


| Basic Information | |
|---|---|
| Family ID | F033197 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.83 % |
| % of genes near scaffold ends (potentially truncated) | 19.66 % |
| % of genes from short scaffolds (< 2000 bps) | 83.15 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.360 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.045 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.281 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.067 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.03% β-sheet: 0.00% Coil/Unstructured: 46.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF08734 | GYD | 3.37 |
| PF00571 | CBS | 2.81 |
| PF00501 | AMP-binding | 1.69 |
| PF03466 | LysR_substrate | 1.69 |
| PF00550 | PP-binding | 1.12 |
| PF00583 | Acetyltransf_1 | 1.12 |
| PF07045 | DUF1330 | 1.12 |
| PF16861 | Carbam_trans_C | 1.12 |
| PF00126 | HTH_1 | 1.12 |
| PF01925 | TauE | 0.56 |
| PF03401 | TctC | 0.56 |
| PF04392 | ABC_sub_bind | 0.56 |
| PF16177 | ACAS_N | 0.56 |
| PF12071 | DUF3551 | 0.56 |
| PF14403 | CP_ATPgrasp_2 | 0.56 |
| PF02652 | Lactate_perm | 0.56 |
| PF08379 | Bact_transglu_N | 0.56 |
| PF00486 | Trans_reg_C | 0.56 |
| PF12146 | Hydrolase_4 | 0.56 |
| PF02682 | CT_C_D | 0.56 |
| PF01161 | PBP | 0.56 |
| PF01381 | HTH_3 | 0.56 |
| PF01032 | FecCD | 0.56 |
| PF13454 | NAD_binding_9 | 0.56 |
| PF13230 | GATase_4 | 0.56 |
| PF02518 | HATPase_c | 0.56 |
| PF09339 | HTH_IclR | 0.56 |
| PF03171 | 2OG-FeII_Oxy | 0.56 |
| PF01977 | UbiD | 0.56 |
| PF01207 | Dus | 0.56 |
| PF00291 | PALP | 0.56 |
| PF00884 | Sulfatase | 0.56 |
| PF01068 | DNA_ligase_A_M | 0.56 |
| PF00171 | Aldedh | 0.56 |
| PF01814 | Hemerythrin | 0.56 |
| PF01844 | HNH | 0.56 |
| PF01928 | CYTH | 0.56 |
| PF00490 | ALAD | 0.56 |
| PF03734 | YkuD | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 3.37 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 1.12 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.56 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 0.56 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.56 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.56 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.56 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.56 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.56 |
| COG2049 | 5-oxoprolinase subunit B/Allophanate hydrolase subunit 1 | Amino acid transport and metabolism [E] | 0.56 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.56 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.56 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.36 % |
| All Organisms | root | All Organisms | 37.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459023|GZGNO2B01DD52U | Not Available | 507 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1002165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3151 | Open in IMG/M |
| 3300000580|AF_2010_repII_A01DRAFT_1005969 | Not Available | 1979 | Open in IMG/M |
| 3300005332|Ga0066388_100671848 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300005434|Ga0070709_11187576 | Not Available | 613 | Open in IMG/M |
| 3300005533|Ga0070734_10000376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 100573 | Open in IMG/M |
| 3300005560|Ga0066670_10287562 | Not Available | 999 | Open in IMG/M |
| 3300005764|Ga0066903_100479786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2095 | Open in IMG/M |
| 3300005764|Ga0066903_101137483 | Not Available | 1443 | Open in IMG/M |
| 3300005764|Ga0066903_101191579 | Not Available | 1413 | Open in IMG/M |
| 3300005764|Ga0066903_101319715 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300005764|Ga0066903_101715924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1196 | Open in IMG/M |
| 3300005764|Ga0066903_106285229 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006028|Ga0070717_10276358 | Not Available | 1489 | Open in IMG/M |
| 3300006028|Ga0070717_11145992 | Not Available | 708 | Open in IMG/M |
| 3300006028|Ga0070717_11929168 | Not Available | 533 | Open in IMG/M |
| 3300006041|Ga0075023_100121250 | Not Available | 930 | Open in IMG/M |
| 3300006047|Ga0075024_100440274 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300006052|Ga0075029_100082706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1903 | Open in IMG/M |
| 3300006057|Ga0075026_100435781 | Not Available | 743 | Open in IMG/M |
| 3300006057|Ga0075026_100657594 | Not Available | 622 | Open in IMG/M |
| 3300006059|Ga0075017_100974258 | Not Available | 660 | Open in IMG/M |
| 3300006059|Ga0075017_101131241 | Not Available | 612 | Open in IMG/M |
| 3300006086|Ga0075019_10760594 | Not Available | 616 | Open in IMG/M |
| 3300006102|Ga0075015_100271599 | Not Available | 924 | Open in IMG/M |
| 3300006102|Ga0075015_100794739 | Not Available | 568 | Open in IMG/M |
| 3300006102|Ga0075015_101041318 | Not Available | 502 | Open in IMG/M |
| 3300006172|Ga0075018_10494130 | Not Available | 637 | Open in IMG/M |
| 3300006174|Ga0075014_100053469 | Not Available | 1743 | Open in IMG/M |
| 3300006175|Ga0070712_100093477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2207 | Open in IMG/M |
| 3300006175|Ga0070712_100524963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli | 995 | Open in IMG/M |
| 3300006175|Ga0070712_101502670 | Not Available | 588 | Open in IMG/M |
| 3300006800|Ga0066660_11608223 | Not Available | 515 | Open in IMG/M |
| 3300006804|Ga0079221_10028095 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2357 | Open in IMG/M |
| 3300006893|Ga0073928_10074302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2935 | Open in IMG/M |
| 3300009038|Ga0099829_11485249 | Not Available | 560 | Open in IMG/M |
| 3300009137|Ga0066709_103884797 | Not Available | 543 | Open in IMG/M |
| 3300009792|Ga0126374_10039322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2303 | Open in IMG/M |
| 3300009792|Ga0126374_10080259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1781 | Open in IMG/M |
| 3300009792|Ga0126374_10273432 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300009792|Ga0126374_10815204 | Not Available | 715 | Open in IMG/M |
| 3300010047|Ga0126382_10400357 | Not Available | 1071 | Open in IMG/M |
| 3300010048|Ga0126373_10341037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1507 | Open in IMG/M |
| 3300010048|Ga0126373_11578577 | Not Available | 721 | Open in IMG/M |
| 3300010359|Ga0126376_10324017 | Not Available | 1352 | Open in IMG/M |
| 3300010360|Ga0126372_10647496 | Not Available | 1022 | Open in IMG/M |
| 3300010361|Ga0126378_10541276 | Not Available | 1279 | Open in IMG/M |
| 3300010361|Ga0126378_13326671 | Not Available | 511 | Open in IMG/M |
| 3300010366|Ga0126379_10782223 | Not Available | 1053 | Open in IMG/M |
| 3300010376|Ga0126381_100977241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1221 | Open in IMG/M |
| 3300010376|Ga0126381_101362820 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300012198|Ga0137364_10182151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1533 | Open in IMG/M |
| 3300012198|Ga0137364_11162313 | Not Available | 579 | Open in IMG/M |
| 3300012198|Ga0137364_11169240 | Not Available | 577 | Open in IMG/M |
| 3300012207|Ga0137381_10261058 | Not Available | 1506 | Open in IMG/M |
| 3300012208|Ga0137376_10734248 | Not Available | 851 | Open in IMG/M |
| 3300012209|Ga0137379_10226767 | Not Available | 1782 | Open in IMG/M |
| 3300012209|Ga0137379_10958185 | Not Available | 760 | Open in IMG/M |
| 3300012209|Ga0137379_11143266 | Not Available | 685 | Open in IMG/M |
| 3300012285|Ga0137370_10388064 | Not Available | 844 | Open in IMG/M |
| 3300012359|Ga0137385_10587947 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300012971|Ga0126369_13230846 | Not Available | 534 | Open in IMG/M |
| 3300016319|Ga0182033_11370152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300016341|Ga0182035_10050273 | Not Available | 2824 | Open in IMG/M |
| 3300016341|Ga0182035_11993943 | Not Available | 527 | Open in IMG/M |
| 3300016341|Ga0182035_12157715 | Not Available | 505 | Open in IMG/M |
| 3300016357|Ga0182032_10087353 | Not Available | 2161 | Open in IMG/M |
| 3300016422|Ga0182039_10841696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300017822|Ga0187802_10010967 | All Organisms → cellular organisms → Bacteria | 2927 | Open in IMG/M |
| 3300017822|Ga0187802_10026145 | Not Available | 2044 | Open in IMG/M |
| 3300017822|Ga0187802_10028424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1970 | Open in IMG/M |
| 3300017822|Ga0187802_10089107 | Not Available | 1155 | Open in IMG/M |
| 3300017823|Ga0187818_10537642 | Not Available | 526 | Open in IMG/M |
| 3300017924|Ga0187820_1034491 | Not Available | 1324 | Open in IMG/M |
| 3300017924|Ga0187820_1280130 | Not Available | 543 | Open in IMG/M |
| 3300017943|Ga0187819_10103012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8 | 1705 | Open in IMG/M |
| 3300017955|Ga0187817_10230194 | Not Available | 1181 | Open in IMG/M |
| 3300017955|Ga0187817_10775767 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300017959|Ga0187779_10757157 | Not Available | 660 | Open in IMG/M |
| 3300017961|Ga0187778_10180854 | Not Available | 1339 | Open in IMG/M |
| 3300017970|Ga0187783_10041428 | Not Available | 3411 | Open in IMG/M |
| 3300017970|Ga0187783_10142048 | Not Available | 1769 | Open in IMG/M |
| 3300017972|Ga0187781_10672549 | Not Available | 748 | Open in IMG/M |
| 3300017973|Ga0187780_10535201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 838 | Open in IMG/M |
| 3300017974|Ga0187777_10114033 | Not Available | 1784 | Open in IMG/M |
| 3300017994|Ga0187822_10358430 | Not Available | 528 | Open in IMG/M |
| 3300018001|Ga0187815_10111353 | All Organisms → cellular organisms → Bacteria | 1155 | Open in IMG/M |
| 3300018001|Ga0187815_10512268 | Not Available | 514 | Open in IMG/M |
| 3300018007|Ga0187805_10573820 | Not Available | 532 | Open in IMG/M |
| 3300018062|Ga0187784_10000784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 24250 | Open in IMG/M |
| 3300018062|Ga0187784_11154622 | Not Available | 615 | Open in IMG/M |
| 3300018433|Ga0066667_12195193 | Not Available | 514 | Open in IMG/M |
| 3300019888|Ga0193751_1002067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12389 | Open in IMG/M |
| 3300019888|Ga0193751_1009719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5117 | Open in IMG/M |
| 3300019888|Ga0193751_1010359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4931 | Open in IMG/M |
| 3300020010|Ga0193749_1007705 | Not Available | 2088 | Open in IMG/M |
| 3300020581|Ga0210399_10146792 | All Organisms → cellular organisms → Bacteria | 1950 | Open in IMG/M |
| 3300021168|Ga0210406_11297118 | Not Available | 525 | Open in IMG/M |
| 3300021433|Ga0210391_11026627 | Not Available | 642 | Open in IMG/M |
| 3300021560|Ga0126371_10078183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3239 | Open in IMG/M |
| 3300021560|Ga0126371_10117987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2672 | Open in IMG/M |
| 3300021560|Ga0126371_10291446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1756 | Open in IMG/M |
| 3300021560|Ga0126371_10331428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1654 | Open in IMG/M |
| 3300021560|Ga0126371_10997214 | Not Available | 979 | Open in IMG/M |
| 3300022557|Ga0212123_10062885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3268 | Open in IMG/M |
| 3300025915|Ga0207693_10442988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300025939|Ga0207665_11302677 | Not Available | 579 | Open in IMG/M |
| 3300026330|Ga0209473_1244354 | Not Available | 625 | Open in IMG/M |
| 3300026552|Ga0209577_10295255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1210 | Open in IMG/M |
| 3300026552|Ga0209577_10369719 | Not Available | 1047 | Open in IMG/M |
| 3300026896|Ga0207730_1012668 | Not Available | 721 | Open in IMG/M |
| 3300026979|Ga0207817_1016906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas palustris | 796 | Open in IMG/M |
| 3300026997|Ga0207784_1030795 | Not Available | 550 | Open in IMG/M |
| 3300027042|Ga0207766_1030647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300027050|Ga0209325_1005993 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300027680|Ga0207826_1155550 | Not Available | 623 | Open in IMG/M |
| 3300027824|Ga0209040_10464489 | Not Available | 572 | Open in IMG/M |
| 3300027826|Ga0209060_10000061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 294831 | Open in IMG/M |
| 3300027842|Ga0209580_10657910 | Not Available | 518 | Open in IMG/M |
| 3300027874|Ga0209465_10231481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 923 | Open in IMG/M |
| 3300027898|Ga0209067_10119762 | Not Available | 1381 | Open in IMG/M |
| 3300027898|Ga0209067_10828834 | Not Available | 541 | Open in IMG/M |
| 3300027898|Ga0209067_10914892 | Not Available | 516 | Open in IMG/M |
| 3300027910|Ga0209583_10193977 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300027910|Ga0209583_10403937 | Not Available | 651 | Open in IMG/M |
| 3300030844|Ga0075377_11686015 | Not Available | 506 | Open in IMG/M |
| 3300031057|Ga0170834_109479439 | Not Available | 520 | Open in IMG/M |
| 3300031057|Ga0170834_113905066 | Not Available | 812 | Open in IMG/M |
| 3300031128|Ga0170823_12007422 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031128|Ga0170823_12975906 | Not Available | 510 | Open in IMG/M |
| 3300031128|Ga0170823_16098464 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300031128|Ga0170823_16483875 | Not Available | 607 | Open in IMG/M |
| 3300031231|Ga0170824_104144544 | All Organisms → cellular organisms → Bacteria | 3574 | Open in IMG/M |
| 3300031231|Ga0170824_108239543 | Not Available | 559 | Open in IMG/M |
| 3300031231|Ga0170824_118199175 | Not Available | 521 | Open in IMG/M |
| 3300031231|Ga0170824_127945427 | Not Available | 792 | Open in IMG/M |
| 3300031474|Ga0170818_102047501 | Not Available | 702 | Open in IMG/M |
| 3300031474|Ga0170818_104548795 | Not Available | 546 | Open in IMG/M |
| 3300031545|Ga0318541_10063198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1926 | Open in IMG/M |
| 3300031545|Ga0318541_10208085 | Not Available | 1083 | Open in IMG/M |
| 3300031545|Ga0318541_10849116 | Not Available | 509 | Open in IMG/M |
| 3300031573|Ga0310915_10499329 | Not Available | 864 | Open in IMG/M |
| 3300031679|Ga0318561_10486656 | Not Available | 679 | Open in IMG/M |
| 3300031682|Ga0318560_10510719 | Not Available | 651 | Open in IMG/M |
| 3300031708|Ga0310686_119156766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2722 | Open in IMG/M |
| 3300031719|Ga0306917_10439770 | Not Available | 1021 | Open in IMG/M |
| 3300031719|Ga0306917_11417326 | Not Available | 536 | Open in IMG/M |
| 3300031748|Ga0318492_10254484 | Not Available | 908 | Open in IMG/M |
| 3300031768|Ga0318509_10125602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1402 | Open in IMG/M |
| 3300031771|Ga0318546_10227153 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300031879|Ga0306919_10185236 | Not Available | 1539 | Open in IMG/M |
| 3300031879|Ga0306919_10319634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1181 | Open in IMG/M |
| 3300031890|Ga0306925_10122349 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2785 | Open in IMG/M |
| 3300031890|Ga0306925_10418596 | Not Available | 1434 | Open in IMG/M |
| 3300031890|Ga0306925_10522241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1262 | Open in IMG/M |
| 3300031897|Ga0318520_11073878 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031910|Ga0306923_10093139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3392 | Open in IMG/M |
| 3300031910|Ga0306923_11320901 | Not Available | 764 | Open in IMG/M |
| 3300031912|Ga0306921_10033816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5725 | Open in IMG/M |
| 3300031912|Ga0306921_10241397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. SRL28 | 2117 | Open in IMG/M |
| 3300031941|Ga0310912_10114659 | All Organisms → cellular organisms → Bacteria | 2002 | Open in IMG/M |
| 3300031941|Ga0310912_10295323 | Not Available | 1253 | Open in IMG/M |
| 3300031941|Ga0310912_10757108 | Not Available | 751 | Open in IMG/M |
| 3300031945|Ga0310913_10058905 | Not Available | 2525 | Open in IMG/M |
| 3300031946|Ga0310910_10078459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 2400 | Open in IMG/M |
| 3300031947|Ga0310909_10833239 | Not Available | 760 | Open in IMG/M |
| 3300032035|Ga0310911_10847948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 528 | Open in IMG/M |
| 3300032059|Ga0318533_10216329 | Not Available | 1376 | Open in IMG/M |
| 3300032076|Ga0306924_11561678 | Not Available | 697 | Open in IMG/M |
| 3300032180|Ga0307471_100287161 | Not Available | 1724 | Open in IMG/M |
| 3300032180|Ga0307471_100472463 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300032180|Ga0307471_100826124 | Not Available | 1094 | Open in IMG/M |
| 3300032180|Ga0307471_101632970 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300032261|Ga0306920_103664950 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300032261|Ga0306920_104252985 | Not Available | 515 | Open in IMG/M |
| 3300033289|Ga0310914_11277640 | Not Available | 636 | Open in IMG/M |
| 3300033290|Ga0318519_10445803 | Not Available | 775 | Open in IMG/M |
| 3300033290|Ga0318519_10647900 | Not Available | 644 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.24% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 10.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.87% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 7.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.18% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.25% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.81% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.69% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.12% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000580 | Forest soil microbial communities from Amazon forest - 2010 replicate II A01 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300026997 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 66 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FA3_01963740 | 2170459023 | Grass Soil | MNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW |
| AF_2010_repII_A01DRAFT_10021652 | 3300000580 | Forest Soil | MNTQTSNKAGFANNFWVQMTALLVVTVGIIALAAKYIW* |
| AF_2010_repII_A01DRAFT_10059692 | 3300000580 | Forest Soil | MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW* |
| Ga0066388_1006718483 | 3300005332 | Tropical Forest Soil | MIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW* |
| Ga0070709_111875762 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LYSTGYQPKEVIQYETQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW* |
| Ga0070734_1000037612 | 3300005533 | Surface Soil | MTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW* |
| Ga0066670_102875622 | 3300005560 | Soil | MDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW* |
| Ga0066903_1004797863 | 3300005764 | Tropical Forest Soil | MDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW* |
| Ga0066903_1011374832 | 3300005764 | Tropical Forest Soil | MATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW* |
| Ga0066903_1011915793 | 3300005764 | Tropical Forest Soil | MDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW* |
| Ga0066903_1013197152 | 3300005764 | Tropical Forest Soil | MNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW* |
| Ga0066903_1017159241 | 3300005764 | Tropical Forest Soil | MNTQITSKRSFANNFWLQAAALVVMTLVVIALAANYVW* |
| Ga0066903_1062852291 | 3300005764 | Tropical Forest Soil | MNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW* |
| Ga0070717_102763582 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQIRNTGGFTNNFWVQMAALVIVSLAVIAVAAKYIW* |
| Ga0070717_111459923 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTQIAPKSGFANNVWVQMAALVIVTIVVIALAAKYIW* |
| Ga0070717_119291681 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQIRSTGGLANNFWVQMAALIVVVAVLIALAAKYLW* |
| Ga0075023_1001212502 | 3300006041 | Watersheds | MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW* |
| Ga0075024_1004402741 | 3300006047 | Watersheds | MNTQIRNTDGFTNSFWVQIAALVIVTLAVIALAAKYIW* |
| Ga0075029_1000827062 | 3300006052 | Watersheds | MDTQITPKGGVANNVWVQMAALVIVTIVVIALAAKYIW* |
| Ga0075026_1004357813 | 3300006057 | Watersheds | LLDRCVPSGHRLKGGNRAMNTQIRNKGGFTNNFWVQMAALVIVTLAVIALAAKYIW* |
| Ga0075026_1006575941 | 3300006057 | Watersheds | MDTQTTPKSGFARNFWVQMAALVIVTIVVIALAAKYIW* |
| Ga0075017_1009742582 | 3300006059 | Watersheds | MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW* |
| Ga0075017_1011312411 | 3300006059 | Watersheds | MDTQITRKSGFANKFWVQMAALVIVTIVVIALAAKYIW* |
| Ga0075019_107605942 | 3300006086 | Watersheds | LTMNTQITTKQGFTNNFWVQMAAMVILTVVVIALAAKYIW* |
| Ga0075015_1002715991 | 3300006102 | Watersheds | MDTQIPRKSGFANNFWVQMAALVVVTIAVIALAAKYIW* |
| Ga0075015_1007947391 | 3300006102 | Watersheds | MDTQIAPKSGFANNVWVQMAAMVILTVVVIALAAKYIW |
| Ga0075015_1010413181 | 3300006102 | Watersheds | QIPPQKRGFANNVWVQMAALVIVTIVVIALAAKYIW* |
| Ga0075018_104941301 | 3300006172 | Watersheds | MNTQIFNKGGLAGNFWLQIAALVIVTLVVIALASKYVW* |
| Ga0075014_1000534695 | 3300006174 | Watersheds | MNTQIFNKGGFADNFWVQMAALVIVTLVVIALAAKYVW* |
| Ga0070712_1000934775 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQTSNKAGFTNNFWVQMAALVIVTVVIIALAAKYIW* |
| Ga0070712_1005249632 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNTQITRKSGFANNFWVQMAALVIVTIVVIAIAAKYVW* |
| Ga0070712_1015026701 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW* |
| Ga0066660_116082232 | 3300006800 | Soil | MNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW* |
| Ga0079221_100280952 | 3300006804 | Agricultural Soil | MNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW* |
| Ga0073928_100743024 | 3300006893 | Iron-Sulfur Acid Spring | MNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW* |
| Ga0099829_114852491 | 3300009038 | Vadose Zone Soil | MDTRADSRRGFVNNLWVQMAALVIVVLVLLALAAKYIW* |
| Ga0066709_1038847971 | 3300009137 | Grasslands Soil | MNTQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW* |
| Ga0126374_100393222 | 3300009792 | Tropical Forest Soil | MNTQIGNTSGFANNIWVQMAALVIVVGGLIALAAKYIW* |
| Ga0126374_100802593 | 3300009792 | Tropical Forest Soil | MDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW* |
| Ga0126374_102734321 | 3300009792 | Tropical Forest Soil | MNTQISNKAGFANNFWVQVTALIVVTVVIIALAAKYIW* |
| Ga0126374_108152042 | 3300009792 | Tropical Forest Soil | MATQITSKHGFTDNLWLQMVALVIVTLVVIALAAEYVW* |
| Ga0126382_104003572 | 3300010047 | Tropical Forest Soil | MATQITSKHGFTDNLWLQMAALVIVTLVVITLAAEYVW* |
| Ga0126373_103410373 | 3300010048 | Tropical Forest Soil | MATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW* |
| Ga0126373_115785771 | 3300010048 | Tropical Forest Soil | MATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW* |
| Ga0126376_103240172 | 3300010359 | Tropical Forest Soil | MDSQITSKSGLANDFWLQMAALTILTIVVIALAAKYVW* |
| Ga0126372_106474962 | 3300010360 | Tropical Forest Soil | MATQITSNHGFTDNLWLQMAALVIVTLVVIALAAEYVW* |
| Ga0126378_105412762 | 3300010361 | Tropical Forest Soil | MATQITSKHGFADNFWLQMAALVIVTLIVIALAAEYVW* |
| Ga0126378_133266711 | 3300010361 | Tropical Forest Soil | MNTQITGKRSFANNFWLQAAALVVVTLVVIALAANYV |
| Ga0126379_107822231 | 3300010366 | Tropical Forest Soil | MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW* |
| Ga0126381_1009772411 | 3300010376 | Tropical Forest Soil | MDTQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW* |
| Ga0126381_1013628201 | 3300010376 | Tropical Forest Soil | MPTQINKGGFTNNVWVQMAALGVITVIIIALAAKYIW* |
| Ga0137364_101821511 | 3300012198 | Vadose Zone Soil | SMNTQIFKKGGLANNFWVQMAALVIVTLVVIALAANYIW* |
| Ga0137364_111623132 | 3300012198 | Vadose Zone Soil | VIQYESQTFNKGGFANNFWVQMAALVIVTLVVIAFAAKYVW* |
| Ga0137364_111692401 | 3300012198 | Vadose Zone Soil | MDAWADRKSGFANNFWVPIAALVIVVVVIIALAAKYIW* |
| Ga0137381_102610581 | 3300012207 | Vadose Zone Soil | MNTQIRNTDGFANNFWVQMAALVVVVAVVIVLAAKYVW* |
| Ga0137376_107342482 | 3300012208 | Vadose Zone Soil | MNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW* |
| Ga0137379_102267673 | 3300012209 | Vadose Zone Soil | MNTQIRNTGGFANNFWVQMAALVVVVAVVIVLAAKYVW* |
| Ga0137379_109581851 | 3300012209 | Vadose Zone Soil | MNTQIFKKGGFANNFWVQMAALVIVTLVVIALAAKYVW* |
| Ga0137379_111432662 | 3300012209 | Vadose Zone Soil | MDTKADSRSGFVNKLWVQMAALVIVVLVLIALATKYIW* |
| Ga0137370_103880642 | 3300012285 | Vadose Zone Soil | MNTQIRNIGGLANNFWVQMAALVIVTLVVIALAANYIW* |
| Ga0137385_105879474 | 3300012359 | Vadose Zone Soil | MDTRADSRSGFVNKLWVQMAALVIVVLVLIALAAKYIW* |
| Ga0126369_132308461 | 3300012971 | Tropical Forest Soil | MNTQITSKRSFANNFWLQAAAMVVVTLVVIALAANYVW* |
| Ga0182033_113701521 | 3300016319 | Soil | GDPLMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW |
| Ga0182035_100502734 | 3300016341 | Soil | EIRMDTQITHKSGLANNLWVQMAALVIVKNVVIALAAEFIW |
| Ga0182035_119939431 | 3300016341 | Soil | VDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0182035_121577152 | 3300016341 | Soil | MATPITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW |
| Ga0182032_100873532 | 3300016357 | Soil | MDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW |
| Ga0182039_108416961 | 3300016422 | Soil | LMDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW |
| Ga0187802_100109673 | 3300017822 | Freshwater Sediment | MDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW |
| Ga0187802_100261453 | 3300017822 | Freshwater Sediment | MDTPTRQRSGLANNFWLQMAALVIVVAIIIALAAKYIW |
| Ga0187802_100284242 | 3300017822 | Freshwater Sediment | MNTQIRNTGGFINNFWVQMAALVVVTLAVIALAAKYIW |
| Ga0187802_100891071 | 3300017822 | Freshwater Sediment | MDTQITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW |
| Ga0187818_105376422 | 3300017823 | Freshwater Sediment | MDTPTRQKSGLANNFWLQMAALVIVVAIIIALAAKYIW |
| Ga0187820_10344911 | 3300017924 | Freshwater Sediment | MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYIW |
| Ga0187820_12801301 | 3300017924 | Freshwater Sediment | MDTQITPKSGFANNFWVQMAAMVIVTIVVIALEAKY |
| Ga0187819_101030121 | 3300017943 | Freshwater Sediment | MATQITSRHGFTDNFWLQMAGLVIVTLVVIALAAEYIW |
| Ga0187817_102301941 | 3300017955 | Freshwater Sediment | MDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQYIW |
| Ga0187817_107757671 | 3300017955 | Freshwater Sediment | QITPKSGFANNFWVQMAAMVIVTIVVIALAAKYIW |
| Ga0187779_107571571 | 3300017959 | Tropical Peatland | MDTQITRKSGLTNNLWVQMAALVIVTIAVIALAAKFIW |
| Ga0187778_101808543 | 3300017961 | Tropical Peatland | MNMQTKGSLANNFWLQMAALVIVTVVIIALAAKYIW |
| Ga0187783_100414284 | 3300017970 | Tropical Peatland | MNTQIRKRGGLANNFWVQAAALAVVAVVLIALAAKYVW |
| Ga0187783_101420481 | 3300017970 | Tropical Peatland | MDSQTTNKTGLANNFWMQTAALVIVVVVLIALAAKYIW |
| Ga0187781_106725492 | 3300017972 | Tropical Peatland | MNTQTDSKSGLANNLWVQIAALVIVGVVLIVFAAKYIW |
| Ga0187780_105352011 | 3300017973 | Tropical Peatland | MDTQITHKSGLANNLWVQMAALVIVTIAVIALAAKFIW |
| Ga0187777_101140333 | 3300017974 | Tropical Peatland | MNTQLENKGGLTNNFWVQIAALIIVTLVVIALAAKYIW |
| Ga0187822_103584302 | 3300017994 | Freshwater Sediment | MDTQVGNTSGFTNNFWVQIAALVIVTLVVIALAAQY |
| Ga0187815_101113531 | 3300018001 | Freshwater Sediment | MDTQITPKRGFTNNVWVQIAALVIVTIVVIALAAKYIW |
| Ga0187815_105122682 | 3300018001 | Freshwater Sediment | MDTQITRKSGFANNFWVQMTALVIVTIAVIALAAKYVW |
| Ga0187805_105738202 | 3300018007 | Freshwater Sediment | RGGGDSAMDTQITGKSGFANNVWVQMAALVIVTIAVIALAAKYIW |
| Ga0187784_1000078421 | 3300018062 | Tropical Peatland | MNMQTKGSLANNFWLQIAALVIVTVVIIALAAKYIW |
| Ga0187784_111546221 | 3300018062 | Tropical Peatland | MNAQTTHKGGFASSFWLQRAALVVVTVVALAAKYI |
| Ga0066667_121951931 | 3300018433 | Grasslands Soil | MNTQIFNKGGFANNLWVQMAALVIVTLVVIALAAKYVW |
| Ga0193751_10020677 | 3300019888 | Soil | MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYVW |
| Ga0193751_10097192 | 3300019888 | Soil | MNTQADSKSGFAKNFWVQMAALVIVAVVLIALAAKYVW |
| Ga0193751_10103596 | 3300019888 | Soil | MDTQITRKSGFANNFWVQMTALVIVTVVVIALAAKYVW |
| Ga0193749_10077052 | 3300020010 | Soil | MNTQIFNKGGFANNLWVQIAALVIVSLVVIAVAAKYV |
| Ga0210399_101467923 | 3300020581 | Soil | MNAQTSNRTGFANNFWVQMAAMVIVTVVIIALAAKYIW |
| Ga0210406_112971181 | 3300021168 | Soil | MNTQTFNKSGFANSFWVQIAVLVIVTLVVIAVAAKYVW |
| Ga0210391_110266272 | 3300021433 | Soil | MNAQTSNKAGFANNFWVQMAALVVVTVGIIALAAKYIW |
| Ga0126371_100781838 | 3300021560 | Tropical Forest Soil | MATQITSKHGFTDNLWLQMAALVIVTLVVIALAAEYVW |
| Ga0126371_101179871 | 3300021560 | Tropical Forest Soil | MDSQITSKSGLANDFWLQMAALAILTIVVIALAAKYVW |
| Ga0126371_102914463 | 3300021560 | Tropical Forest Soil | MDTRISPKTGFANNAWVQIAALLVLTIVVIALAAKYIW |
| Ga0126371_103314282 | 3300021560 | Tropical Forest Soil | MDTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW |
| Ga0126371_109972143 | 3300021560 | Tropical Forest Soil | MATQITSKHGFTDNFWLQMAALVIVTLVMIALAAEYVW |
| Ga0212123_100628853 | 3300022557 | Iron-Sulfur Acid Spring | MNTQIRNIGSFANNFWVQMAALVVVVAIVIAFAAKYLW |
| Ga0207693_104429881 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQASNKPGFANNLWVQMAALVIVTVVIIALAAKY |
| Ga0207665_113026772 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNTQIFNKGGLAGNFWLQIAALVIVTLVVVALAAKYVW |
| Ga0209473_12443541 | 3300026330 | Soil | MDTQLANKGDITNNFWLQMAALVIVTVAMIALAAKYVW |
| Ga0209577_102952551 | 3300026552 | Soil | MNTQIFNKGGFANNLWVQMATLVIVTLVVVALAAMYVW |
| Ga0209577_103697193 | 3300026552 | Soil | MNTQTFNKGGFANNFWVQIAALVIVTLVVIDVAAKYVW |
| Ga0207730_10126681 | 3300026896 | Tropical Forest Soil | MDTQITHKSGLANNLWVQMAALVFVTIAVIALAAKFIW |
| Ga0207817_10169062 | 3300026979 | Tropical Forest Soil | MDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0207784_10307951 | 3300026997 | Tropical Forest Soil | MATQITSKHGFTDNFWLQMAALVIMTLIVILAAEYVW |
| Ga0207766_10306473 | 3300027042 | Tropical Forest Soil | MDTQITRKSGLANNFWVQMAALVIVTIAVIALAAKFIW |
| Ga0209325_10059932 | 3300027050 | Forest Soil | MNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW |
| Ga0207826_11555502 | 3300027680 | Tropical Forest Soil | MATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYIW |
| Ga0209040_104644891 | 3300027824 | Bog Forest Soil | SSMNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW |
| Ga0209060_1000006197 | 3300027826 | Surface Soil | MTTQAANKNSLANNLWVQMAALIVVTVVIIALAAKYIW |
| Ga0209580_106579101 | 3300027842 | Surface Soil | MSTQAANKNSLANNLWVQMAALIVVTVVVIALAAKYIW |
| Ga0209465_102314812 | 3300027874 | Tropical Forest Soil | MATQITSKHGFADNFWLQMAALVIVTLVVIALAAEYVW |
| Ga0209067_101197623 | 3300027898 | Watersheds | MNTQIFNKGGFANNFWVQMAALVIVTLVVIALAAKYVW |
| Ga0209067_108288341 | 3300027898 | Watersheds | MDTQITRKSGFANNVWVQMAALVIVTIAVIALAAKYI |
| Ga0209067_109148922 | 3300027898 | Watersheds | MATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYV |
| Ga0209583_101939772 | 3300027910 | Watersheds | MNTQTSNKAGFANNFWVQMAALVIVTVAIIALAAKYIW |
| Ga0209583_104039372 | 3300027910 | Watersheds | RPRGGDPAMDTQIPRKSGFANNFWVQMAALVIVTIAVIALAAKYIW |
| Ga0075377_116860151 | 3300030844 | Soil | MNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW |
| Ga0170834_1094794391 | 3300031057 | Forest Soil | MNTQTSNKAGFANNVWMQVAALVVVTVVIIALGAKYIW |
| Ga0170834_1139050661 | 3300031057 | Forest Soil | MNTQTFNKGGFANNFWVQIAVLVIVTLVVIAVAAKYVW |
| Ga0170823_120074222 | 3300031128 | Forest Soil | MNTQIRNIGGLANNFWVQMAALVIVTLVVIAVAANYIW |
| Ga0170823_129759061 | 3300031128 | Forest Soil | MNTQTSNKAGFANNVWMQVAALVVVTVVIIALAAKYIW |
| Ga0170823_160984641 | 3300031128 | Forest Soil | MDTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYLW |
| Ga0170823_164838751 | 3300031128 | Forest Soil | MNTQIFKTGGFANNFWVQMAALVIVTLVVIALAAKYVW |
| Ga0170824_1041445443 | 3300031231 | Forest Soil | MNTQIRNTGGFTNNFWVQMAALVIVTLAVIALAAKYIW |
| Ga0170824_1082395431 | 3300031231 | Forest Soil | MDTQIAPKSGFANNVWVQIAALVIVTIVVIALAAKYIW |
| Ga0170824_1181991752 | 3300031231 | Forest Soil | MNTQIRNTGGFINNFWVQIAALVVVTLAVIALAAKYIW |
| Ga0170824_1279454272 | 3300031231 | Forest Soil | MNTQIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW |
| Ga0170818_1020475011 | 3300031474 | Forest Soil | MDTRIAPKSGFANNFWVQMAALVIVTIVVIALAAKYIW |
| Ga0170818_1045487951 | 3300031474 | Forest Soil | QIRNTGGFTNNFWVQMAALVIVSLAVIALAAKYIW |
| Ga0318541_100631982 | 3300031545 | Soil | MIIQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW |
| Ga0318541_102080851 | 3300031545 | Soil | MATQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW |
| Ga0318541_108491161 | 3300031545 | Soil | MATQIASKHGFTDNLWLQMAALVIVTLVVIALAAEYVW |
| Ga0310915_104993292 | 3300031573 | Soil | MDTQLANKSGLTNNFWVQIAALVILTVVVIALAAEYIW |
| Ga0318561_104866562 | 3300031679 | Soil | MDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0318560_105107191 | 3300031682 | Soil | MNTQIRNTGGLVNNIWVQMAALVIVTLVVIALAAKYIW |
| Ga0310686_1191567663 | 3300031708 | Soil | MSTRIGNKGGFANITWVQLAALVIVPAFLIAVAAKCVWLPT |
| Ga0306917_104397702 | 3300031719 | Soil | MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW |
| Ga0306917_114173261 | 3300031719 | Soil | MNTQTSNKAGLANNFWVQMAAMVVVTVVIIALAAK |
| Ga0318492_102544842 | 3300031748 | Soil | MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYLW |
| Ga0318509_101256021 | 3300031768 | Soil | MATQITSKHGFTDNFWLQRAALVIMTLVVIALAAEYVW |
| Ga0318546_102271531 | 3300031771 | Soil | MDTQISPQTGFTNNAWVQITALVVLTIVVIALAAK |
| Ga0306919_101852363 | 3300031879 | Soil | MATQITSKHGFTDNFWLQMAALVIMTLVVIALAAEYVW |
| Ga0306919_103196342 | 3300031879 | Soil | MNTQTSNKTGFANNFWVQMTALVVVTVLIIALAAKYIW |
| Ga0306925_101223494 | 3300031890 | Soil | MDTQISPKTGFTNNAWVQITALVVLTILVIALAAKYIW |
| Ga0306925_104185961 | 3300031890 | Soil | IRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW |
| Ga0306925_105222411 | 3300031890 | Soil | MDTRISPNPGFANNAWVQIAALLVLTIVVIALAAKYIW |
| Ga0318520_110738782 | 3300031897 | Soil | HMNTQTSNKAGFANNFWVQMAALVVVTVVIIALAAKYIW |
| Ga0306923_100931393 | 3300031910 | Soil | MNTQITSKRSFANNFWLQAAALVVVTLVVIALAANYVW |
| Ga0306923_113209011 | 3300031910 | Soil | MNTQSANKGGLANNLWVQMAALVIVTVVVIALAAKFIW |
| Ga0306921_100338166 | 3300031912 | Soil | MDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW |
| Ga0306921_102413971 | 3300031912 | Soil | MPNRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0310912_101146591 | 3300031941 | Soil | NRGEVIRMDTQITRKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0310912_102953231 | 3300031941 | Soil | LDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW |
| Ga0310912_107571082 | 3300031941 | Soil | VCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAEFIW |
| Ga0310913_100589051 | 3300031945 | Soil | VIRLDTQITHKSGLANNLWVQMAALLIVTIVVIALAAKFIW |
| Ga0310910_100784592 | 3300031946 | Soil | MIREGGDQMNTQTSNKAGLANNFWVQMAALVVVTVVIIALAAKYIW |
| Ga0310909_108332391 | 3300031947 | Soil | FSWITVCPSRGGDNMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0310911_108479481 | 3300032035 | Soil | VDTQITRKSGFVNNFWVQMAALLIVTIAVIALAAKYVW |
| Ga0318533_102163292 | 3300032059 | Soil | MDTQISPQTGFTNNAWVQITALVVLTIVVIALAAKYI |
| Ga0306924_115616781 | 3300032076 | Soil | DMDTQISPKTGFTNNAWVQITALVVLTIIVIALAAKYIW |
| Ga0307471_1002871613 | 3300032180 | Hardwood Forest Soil | MNTQSSNKAGFANNFWVQMAALVIVTVVIIALAAKYIW |
| Ga0307471_1004724633 | 3300032180 | Hardwood Forest Soil | MNTQASNKPGFANNLWVQMAALAIVTVVIIALAAKYIW |
| Ga0307471_1008261242 | 3300032180 | Hardwood Forest Soil | MDTRAGNKSGFASNLWVQMAALVIVVLVLIALAAKYIW |
| Ga0307471_1016329702 | 3300032180 | Hardwood Forest Soil | MNTQISNKAGFANNFWVQMAALVIVTVAIIALAAKYIW |
| Ga0306920_1036649501 | 3300032261 | Soil | MNTQTSNKAGFANNFWVQMTALAVVTVGIIALAAKYIW |
| Ga0306920_1042529852 | 3300032261 | Soil | MPNRGEVIRMDTQITHKSGLANNLWVQMAALVIVTIVVIALAAKFIW |
| Ga0310914_112776402 | 3300033289 | Soil | DTQITRKSGLANNLWVQMAALVIVTIVVIALAVKFIW |
| Ga0318519_104458031 | 3300033290 | Soil | AAQITSKHGFTDNFWLQMAALVIVTLVVIALAAEYVW |
| Ga0318519_106479001 | 3300033290 | Soil | MNTQTSNKAGFANNFWVQMAALVVVTIVIIALAAKYIW |
| ⦗Top⦘ |