_12889885 | Not Available | 561 | Open in IMG/M |
| 3300011270|Ga0137391_10439948 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300011270|Ga0137391_10759635 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300012096|Ga0137389_10168208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1807 | Open in IMG/M |
| 3300012189|Ga0137388_11174851 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012203|Ga0137399_10102136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2220 | Open in IMG/M |
| 3300012203|Ga0137399_11649512 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012353|Ga0137367_10966974 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012356|Ga0137371_10352360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1144 | Open in IMG/M |
| 3300012357|Ga0137384_10050317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3447 | Open in IMG/M |
| 3300012357|Ga0137384_10650169 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300012357|Ga0137384_11602225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300012361|Ga0137360_11695034 | Not Available | 537 | Open in IMG/M |
| 3300012363|Ga0137390_10808605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 895 | Open in IMG/M |
| 3300012469|Ga0150984_111558665 | Not Available | 610 | Open in IMG/M |
| 3300012685|Ga0137397_10710485 | Not Available | 747 | Open in IMG/M |
| 3300012902|Ga0157291_10403229 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300012918|Ga0137396_11025564 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012924|Ga0137413_10787603 | Not Available | 729 | Open in IMG/M |
| 3300012930|Ga0137407_12037393 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012944|Ga0137410_10620893 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300012955|Ga0164298_10039310 | All Organisms → cellular organisms → Bacteria | 2194 | Open in IMG/M |
| 3300012957|Ga0164303_10023073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2435 | Open in IMG/M |
| 3300012961|Ga0164302_10881129 | Not Available | 685 | Open in IMG/M |
| 3300012971|Ga0126369_10421911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1377 | Open in IMG/M |
| 3300012971|Ga0126369_11337641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 806 | Open in IMG/M |
| 3300012975|Ga0134110_10629139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 501 | Open in IMG/M |
| 3300012989|Ga0164305_11784632 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014326|Ga0157380_11719363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 685 | Open in IMG/M |
| 3300014865|Ga0180078_1042021 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300014968|Ga0157379_11625174 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300015358|Ga0134089_10277002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 692 | Open in IMG/M |
| 3300015373|Ga0132257_103471318 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300016294|Ga0182041_10612152 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300016294|Ga0182041_11982077 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300016357|Ga0182032_11594260 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300016371|Ga0182034_10898537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 762 | Open in IMG/M |
| 3300016371|Ga0182034_11354291 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300016387|Ga0182040_10410062 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300016404|Ga0182037_11200423 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300016422|Ga0182039_11825785 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300016445|Ga0182038_10062354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2548 | Open in IMG/M |
| 3300018075|Ga0184632_10190265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 904 | Open in IMG/M |
| 3300018081|Ga0184625_10478354 | Not Available | 633 | Open in IMG/M |
| 3300018429|Ga0190272_10812356 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 863 | Open in IMG/M |
| 3300018431|Ga0066655_11071389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300018468|Ga0066662_11675693 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300018476|Ga0190274_12060472 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300019356|Ga0173481_10343585 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300020579|Ga0210407_10773175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 742 | Open in IMG/M |
| 3300020583|Ga0210401_10258568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1601 | Open in IMG/M |
| 3300021082|Ga0210380_10355765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300021082|Ga0210380_10529173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300021086|Ga0179596_10387421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 704 | Open in IMG/M |
| 3300021086|Ga0179596_10393896 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300021171|Ga0210405_11384217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300021178|Ga0210408_10913599 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300021407|Ga0210383_11502223 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021432|Ga0210384_10911551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 779 | Open in IMG/M |
| 3300021475|Ga0210392_10491036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 904 | Open in IMG/M |
| 3300021479|Ga0210410_10687017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 905 | Open in IMG/M |
| 3300021861|Ga0213853_11620361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 555 | Open in IMG/M |
| 3300022726|Ga0242654_10068130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1052 | Open in IMG/M |
| 3300023058|Ga0193714_1022936 | Not Available | 922 | Open in IMG/M |
| 3300025915|Ga0207693_10082838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2512 | Open in IMG/M |
| 3300025918|Ga0207662_11078586 | Not Available | 571 | Open in IMG/M |
| 3300026075|Ga0207708_10098524 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
| 3300026277|Ga0209350_1028604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1674 | Open in IMG/M |
| 3300026277|Ga0209350_1072176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 956 | Open in IMG/M |
| 3300026313|Ga0209761_1305789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23 | 550 | Open in IMG/M |
| 3300026537|Ga0209157_1028429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3280 | Open in IMG/M |
| 3300027324|Ga0209845_1011291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1502 | Open in IMG/M |
| 3300027512|Ga0209179_1092712 | Not Available | 670 | Open in IMG/M |
| 3300027787|Ga0209074_10083067 | Not Available | 1051 | Open in IMG/M |
| 3300027842|Ga0209580_10205181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 978 | Open in IMG/M |
| 3300027869|Ga0209579_10099467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1541 | Open in IMG/M |
| 3300027880|Ga0209481_10188860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1027 | Open in IMG/M |
| 3300027882|Ga0209590_10511667 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300027903|Ga0209488_10959514 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300027952|Ga0209889_1083562 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300028047|Ga0209526_10645887 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300028536|Ga0137415_10105772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2664 | Open in IMG/M |
| 3300028536|Ga0137415_11385450 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300028754|Ga0307297_10308787 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028782|Ga0307306_10081367 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300028812|Ga0247825_10080963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2183 | Open in IMG/M |
| 3300028872|Ga0307314_10041195 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031093|Ga0308197_10310709 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031572|Ga0318515_10672789 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300031679|Ga0318561_10542649 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031679|Ga0318561_10625447 | Not Available | 592 | Open in IMG/M |
| 3300031679|Ga0318561_10826199 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300031682|Ga0318560_10399872 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031719|Ga0306917_10022850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3892 | Open in IMG/M |
| 3300031719|Ga0306917_10848542 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031740|Ga0307468_101460391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 632 | Open in IMG/M |
| 3300031740|Ga0307468_102496180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 506 | Open in IMG/M |
| 3300031744|Ga0306918_10806942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
| 3300031765|Ga0318554_10372075 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031768|Ga0318509_10231827 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300031770|Ga0318521_10623178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
| 3300031797|Ga0318550_10586451 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031833|Ga0310917_10590727 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300031835|Ga0318517_10491405 | Not Available | 553 | Open in IMG/M |
| 3300031897|Ga0318520_10924122 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031910|Ga0306923_11130996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300031912|Ga0306921_10161375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2624 | Open in IMG/M |
| 3300031947|Ga0310909_11562715 | Not Available | 524 | Open in IMG/M |
| 3300031959|Ga0318530_10022961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 2162 | Open in IMG/M |
| 3300031995|Ga0307409_101768447 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300032001|Ga0306922_12055501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 555 | Open in IMG/M |
| 3300032041|Ga0318549_10377074 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300032044|Ga0318558_10352093 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300032059|Ga0318533_10688973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300032059|Ga0318533_11193820 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae | 557 | Open in IMG/M |
| 3300032068|Ga0318553_10193973 | Not Available | 1058 | Open in IMG/M |
| 3300032094|Ga0318540_10351068 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300032261|Ga0306920_103889289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300032261|Ga0306920_104121245 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300033550|Ga0247829_11179901 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300034257|Ga0370495_0081170 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 995 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.30% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.06% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.49% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.25% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.69% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.12% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.56% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034257 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_127199384 | 3300000789 | Soil | SGTGHGYSTPKNKDEERANAQSLASSARFLKEIFNGE* |
| AF_2010_repII_A001DRAFT_100393742 | 3300000793 | Forest Soil | TGHGFSTPKNKAEERANAQSIASTARTLKELFGTGLPGLP* |
| JGI1027J12803_1089512382 | 3300000955 | Soil | VPFQLEVYSGTGHGFSTPKNKAEERANTQSIASTARTLKELFGI* |
| JGI10216J12902_1217743511 | 3300000956 | Soil | EVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI* |
| JGI12053J15887_102694523 | 3300001661 | Forest Soil | GTGHGFSTPKNKAEERANAQSIGTTARTLKELFGI* |
| JGIcombinedJ26739_1010717742 | 3300002245 | Forest Soil | KVPFELEVYSGTGHGFSTPKNSAEERANSQSIGTTARTLKELFGI* |
| C688J35102_1198805541 | 3300002568 | Soil | EVYSGTGHGFSSPKGKDEERANAQSIATTSRTMKELFGI* |
| Ga0066397_100189211 | 3300004281 | Tropical Forest Soil | EVYSGTGHGFSTPKNKAEERANAQSIASTGRTLKELFGI* |
| Ga0066395_102707913 | 3300004633 | Tropical Forest Soil | FQLEVYSGTGHGFSTPKNKAEERANVQSIASTARTLKELFGI* |
| Ga0066672_102861572 | 3300005167 | Soil | AKVRFELEVYSGTGHGFSAPKNKDEERANTESIATTARTLKELFGT* |
| Ga0066683_102536021 | 3300005172 | Soil | QYELYSGAGHGFSTPKDKAEERANVQSIASTERFLKEVFAR* |
| Ga0066388_1012532891 | 3300005332 | Tropical Forest Soil | AKVPFQLEVYSGTGHGFSTPKNKAEERANVQSIASTARTLKELFGI* |
| Ga0066388_1059245841 | 3300005332 | Tropical Forest Soil | PFQLEVYSGTGHGFSSPKNKAEERANEQSIASTGRTLKELFGI* |
| Ga0066388_1061206571 | 3300005332 | Tropical Forest Soil | LKAAKTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGA* |
| Ga0070711_1009924141 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EVYSGTGHGFSTPKNKAEERANTQSIAATARTLKELFGI* |
| Ga0070698_1004868381 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EVYSGTGHGFSTPKNKAEERANAQSIASATRTLKELFGI* |
| Ga0066661_103300233 | 3300005554 | Soil | EVYSGTGHGFSTPKNKAEERANAQSIGTTARTLKELFGI* |
| Ga0066699_112870162 | 3300005561 | Soil | LEVYSGTGHGFSTPKNKDEERANTQSIATTARTFKELFGI* |
| Ga0066691_107447442 | 3300005586 | Soil | GTGHGFSTPKNKAEERANEQSIGTTARTLKELFGI* |
| Ga0066905_1004979562 | 3300005713 | Tropical Forest Soil | LRGAKVPFQLEVYSGTGHGFSTPKNKAEERANVQSIASTARTLKELFGI* |
| Ga0066905_1019704212 | 3300005713 | Tropical Forest Soil | VPFELEVYSGTGHGFSTPKNPAEERANAQSIAATTRTLKEVFGPRGGI* |
| Ga0066903_1054571392 | 3300005764 | Tropical Forest Soil | RAAKIGWQLELYSGTKHGFSTPKNADEERANAQSQAAMARFFKEVFGI* |
| Ga0066903_1055067533 | 3300005764 | Tropical Forest Soil | GTGHGFSTPKNKAEERANAQSIASTARTLKELFGI* |
| Ga0066903_1061828193 | 3300005764 | Tropical Forest Soil | AKVPFQLEVYSGTGHGFSTPKNKAEERANTQSIAATARTLKELFGI* |
| Ga0075024_1008618871 | 3300006047 | Watersheds | YSGAEHGFSTPKNKAEERANSRSIEATDRYLKETFGI* |
| Ga0075018_102246863 | 3300006172 | Watersheds | LEVYSGTGHGFSTPKGSSEERANTQSIGTTARTLKELFGS* |
| Ga0070712_1000085511 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0075428_1007020212 | 3300006844 | Populus Rhizosphere | ANVPFQVEIYGGVGHGFYKPANKAEERALELSFASTARNLREVFGD* |
| Ga0075421_1025421602 | 3300006845 | Populus Rhizosphere | LRKAKVDFHYELYSGADHGFSTPQNAAEERANVQSIASSTRYLKEVFGR* |
| Ga0075421_1026521852 | 3300006845 | Populus Rhizosphere | YSGTGHGFSTPKNKDEERANAQSIASTARTLKELFGI* |
| Ga0075419_102159611 | 3300006969 | Populus Rhizosphere | RGAKVPFQLEVYSGTGHGFSTPKNKAEERANVQSIASTARTLKELFGI* |
| Ga0099828_117201141 | 3300009089 | Vadose Zone Soil | PFQLEVYSGTGHGFSTPKNKDEERANAQSIASTARTLKELFGI* |
| Ga0075418_127308801 | 3300009100 | Populus Rhizosphere | VPFQLEVYSGTGHGYSTPKNKDEERANAQSLASSARFLKEIFNGE* |
| Ga0099792_105732001 | 3300009143 | Vadose Zone Soil | KIDWQFELYSGTKHGFSTPKNADEERANAQSQGSMARFFKEVFGI* |
| Ga0114129_135255432 | 3300009147 | Populus Rhizosphere | YSGAGHGFYRPVGRDNERALEQSIASTTRMLREVFGP* |
| Ga0111538_119665381 | 3300009156 | Populus Rhizosphere | EVYSGAGHGFSSPKGQDNERANAQSIASTARNLREVFGE* |
| Ga0103869_101592641 | 3300009257 | River Water | EVYSGTEHGFSTPKNKDEERANTQSIAAASRTMKDLFGM* |
| Ga0126307_101775341 | 3300009789 | Serpentine Soil | QVELYSGTAHGFSRPKNKAEERANAQSIDTTGRTLKELFGI* |
| Ga0126374_111888041 | 3300009792 | Tropical Forest Soil | EVYSGTGHGFSSPKNKAEERANAQSIASTSRTLKELFGS* |
| Ga0126374_114217341 | 3300009792 | Tropical Forest Soil | SGTGHGFSAPKNKAEERANAQSIASTARLFKEVFGN* |
| Ga0126309_112461052 | 3300010039 | Serpentine Soil | QYELYSGAGHGFSTPRNKAEERANVQSVASTERFLKEVFGR* |
| Ga0126380_102604711 | 3300010043 | Tropical Forest Soil | TGHGFSTPKNKAEERANAQSIASTGRTLKELFGI* |
| Ga0126382_105964611 | 3300010047 | Tropical Forest Soil | WKVPFQLEVYSGTGHGFSTPKNEAEERANAQSIASTARTLKELFGI* |
| Ga0126382_113900682 | 3300010047 | Tropical Forest Soil | AWKVPFQLEVYSGTGHGFSTPKNEAEERANAQSIASTARTLKEPFGI* |
| Ga0134111_101045681 | 3300010329 | Grasslands Soil | SAKVPFQLEVYSGTGHGFSTPKNKAEERANAQSIGTTARTLKELFGI* |
| Ga0134071_100748732 | 3300010336 | Grasslands Soil | EVYSGTGHGFSTPKNKAEERANAQSIDSTARTLKEVFGM* |
| Ga0126376_104569651 | 3300010359 | Tropical Forest Soil | RTGHGFSRPKNKDEERANTQSIETTARTLKELFGT* |
| Ga0126376_121018442 | 3300010359 | Tropical Forest Soil | FQLEVYSGTGHGFSSPRNKAEERANTESVATATRTLRELFGI* |
| Ga0126372_111818952 | 3300010360 | Tropical Forest Soil | KAAKTPFEVELYSGTAHGFSQPKDRAEERAITQAKATTGRTLKELFGV* |
| Ga0126377_101278221 | 3300010362 | Tropical Forest Soil | SGTGHGFSSPKNKAEERANAQSIATTSRTMKELFGI* |
| Ga0126377_114161312 | 3300010362 | Tropical Forest Soil | FQLEVYSGTGHGFSTPKNKDEERANTQSIATTGRTLKELFGI* |
| Ga0126377_132161701 | 3300010362 | Tropical Forest Soil | GFSTPKNKAEERANAQSIASTARTLKELFGTGLPGLP* |
| Ga0126381_10002451011 | 3300010376 | Tropical Forest Soil | WQLELYSGTKHGFSTPKNADEERADAQSRASMARFFKEVFGI* |
| Ga0126381_1029589002 | 3300010376 | Tropical Forest Soil | LRAWKVPFQLEVYSGTGHGFSTPKNKAEVRANAQSIASTARTLKELFGI* |
| Ga0126381_1039447712 | 3300010376 | Tropical Forest Soil | WQLELYSGTKHGFSTPKNADEERADAQSRASMARFFKEVFGS* |
| Ga0126383_105366023 | 3300010398 | Tropical Forest Soil | LYSGTAHGFSQPKDKAEERAITQAKATTGRTLKELFGV* |
| Ga0126383_114475941 | 3300010398 | Tropical Forest Soil | SGTGHGFSSPKNKAEERANAQSIDTTARTLKELFGS* |
| Ga0126383_128898852 | 3300010398 | Tropical Forest Soil | GTGHGFSTPKNKDEERANEQSIGTTARALKELFGI* |
| Ga0137391_104399484 | 3300011270 | Vadose Zone Soil | GTGHGFSSPKNKAEERANAQSIGATARTLKELFGI* |
| Ga0137391_107596353 | 3300011270 | Vadose Zone Soil | EVYSGTGHGFSTPKNKAEERANAQSIGATARTLKELFGI* |
| Ga0137389_101682083 | 3300012096 | Vadose Zone Soil | QVEVYSGTAHGFSTPKNKDEERANAQSIATTARTLKELFGI* |
| Ga0137388_111748511 | 3300012189 | Vadose Zone Soil | SGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI* |
| Ga0137399_101021363 | 3300012203 | Vadose Zone Soil | EVYSGTGHGFSSPKGKDEERANAQSIASTSRTMKELFGI* |
| Ga0137399_116495121 | 3300012203 | Vadose Zone Soil | EVYSGTGHGFSSPKNKAEERANAQSIGATARTLKELFGI* |
| Ga0137367_109669741 | 3300012353 | Vadose Zone Soil | SGTGHGFSTPKNKAEERANAQSIGATARTLKELFGI* |
| Ga0137371_103523604 | 3300012356 | Vadose Zone Soil | EVYSGTGHGFSTPKNKAEERANEQSIGTTARTLKELFGI* |
| Ga0137384_100503171 | 3300012357 | Vadose Zone Soil | LEVYSGTGHGFSTPKNKAEERANAQSIASTTRTLKELFGI* |
| Ga0137384_106501692 | 3300012357 | Vadose Zone Soil | PFQLEVYSGTGHGFSTPKNKAEERANTQSIATTARTFKELFGI* |
| Ga0137384_116022251 | 3300012357 | Vadose Zone Soil | TGHGFSTPKNKAEERANAQSIGATARTLKELFGI* |
| Ga0137360_116950342 | 3300012361 | Vadose Zone Soil | VYSGTGHGFSTPKNKAEERANAQSIDTTARTLKELFGI* |
| Ga0137390_108086051 | 3300012363 | Vadose Zone Soil | SGTGHGFSTPKNKAEERANAQSIGAPARTLKELFGI* |
| Ga0150984_1115586652 | 3300012469 | Avena Fatua Rhizosphere | GTGHGFSSPKGKDEERANAQSIATTSRTMKELFGI* |
| Ga0137397_107104852 | 3300012685 | Vadose Zone Soil | SGTGHGFSSPKGKDEERANAQSIATTSKAFKELFGI* |
| Ga0157291_104032291 | 3300012902 | Soil | EVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0137396_110255641 | 3300012918 | Vadose Zone Soil | SGAGHGFSVPKNKDEERANAQSIATTSRFLKDVFGI* |
| Ga0137413_107876031 | 3300012924 | Vadose Zone Soil | FQLEVYSGTGHGFSTPKNKAEERANAQSIASTGRTLKELFGI* |
| Ga0137407_120373933 | 3300012930 | Vadose Zone Soil | GTGHGFSSPKNQAEERANAQSIASTARTLKEIFGI* |
| Ga0137410_106208932 | 3300012944 | Vadose Zone Soil | VYSGTGHGFSAPKNKSEERANDTSIASTARTFKELFGI* |
| Ga0164298_100393101 | 3300012955 | Soil | GTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0164303_100230731 | 3300012957 | Soil | PFQLEVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0164302_108811292 | 3300012961 | Soil | YSGTGHGFSSPKGKDEERANAQSIGTTSRTMKELFGI* |
| Ga0126369_104219112 | 3300012971 | Tropical Forest Soil | ELYSGTAHGFSQPKDKAEERAITQAKATTGRTLKELFGV* |
| Ga0126369_113376411 | 3300012971 | Tropical Forest Soil | SGTGHGFSTPKNKAEERANAQSIASTARTLKEVFGI* |
| Ga0134110_106291392 | 3300012975 | Grasslands Soil | FQLEVYSGTGHGFSTPKNKAEERANAQSIDSTARTLKEVFGM* |
| Ga0164305_117846322 | 3300012989 | Soil | VPFQLEVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0157380_117193631 | 3300014326 | Switchgrass Rhizosphere | VEVYSGAGHGFSSPKGQDNERANAQSIASTARNLREVFGD* |
| Ga0180078_10420212 | 3300014865 | Soil | PFQLEVYSGTAHGFSAPKNKAEERANAQSIASAARLFKELFGI* |
| Ga0157379_116251742 | 3300014968 | Switchgrass Rhizosphere | VYSGTGHGFSSPKGKDEERANAQSIATTSRAFKELFGI* |
| Ga0134089_102770022 | 3300015358 | Grasslands Soil | YSGTGHGFSTPKNKAEERANAQSIDSTARTLKEVFGM* |
| Ga0132257_1034713181 | 3300015373 | Arabidopsis Rhizosphere | FQLEVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI* |
| Ga0182041_106121521 | 3300016294 | Soil | KVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0182041_119820773 | 3300016294 | Soil | KVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKDLFGI |
| Ga0182032_115942601 | 3300016357 | Soil | LKAAKTPFEVELYSGTAHGFSQPKNKAEERAITQANATTGRTLKELFGV |
| Ga0182034_108985372 | 3300016371 | Soil | VYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0182034_113542911 | 3300016371 | Soil | PFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0182040_104100623 | 3300016387 | Soil | FEFELYSGTGHGFSNPKNKDEERANAESIATTTRTLKQLFGS |
| Ga0182037_112004232 | 3300016404 | Soil | FEVELYSGTAHGFSQPKNKAEERAIAQANATTGRTLKELFGV |
| Ga0182039_118257851 | 3300016422 | Soil | SGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0182038_100623541 | 3300016445 | Soil | QLEVYSGTGHGFSTPKNGAEERANAQSTASTARTLRELFGI |
| Ga0184632_101902652 | 3300018075 | Groundwater Sediment | PFQLEVYSGTGHGFSDPKNKAEERANAQSIASTARTLKELFGI |
| Ga0184625_104783541 | 3300018081 | Groundwater Sediment | EVYSGTGHGFSSPKGKDEERANSQSIATTSRTMKELFGI |
| Ga0190272_108123561 | 3300018429 | Soil | YSGAGHGFSVPKNKAEERANAQSIAATTRFLKEIFGD |
| Ga0066655_110713891 | 3300018431 | Grasslands Soil | YSGTGHGFSTPKNKAEERANAQSIDSTARTLKEVFGM |
| Ga0066662_116756931 | 3300018468 | Grasslands Soil | SGTAHGFSAPKNKAEERAHAQSIDTAARTFKELFGI |
| Ga0190274_120604721 | 3300018476 | Soil | YSGAGHGFSTPKGPDNERANTQSIAATARNLREVFGD |
| Ga0173481_103435851 | 3300019356 | Soil | GAGHGFSTPKGPDNERANTQSIASATRNLREVFGP |
| Ga0210407_107731751 | 3300020579 | Soil | ELKAAKTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0210401_102585681 | 3300020583 | Soil | LYSGTAHGFSQPKNKAEERAITQAKATAGRTLKELFGV |
| Ga0210380_103557652 | 3300021082 | Groundwater Sediment | SGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI |
| Ga0210380_105291731 | 3300021082 | Groundwater Sediment | VYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI |
| Ga0179596_103874212 | 3300021086 | Vadose Zone Soil | ELYSGAGHGFSTPKDKAEERANVQSIASTERFLKEVFAR |
| Ga0179596_103938962 | 3300021086 | Vadose Zone Soil | AKTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0210405_113842172 | 3300021171 | Soil | FEVELYSGTAHGFSEPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0210408_109135991 | 3300021178 | Soil | ELKVAKTPFEVELYSGTAHGFSEPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0210383_115022232 | 3300021407 | Soil | KMPFEVEIYSGTAHGFSEPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0210384_109115511 | 3300021432 | Soil | YSGTAHGFSQPKNKAEERAITQAKATAGRTLKELFGV |
| Ga0210392_104910361 | 3300021475 | Soil | SRVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTTRTLKELFGI |
| Ga0210410_106870171 | 3300021479 | Soil | KTPFEVELYSGTAHGFSEPKNMAEERAITQAKATTGRTLKELFGV |
| Ga0213853_116203611 | 3300021861 | Watersheds | PIELKAAKTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0242654_100681301 | 3300022726 | Soil | KTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0193714_10229362 | 3300023058 | Soil | GTGHGFSSPKGKDEERANAQSIATTSRTMKELFGI |
| Ga0207693_100828381 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGI |
| Ga0207662_110785861 | 3300025918 | Switchgrass Rhizosphere | VYSGAGHGFSSPKGQDNERANTQSIASTARNLREVFGD |
| Ga0207708_100985241 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | KVPFQLEVYSGTGHAFSTPKNKDEERANAQSIASTGRTLKELFGI |
| Ga0209350_10286041 | 3300026277 | Grasslands Soil | EVYSGTGHGFSTPKNKAEERANAQSIASTTRTLKELFGI |
| Ga0209350_10721763 | 3300026277 | Grasslands Soil | EVYSGTGHGFSTPKNKAEERANAQSIGATARTLKELFGI |
| Ga0209761_13057892 | 3300026313 | Grasslands Soil | SGTGHGFSTPKNKAEERANAQSIGATARTLKELFGI |
| Ga0209157_10284294 | 3300026537 | Soil | QLEVYSGTGHGFSTPKNKAEERANAQSIDSTARTLKEVFGM |
| Ga0209845_10112911 | 3300027324 | Groundwater Sand | PFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLREVFGL |
| Ga0209179_10927122 | 3300027512 | Vadose Zone Soil | VPFQLEVYSGTGHGFSSPKGKDEERANAQSIASTSRTMKELFGI |
| Ga0209074_100830671 | 3300027787 | Agricultural Soil | EVYSGTGHGFSIPKGKDEERANAQSIGTTSRTMKELFGI |
| Ga0209580_102051812 | 3300027842 | Surface Soil | KVPFELEVYSGTAHGFSTPKNKAEERANATSIATTARTLKELFGI |
| Ga0209579_100994673 | 3300027869 | Surface Soil | EVELYSGTKHGFSQPKNEAEKRAITQAKATTGRTLKELFGV |
| Ga0209481_101888602 | 3300027880 | Populus Rhizosphere | AKVPFQLEVYSGTGHGFSTPKNKAEERANVQSIASTARTLKELFGI |
| Ga0209590_105116671 | 3300027882 | Vadose Zone Soil | YSGTGHGFSTPKNKDEERANAQSIASTARTLKELFGI |
| Ga0209488_109595141 | 3300027903 | Vadose Zone Soil | YSGTGHGFSTPKNKAEERANAQSIGATARTLKELFGI |
| Ga0209889_10835621 | 3300027952 | Groundwater Sand | EIYSGSGHGFSTPKNKDEERANTQSISSTARTMKEVFGM |
| Ga0209526_106458872 | 3300028047 | Forest Soil | KTPFEVELYSGTAHGFSEPKNKAEERAITQAKATAGRTLKELFGV |
| Ga0137415_101057721 | 3300028536 | Vadose Zone Soil | KTPFQLEVYSGTGHGFSSPKGKDEERANSQSIATTSRTMKELFGI |
| Ga0137415_113854501 | 3300028536 | Vadose Zone Soil | EVYSGTGHGFSSPKNKAEEHANAESIATTTRTLKELFGS |
| Ga0307297_103087872 | 3300028754 | Soil | MVPFQLEVYSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGM |
| Ga0307306_100813673 | 3300028782 | Soil | GTGHGFSTPKNKDEERANAQSIASTGRTLKELFGM |
| Ga0247825_100809631 | 3300028812 | Soil | YSGAGHGFSTPKGPDNERANTQSIASATRNLREVFGP |
| Ga0307314_100411951 | 3300028872 | Soil | YSGTGHGFSTPKNKDEERANAQSIASTGRTLKELFGM |
| Ga0308197_103107092 | 3300031093 | Soil | VYSGTGHGFSSPKGKDEERANAQSIATTSRTMKELFGI |
| Ga0318515_106727892 | 3300031572 | Soil | RAWKVPFQLEVYSGTGHGFSTPKNGAEERANAQSTASTARTLRELFGI |
| Ga0318561_105426491 | 3300031679 | Soil | LEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0318561_106254472 | 3300031679 | Soil | VPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0318561_108261992 | 3300031679 | Soil | FQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0318560_103998721 | 3300031682 | Soil | AWKVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0306917_100228505 | 3300031719 | Soil | AARVEFQYELYSGAEHGFSTPRNKAEERANAQSIAATARFLKESFGM |
| Ga0306917_108485423 | 3300031719 | Soil | WKVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0307468_1014603911 | 3300031740 | Hardwood Forest Soil | ELYSGTAHGFSQPKNKAEERAIAQAKATTGRTLKELFGV |
| Ga0307468_1024961801 | 3300031740 | Hardwood Forest Soil | EVYSGTGHGYSTPKNKDEERANAQSLVSSARFLKQVFNGE |
| Ga0306918_108069421 | 3300031744 | Soil | VELYSGTAHGFSQPKDKAEERAITQAKATTGRTLKELFGV |
| Ga0318554_103720752 | 3300031765 | Soil | PFEFELYSGTGHGFSNPKNKDEERANAESIVTTTRTLKQLFGS |
| Ga0318509_102318271 | 3300031768 | Soil | FQLEVYSGTGHGFSTPKNEAEERANAQSIASTARTLKELFGI |
| Ga0318521_106231782 | 3300031770 | Soil | LYSGAEHGFSTPRNKAEERANAQSIAATARFLKESFGM |
| Ga0318550_105864512 | 3300031797 | Soil | VELYSGTAHGFSQPKNKAEERAITQANATTGQTLKELFGV |
| Ga0310917_105907271 | 3300031833 | Soil | EVYSGTGHGFSTPKNGAEERANAQSTASTARTLRELFGI |
| Ga0318517_104914052 | 3300031835 | Soil | QLEVYSGTGHGFSTPKNKAEERANAQSIASTVRTLKELFGI |
| Ga0318520_109241222 | 3300031897 | Soil | TSNWKVPFQLEVYSGTGHGFSTPKNEAEERANAQSIASTARTLKELFGI |
| Ga0306923_111309962 | 3300031910 | Soil | WKVPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKDLFGI |
| Ga0306921_101613751 | 3300031912 | Soil | FELYSGTGHGFSNPKNKDEERANAESIVTTTRTLKQLFGS |
| Ga0310909_115627151 | 3300031947 | Soil | YSGTAHGFSQPKNKAEERAITQANATTGRTLKELFGV |
| Ga0318530_100229611 | 3300031959 | Soil | AWKVPFQLEVYSSTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0307409_1017684472 | 3300031995 | Rhizosphere | GAGHGFSVPKNKAEERANAQSIAATARFLKETFGE |
| Ga0306922_120555011 | 3300032001 | Soil | KAAQTPFEVELYSGTAHGFSQPKNKAEERAITQAKATTGRTLKELFGV |
| Ga0318549_103770742 | 3300032041 | Soil | YSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0318558_103520931 | 3300032044 | Soil | ELRTWKTPFQLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0318533_106889731 | 3300032059 | Soil | VYSGTGHGFSTPKNKAEERANAQSIASTGRTLKELFGI |
| Ga0318533_111938202 | 3300032059 | Soil | VYSGTAHGFSTPKNKDEERANATSIATTARTLKELFGI |
| Ga0318553_101939732 | 3300032068 | Soil | YSGAGHGFSTPRNKAEERANAQSIAATARFLKESFGM |
| Ga0318540_103510681 | 3300032094 | Soil | QLEVYSGTGHGFSTPKNKAEERANAQSIASTARTLKELFGI |
| Ga0306920_1038892892 | 3300032261 | Soil | AQRPFQLEVYSGTGHGFSSPKNKDEERANAQSIDTTARTLKELFGS |
| Ga0306920_1041212452 | 3300032261 | Soil | VYSGTGHGFSTPKNKAEERANAQSIASTARTLKDLFGI |
| Ga0247829_111799012 | 3300033550 | Soil | SGTGHGFSAPKNKAEERANARSIESAARTLKELFGI |
| Ga0370495_0081170_880_993 | 3300034257 | Untreated Peat Soil | YSGTGHGFSTPKNKAEERANVQSIDSTARTLKELFGN |
| ⦗Top⦘ |