


| Basic Information | |
|---|---|
| Family ID | F033166 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DEVLDRQLVALTNQPVRELLDARYEKFRKMGQFFDLGN |
| Number of Associated Samples | 135 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.44 % |
| % of genes from short scaffolds (< 2000 bps) | 87.64 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.079 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.023 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.393 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.315 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.94% β-sheet: 0.00% Coil/Unstructured: 56.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF07238 | PilZ | 3.37 |
| PF03100 | CcmE | 2.81 |
| PF01979 | Amidohydro_1 | 1.12 |
| PF13510 | Fer2_4 | 1.12 |
| PF01578 | Cytochrom_C_asm | 1.12 |
| PF14321 | DUF4382 | 0.56 |
| PF13519 | VWA_2 | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF02633 | Creatininase | 0.56 |
| PF16327 | CcmF_C | 0.56 |
| PF01435 | Peptidase_M48 | 0.56 |
| PF13515 | FUSC_2 | 0.56 |
| PF00005 | ABC_tran | 0.56 |
| PF02843 | GARS_C | 0.56 |
| PF12852 | Cupin_6 | 0.56 |
| PF00762 | Ferrochelatase | 0.56 |
| PF13751 | DDE_Tnp_1_6 | 0.56 |
| PF00691 | OmpA | 0.56 |
| PF12762 | DDE_Tnp_IS1595 | 0.56 |
| PF12760 | Zn_Tnp_IS1595 | 0.56 |
| PF12704 | MacB_PCD | 0.56 |
| PF00781 | DAGK_cat | 0.56 |
| PF08241 | Methyltransf_11 | 0.56 |
| PF03379 | CcmB | 0.56 |
| PF03918 | CcmH | 0.56 |
| PF01814 | Hemerythrin | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 2.81 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.12 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0276 | Protoheme ferro-lyase (ferrochelatase) | Coenzyme transport and metabolism [H] | 0.56 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.56 |
| COG2386 | ABC-type transport system involved in cytochrome c biogenesis, permease component | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3088 | Cytochrome c-type biogenesis protein CcmH/NrfF | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.08 % |
| Unclassified | root | N/A | 12.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01DB4E4 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 2228664022|INPgaii200_c0271777 | Not Available | 596 | Open in IMG/M |
| 2228664022|INPgaii200_c1145238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101895882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300001084|JGI12648J13191_1014267 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300001137|JGI12637J13337_1008266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300001593|JGI12635J15846_10645784 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300001686|C688J18823_10491881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100210083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1838 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100394971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100547671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1034 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100785476 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101265250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101473305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101614997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300002916|JGI25389J43894_1079319 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300004080|Ga0062385_10442532 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005434|Ga0070709_11761759 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005468|Ga0070707_101220422 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005468|Ga0070707_101482637 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300005533|Ga0070734_10181542 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300005542|Ga0070732_10247488 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005554|Ga0066661_10321945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300005554|Ga0066661_10554449 | Not Available | 687 | Open in IMG/M |
| 3300005555|Ga0066692_10593532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300005556|Ga0066707_10982878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005560|Ga0066670_10005078 | All Organisms → cellular organisms → Bacteria | 5161 | Open in IMG/M |
| 3300005566|Ga0066693_10120833 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005568|Ga0066703_10802942 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005764|Ga0066903_108194507 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005993|Ga0080027_10083769 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300006052|Ga0075029_100311247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300006162|Ga0075030_100034936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4275 | Open in IMG/M |
| 3300006174|Ga0075014_100114750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1274 | Open in IMG/M |
| 3300006237|Ga0097621_100010961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6657 | Open in IMG/M |
| 3300006755|Ga0079222_11349023 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006796|Ga0066665_10148464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1776 | Open in IMG/M |
| 3300006796|Ga0066665_11128558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300006904|Ga0075424_100949285 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300007258|Ga0099793_10036940 | Not Available | 2105 | Open in IMG/M |
| 3300007258|Ga0099793_10071246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1571 | Open in IMG/M |
| 3300007265|Ga0099794_10170684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300009038|Ga0099829_11526437 | Not Available | 551 | Open in IMG/M |
| 3300009088|Ga0099830_10408636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300009089|Ga0099828_10483257 | Not Available | 1117 | Open in IMG/M |
| 3300009101|Ga0105247_11573789 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300009137|Ga0066709_102800921 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300009174|Ga0105241_11716653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300009551|Ga0105238_11272400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
| 3300009624|Ga0116105_1121368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010046|Ga0126384_11191515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300010048|Ga0126373_11008043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 898 | Open in IMG/M |
| 3300010159|Ga0099796_10277024 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300010358|Ga0126370_10872227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300010362|Ga0126377_12383698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300010362|Ga0126377_13148756 | Not Available | 533 | Open in IMG/M |
| 3300010375|Ga0105239_10383725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300011269|Ga0137392_10141259 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
| 3300011269|Ga0137392_10954525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300011269|Ga0137392_11540260 | Not Available | 523 | Open in IMG/M |
| 3300011270|Ga0137391_10302003 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300011270|Ga0137391_10438740 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300011271|Ga0137393_10064017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2913 | Open in IMG/M |
| 3300011271|Ga0137393_10168892 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300011271|Ga0137393_11268104 | Not Available | 625 | Open in IMG/M |
| 3300012198|Ga0137364_10609064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300012199|Ga0137383_10092154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2197 | Open in IMG/M |
| 3300012200|Ga0137382_10375926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300012202|Ga0137363_10621332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
| 3300012203|Ga0137399_10408297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300012203|Ga0137399_10556880 | Not Available | 963 | Open in IMG/M |
| 3300012203|Ga0137399_11530831 | Not Available | 554 | Open in IMG/M |
| 3300012210|Ga0137378_10064629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3313 | Open in IMG/M |
| 3300012210|Ga0137378_10584918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300012356|Ga0137371_10230809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1446 | Open in IMG/M |
| 3300012359|Ga0137385_11275147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300012362|Ga0137361_10911610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300012363|Ga0137390_10141741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2385 | Open in IMG/M |
| 3300012363|Ga0137390_10211776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1925 | Open in IMG/M |
| 3300012363|Ga0137390_10361921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1431 | Open in IMG/M |
| 3300012363|Ga0137390_10376300 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1400 | Open in IMG/M |
| 3300012363|Ga0137390_11329936 | Not Available | 664 | Open in IMG/M |
| 3300012582|Ga0137358_10041226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3059 | Open in IMG/M |
| 3300012582|Ga0137358_10322505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1048 | Open in IMG/M |
| 3300012918|Ga0137396_10679469 | Not Available | 760 | Open in IMG/M |
| 3300012922|Ga0137394_10196473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1722 | Open in IMG/M |
| 3300012922|Ga0137394_10223025 | Not Available | 1611 | Open in IMG/M |
| 3300012923|Ga0137359_10149722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2080 | Open in IMG/M |
| 3300012923|Ga0137359_10773325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300012924|Ga0137413_10348722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
| 3300012927|Ga0137416_11737596 | Not Available | 569 | Open in IMG/M |
| 3300012929|Ga0137404_10475523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
| 3300012944|Ga0137410_10142871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1816 | Open in IMG/M |
| 3300012948|Ga0126375_10848958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300012964|Ga0153916_12088259 | Not Available | 636 | Open in IMG/M |
| 3300013306|Ga0163162_11626685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300014201|Ga0181537_10901000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300015054|Ga0137420_1090241 | Not Available | 529 | Open in IMG/M |
| 3300015054|Ga0137420_1327056 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300015241|Ga0137418_10429725 | Not Available | 1071 | Open in IMG/M |
| 3300015245|Ga0137409_10048886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4023 | Open in IMG/M |
| 3300015245|Ga0137409_11013957 | Not Available | 668 | Open in IMG/M |
| 3300016270|Ga0182036_10984199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300016319|Ga0182033_11543295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300016371|Ga0182034_10488290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300016371|Ga0182034_10560984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 959 | Open in IMG/M |
| 3300017948|Ga0187847_10221263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Actibacterium → unclassified Actibacterium → Actibacterium sp. 188UL27-1 | 1031 | Open in IMG/M |
| 3300017995|Ga0187816_10221377 | Not Available | 824 | Open in IMG/M |
| 3300018090|Ga0187770_10270196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1320 | Open in IMG/M |
| 3300019362|Ga0173479_10763268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300019789|Ga0137408_1414403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300020170|Ga0179594_10282170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300020199|Ga0179592_10476500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300020579|Ga0210407_10022672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4666 | Open in IMG/M |
| 3300020579|Ga0210407_10149578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1799 | Open in IMG/M |
| 3300020579|Ga0210407_11312508 | Not Available | 540 | Open in IMG/M |
| 3300020583|Ga0210401_10090180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2883 | Open in IMG/M |
| 3300021088|Ga0210404_10605843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300021168|Ga0210406_10052283 | All Organisms → cellular organisms → Bacteria | 3571 | Open in IMG/M |
| 3300021170|Ga0210400_10070139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2744 | Open in IMG/M |
| 3300021170|Ga0210400_10535481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300021178|Ga0210408_10798696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 739 | Open in IMG/M |
| 3300021180|Ga0210396_10795946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300021180|Ga0210396_10877013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300021432|Ga0210384_10664697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300021433|Ga0210391_10743470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300021475|Ga0210392_10759979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300021477|Ga0210398_10191557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
| 3300021478|Ga0210402_11567207 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300021559|Ga0210409_10280573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1504 | Open in IMG/M |
| 3300021559|Ga0210409_11158968 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300021560|Ga0126371_10124083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2611 | Open in IMG/M |
| 3300022840|Ga0224549_1057043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300024182|Ga0247669_1073658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300024225|Ga0224572_1071785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300025941|Ga0207711_10194908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1847 | Open in IMG/M |
| 3300026281|Ga0209863_10071999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300026301|Ga0209238_1007432 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300026308|Ga0209265_1001876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6322 | Open in IMG/M |
| 3300026309|Ga0209055_1012342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4413 | Open in IMG/M |
| 3300026314|Ga0209268_1015386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2926 | Open in IMG/M |
| 3300026335|Ga0209804_1250430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300026557|Ga0179587_10115163 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1643 | Open in IMG/M |
| 3300027334|Ga0209529_1057441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300027521|Ga0209524_1094904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027565|Ga0209219_1064255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300027643|Ga0209076_1042090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
| 3300027651|Ga0209217_1098562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300027671|Ga0209588_1147750 | Not Available | 746 | Open in IMG/M |
| 3300027671|Ga0209588_1178131 | Not Available | 667 | Open in IMG/M |
| 3300027698|Ga0209446_1027936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
| 3300027727|Ga0209328_10173794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300027767|Ga0209655_10093299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1001 | Open in IMG/M |
| 3300027783|Ga0209448_10262062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300027787|Ga0209074_10451800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300027795|Ga0209139_10001482 | All Organisms → cellular organisms → Bacteria | 8685 | Open in IMG/M |
| 3300027846|Ga0209180_10632483 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027846|Ga0209180_10711208 | Not Available | 545 | Open in IMG/M |
| 3300028047|Ga0209526_10001904 | All Organisms → cellular organisms → Bacteria | 13976 | Open in IMG/M |
| 3300028047|Ga0209526_10996173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300028800|Ga0265338_11182523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300028906|Ga0308309_10567861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300029993|Ga0302304_10044014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1795 | Open in IMG/M |
| 3300030862|Ga0265753_1129849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300031057|Ga0170834_103972005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300031057|Ga0170834_108743271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300031057|Ga0170834_110782682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300031754|Ga0307475_10687268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031754|Ga0307475_11584194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031823|Ga0307478_10267882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1392 | Open in IMG/M |
| 3300031823|Ga0307478_10833535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
| 3300031962|Ga0307479_11047371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300032180|Ga0307471_100665474 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300032180|Ga0307471_101205424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
| 3300032515|Ga0348332_11563033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300032805|Ga0335078_11397665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300032954|Ga0335083_10982834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300033547|Ga0316212_1047473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.93% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.25% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.81% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.69% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001084 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027334 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_6477550 | 2032320005 | Soil | DDVLERQLVTLVNQPIRDLLNARYEKFRKMGQFFDLVGS |
| INPgaii200_02717772 | 2228664022 | Soil | EATARFLDEVLDRQLVELTNQPVRDLVDARYEKFRRMGQYFDLGN |
| INPgaii200_11452381 | 2228664022 | Soil | LEEVLDRQLTELTSEPTNVLVQSRYKKFRQMGQYFDLQV |
| INPhiseqgaiiFebDRAFT_1018958821 | 3300000364 | Soil | RFLDTVLDRQLVMLTNQSTKDLLDARYEKFRKMGQFFTS* |
| JGI12648J13191_10142672 | 3300001084 | Forest Soil | LLDEVLDRQLVALANETTKDLLDARYEKFRKMGQFFDLGS* |
| JGI12637J13337_10082661 | 3300001137 | Forest Soil | LDTVLDRQLVMLTNQSTKDLLNARYEKFRKMGQFFTS* |
| JGI12635J15846_106457842 | 3300001593 | Forest Soil | AVLDRQLLMLSQQPQKELLDARYEKFRKMGQFFDLGS* |
| C688J18823_104918812 | 3300001686 | Soil | RSLDAVLDRQLMAVSSQSTKEMLDARYEKFRNMGQFFDIGA* |
| JGIcombinedJ26739_1002100831 | 3300002245 | Forest Soil | DEVLDRQLAALTNQPIRELLQARYEKFRKMGQFFDLGN* |
| JGIcombinedJ26739_1003949711 | 3300002245 | Forest Soil | RLLDAVLDRQLLMLSQQPQKELLDARYEKFRKMGQFFDLG* |
| JGIcombinedJ26739_1005476711 | 3300002245 | Forest Soil | SHLLDAVLDRQLLMLSQQPQKELLDARYEKFRKMGQFFDLGN* |
| JGIcombinedJ26739_1007854761 | 3300002245 | Forest Soil | SNHERAAQLLDEVLDRQLVALLNQSPRDLLAMRHDKFRLMGQFFEMK* |
| JGIcombinedJ26739_1012652501 | 3300002245 | Forest Soil | EATARLLDIVLDRQLVALTNESTKDLLDARYEKFRKMGQFFDLGS* |
| JGIcombinedJ26739_1014733052 | 3300002245 | Forest Soil | DYEAAARLLDAVLDRQLVALTNQSVRDLLDARYEKFRRMGQYFENVS* |
| JGIcombinedJ26739_1016149971 | 3300002245 | Forest Soil | LDTVLERQLLMLSQQPQKELLEARYEKFRKMGQFFDLGS* |
| JGI25389J43894_10793192 | 3300002916 | Grasslands Soil | LDEALDRQLVSLAHESVRELLDARYEKFRKMGQFFDLGN* |
| Ga0062385_104425322 | 3300004080 | Bog Forest Soil | DEILNRQLIALSHQPLKSILDARYDKFRKMGQFFDFVSR* |
| Ga0070709_117617591 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EAASRLLDAVLDRQLLMLSQQPQKELLEARYEKFRKMGQFFDLG* |
| Ga0070707_1012204221 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | DDVLDRQLVALTNQPIRELLDARYEKFRKMGQFFDVRND* |
| Ga0070707_1014826371 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | HMDADESARILGEVLDRQLVALSNQPVKDRLSARYEKFRRMGQFFNLGT* |
| Ga0070734_101815423 | 3300005533 | Surface Soil | TDFDTTAKLLDQVLDRQLTALVNQPTRELLEARYEKFRRMGQYFDFGGVR* |
| Ga0070732_102474881 | 3300005542 | Surface Soil | ADYEASARFLDTVLDRQLVMLTNQSTKDLLAARYEKFRKMGQFFDNAS* |
| Ga0066661_103219451 | 3300005554 | Soil | RLLDEVLDRQLVALTNQPVPELLDARYEKFRKMGQFFDLGN* |
| Ga0066661_105544492 | 3300005554 | Soil | DEVLDRQLVALTNQPIRELLDARYEKFRNMGQFFDLGN* |
| Ga0066692_105935321 | 3300005555 | Soil | RFLDEVLDRQLVSLAHEPVRELLDARYEKFRKMGQFFDLGN* |
| Ga0066707_109828781 | 3300005556 | Soil | DEVLDRQLVSLAHEPVRELLDARYEKFRKMGQFFDLGN* |
| Ga0066670_100050786 | 3300005560 | Soil | AAARLLDEVLDRQLVALSHEPTRQLLDARYEKFRKMGQFFDLASS* |
| Ga0066693_101208333 | 3300005566 | Soil | AARLLEEVLDRQLVELTSQPAKDLVEARYKKFREMGQYFDLHGS* |
| Ga0066703_108029421 | 3300005568 | Soil | ARFLDEVLDRQLVLLTNQPIAGLLDARHEKFRKMGQFFDLGH* |
| Ga0066903_1081945071 | 3300005764 | Tropical Forest Soil | DYEAAARLLEEVLDRQLVELVSQPTKDLLDSRYEKFRKMGQFFDLQA* |
| Ga0080027_100837693 | 3300005993 | Prmafrost Soil | SRLLDAVLERQLLMLSEQPQKNLLDARYEKFRKMGQFFEISN* |
| Ga0075029_1003112474 | 3300006052 | Watersheds | LGEVLDRELVAVSQQSTKDLLEARYEKFRKMGQYFDFGN* |
| Ga0075030_1000349367 | 3300006162 | Watersheds | EVLDRQLTELALQSPRDLISSRYDKFRKMGQFFDLRN* |
| Ga0075014_1001147503 | 3300006174 | Watersheds | HEAAARALDEVLDRQLTELALQSPRDLISSRYDKFRKMGQFFDLRN* |
| Ga0097621_1000109611 | 3300006237 | Miscanthus Rhizosphere | AHTDLEAAARFLEEVLDRQLIELLNEPVTGLVSARYEKFRKMGQFFDLQA* |
| Ga0079222_113490232 | 3300006755 | Agricultural Soil | LDDVLERQLVTLVNQPIRDLVNARYEKFRKMGQFFDLVGS* |
| Ga0066665_101484641 | 3300006796 | Soil | VLDRQLAALTNQPIRELLEARYEKFRKMGQFFDLGN* |
| Ga0066665_111285582 | 3300006796 | Soil | ARLLDEVLDRQLVALTNQPVPELLDARYEKFRKMGQFFDLGN* |
| Ga0075424_1009492851 | 3300006904 | Populus Rhizosphere | RSLDAVLDRQLMALSNQPTKELLDARYEKFRNMGQFFDLGA* |
| Ga0099793_100369403 | 3300007258 | Vadose Zone Soil | DEVLDRQLVALTNQPVRELLDARYEKFRKMGQFFDLGN* |
| Ga0099793_100712464 | 3300007258 | Vadose Zone Soil | LDRQLVKLSNEPVKDLLDARYQKFRNMGQYFDHG* |
| Ga0099794_101706843 | 3300007265 | Vadose Zone Soil | RFLDEVLDRQLVALTNQPPRELLDARYEKFRKMGQFFDLGN* |
| Ga0099829_115264371 | 3300009038 | Vadose Zone Soil | DEVLDRQLVALTNQPLRELLDARYEKFRKMGQFFDLGN* |
| Ga0099830_104086361 | 3300009088 | Vadose Zone Soil | ASARILDEVLDRQLVALSNQPIRELLDARYEKFRRMGQFFDLANS* |
| Ga0099828_104832571 | 3300009089 | Vadose Zone Soil | ARFLDEVLDRQLVALTNQPLRELLDARYEKFRKMGQFFDLGN* |
| Ga0105247_115737892 | 3300009101 | Switchgrass Rhizosphere | VEAAARLLEEVLDRQLVELLNEPMTSLVSSRYDKFRKMGQFFDMQS* |
| Ga0066709_1028009211 | 3300009137 | Grasslands Soil | TAARFLEEVLDRQLVELLNQPVTSLVSARYEKFRKMGQFFDLQA* |
| Ga0105241_117166532 | 3300009174 | Corn Rhizosphere | TDLEAAARFLEEVLDCQLIELLNEPVTSLVSARYDKFRKMGQFFDLQA* |
| Ga0105238_112724002 | 3300009551 | Corn Rhizosphere | SPEDAAKLLDEVLDRQLMALSNESTKDLLDARYEKFRKMGQFFDLGN* |
| Ga0116105_11213682 | 3300009624 | Peatland | LDEVLDRQLVALTNETTKDLSDARYEKFRKMGQFFDLGS* |
| Ga0126384_111915151 | 3300010046 | Tropical Forest Soil | AKLLDEVLDRQLMALSNESMKDLLDAGYEKFRMMGQYFDLGN* |
| Ga0126373_110080431 | 3300010048 | Tropical Forest Soil | RLLDDVLDRQLVALTNEPIRVLLALRYEKFRKMGQFFDLPNG* |
| Ga0099796_102770242 | 3300010159 | Vadose Zone Soil | LDEVLDRQLVALTNQPIQELLDARYDKFRRMGQFFDLGN* |
| Ga0126370_108722271 | 3300010358 | Tropical Forest Soil | LDEVLDRQLVTLTNQPVKDLLDARYEKFRRMGQFFDLINP* |
| Ga0126377_123836982 | 3300010362 | Tropical Forest Soil | AARLLEEVLDRQLVELLNEPVKSLLSARYEKFRRMGQFFDLQS* |
| Ga0126377_131487561 | 3300010362 | Tropical Forest Soil | AQFLDEVLDRQLTELSTEPVKDLLEARYKKFRVMGQFFDISQTL* |
| Ga0105239_103837253 | 3300010375 | Corn Rhizosphere | DAVLDRQLMALSNQPTKELLDARYEKFRNMGQFFDLGA* |
| Ga0137392_101412591 | 3300011269 | Vadose Zone Soil | HTDFEGAARFLDEVLDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN* |
| Ga0137392_109545252 | 3300011269 | Vadose Zone Soil | TVLDRQLVMLTNQSAKDLLDTRYEKFRKMGQFFHIVG* |
| Ga0137392_115402601 | 3300011269 | Vadose Zone Soil | LDRQLVTLTNQPIRELLGARYEKFRKMGQFFDLGN* |
| Ga0137391_103020031 | 3300011270 | Vadose Zone Soil | DHEAAARFHDEVLDRQMAALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137391_104387401 | 3300011270 | Vadose Zone Soil | TDFEAAARFVDEVLDRQLVALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137393_100640171 | 3300011271 | Vadose Zone Soil | QFLGEVLDRQLTELTTESVKDLVEARYKKFRQMGQFFDLQA* |
| Ga0137393_101688923 | 3300011271 | Vadose Zone Soil | DEVLDRQLAALTSEPVKALVASRYDKFRKMGQYFDLQA* |
| Ga0137393_112681041 | 3300011271 | Vadose Zone Soil | GAARFLDEVLDRQLAALTNQPVRELLKARYEKFRKLGQFFDLGH* |
| Ga0137364_106090641 | 3300012198 | Vadose Zone Soil | EVLDRQLAALTNQPIRELLEARYEKFRKMGQFFDLGN* |
| Ga0137383_100921541 | 3300012199 | Vadose Zone Soil | LDRQLVSLAHEPVRELLDARYEKFRKMGQFFDLGN* |
| Ga0137382_103759263 | 3300012200 | Vadose Zone Soil | EAAAKLLDEVLDRQLVALTNQPVPELLDARYEKFRKMGQFFDLGN* |
| Ga0137363_106213322 | 3300012202 | Vadose Zone Soil | DRQLTELMSEPVKHLVEARYKKFRQMGQFFDLQA* |
| Ga0137399_104082973 | 3300012203 | Vadose Zone Soil | RFLEEVLERQLAALAVEPTKDLLAARYDKFRKMGQYFDMQT* |
| Ga0137399_105568801 | 3300012203 | Vadose Zone Soil | TDHEGAARFLDEVLDRQLAALTNQPLRELLEVRYEKFRKMGQFFDLGN* |
| Ga0137399_115308311 | 3300012203 | Vadose Zone Soil | RFLEEVLDRQLVALTNQPIRDLIDARYEKFRKMGQYFDLWN* |
| Ga0137378_100646295 | 3300012210 | Vadose Zone Soil | DRQLVSLAHEPVRELLDARYEKFRKMGQFFDLGN* |
| Ga0137378_105849181 | 3300012210 | Vadose Zone Soil | LDRQLVALTNQPVRELLDARYEKFRRMGQFFDLGK* |
| Ga0137371_102308093 | 3300012356 | Vadose Zone Soil | AAAQYLDEVLDRQLTELSATPVKDLLESRYKKFREMGQFFDLQP* |
| Ga0137385_112751472 | 3300012359 | Vadose Zone Soil | RFLDEVLDRQLVALTNQPVRELLDARYEKFRRMGQFFDLGN* |
| Ga0137361_109116102 | 3300012362 | Vadose Zone Soil | ARFLDEVLDRQLVALTNQPVRELLDARYEKFRRMGQFFDLGN* |
| Ga0137390_101417415 | 3300012363 | Vadose Zone Soil | EVLDRQLTELTTESVKDLVAARYKKFRQMGQFFDLQA* |
| Ga0137390_102117762 | 3300012363 | Vadose Zone Soil | LDRQLVALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137390_103619211 | 3300012363 | Vadose Zone Soil | EAAAQFLDEVLDRQLTELTTESVKDLVEARYKKFRQMGQFFDLQA* |
| Ga0137390_103763002 | 3300012363 | Vadose Zone Soil | RFVDEVLDRQLVALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137390_113299362 | 3300012363 | Vadose Zone Soil | DEVLDRQLVALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137358_100412261 | 3300012582 | Vadose Zone Soil | EAAARFLDEVLDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN* |
| Ga0137358_103225053 | 3300012582 | Vadose Zone Soil | LDRQLVMLTNQPVKDLLDARYQKFRNMGQYFDIG* |
| Ga0137396_106794693 | 3300012918 | Vadose Zone Soil | HVDHEAAARFLEEVLDRQLVALTNQPIRDLIDARYEKFRKMGQYFDLWN* |
| Ga0137394_101964734 | 3300012922 | Vadose Zone Soil | LDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN* |
| Ga0137394_102230252 | 3300012922 | Vadose Zone Soil | DRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN* |
| Ga0137359_101497225 | 3300012923 | Vadose Zone Soil | DRQLAELSATPVKDLVESRYKKFREMGQFFDLQP* |
| Ga0137359_107733253 | 3300012923 | Vadose Zone Soil | DHEAAARFLDEVLDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN* |
| Ga0137413_103487221 | 3300012924 | Vadose Zone Soil | TDFEGAARFLDEVLDRQLVALTNQPLRELLDARYEKFRKMGQFFDLGN* |
| Ga0137416_117375961 | 3300012927 | Vadose Zone Soil | HEGAARFLDEVLDRQLAALTNQPIRELLAARYEKFRKMGQFFDLSN* |
| Ga0137404_104755233 | 3300012929 | Vadose Zone Soil | HEAAARLFDEVLDRQLMILLNQPIRDLLQARYEKFRNMAQYFDIGS* |
| Ga0137410_101428712 | 3300012944 | Vadose Zone Soil | LDEVLDRQLVALTNQPVQELLDARYEKFRKMGQFFDLGN* |
| Ga0126375_108489582 | 3300012948 | Tropical Forest Soil | DEVLDRQLVTLTNQPVKDLLDARYEKFRRMGQFFDLMNP* |
| Ga0153916_120882591 | 3300012964 | Freshwater Wetlands | QFLDTVLERQLALLSGLGPADLVRKRYEKFRKMGQFFDLHG* |
| Ga0163162_116266852 | 3300013306 | Switchgrass Rhizosphere | FLEEVLDRQLIELLNEPVTALVSARYNKFRKMGQFFDLQA* |
| Ga0181537_109010002 | 3300014201 | Bog | AFLDDVLNRQLMALSNQPLRALLDARYEKFRKMGQFFDFVR* |
| Ga0137420_10902411 | 3300015054 | Vadose Zone Soil | FLDEVLDRQLAALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137420_13270562 | 3300015054 | Vadose Zone Soil | DEVLDRQLAALTNQPIRELLDARYEKFRKMGQFFDLGN* |
| Ga0137418_104297251 | 3300015241 | Vadose Zone Soil | TDFEGAARFLDEVLDRQLVALTNQPPRELLDARYEKFRKMGQFFDLGN* |
| Ga0137409_100488866 | 3300015245 | Vadose Zone Soil | HEAAARFLEEVLDRQLVALTNQPVLDLVDARYEKFRKMGQFFDLWN* |
| Ga0137409_110139571 | 3300015245 | Vadose Zone Soil | VVLDRQLAELSATPVKDLVESRYKKFREMGQFFDLQP* |
| Ga0182036_109841992 | 3300016270 | Soil | RLLDDVLDRQLVALTNEPVRELLSARYEKFRKMGQFFDLPNG |
| Ga0182033_115432951 | 3300016319 | Soil | EAAARLLEEVLDRQLVELLNEPIARLVSARYEKFRKMGQFFDLQS |
| Ga0182034_104882903 | 3300016371 | Soil | AAARFLEEVLDKQLIELLNEPVDSLLSARYNKFRTMGQFFDLQS |
| Ga0182034_105609841 | 3300016371 | Soil | TDPEAAARLLEEVLDRQLVQLLNEPTAALISARYEKFRKMGQFFDLQS |
| Ga0187847_102212633 | 3300017948 | Peatland | AAGYVDEVLNRQLIALSHQPLKAVLDGRYEKFRKMGQFFDLVPR |
| Ga0187816_102213772 | 3300017995 | Freshwater Sediment | LDEVLYRQLVELTNQPIRELLHARYEKFRKMGQFFDLGG |
| Ga0187770_102701963 | 3300018090 | Tropical Peatland | RLLDEVLDRQLVALANQPVRELLNARYEKFRKMGQFFDLGA |
| Ga0173479_107632681 | 3300019362 | Soil | RLLEEVLDRQLVELLNEPVKGLLSARYDKFRKMGQFFDLQS |
| Ga0137408_14144031 | 3300019789 | Vadose Zone Soil | YLDEVLDRQLVSLTNQPLPELLEARYEKFRKMGQFFDLGG |
| Ga0179594_102821701 | 3300020170 | Vadose Zone Soil | EEVLDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN |
| Ga0179592_104765002 | 3300020199 | Vadose Zone Soil | EASARLLDIVLDRQLVALTNESTKDLLDARYEKFRKMGQFFDLGS |
| Ga0210407_100226726 | 3300020579 | Soil | EVLDRQLVALSQQPTKDLLETRYDKFRKMGQFFDFGS |
| Ga0210407_101495783 | 3300020579 | Soil | AARFLDEVLDRQLAALTNQPIRELLDARYEKFRKMGQFFDLGN |
| Ga0210407_113125081 | 3300020579 | Soil | DEVLDRQLTALTNQPIRELLAARYEKFRKMGQFFDLGN |
| Ga0210401_100901806 | 3300020583 | Soil | LDRELVALTQQPTKDLLEARYEKFRKMGQFFDFGN |
| Ga0210404_106058431 | 3300021088 | Soil | AQLLGEVLDRELLALTQQPTKDLLEARYEKFRKMGQFFDFGN |
| Ga0210406_100522831 | 3300021168 | Soil | VLDRQLVALTNQPVRTLVDARYEKFRRMGQFFDLGN |
| Ga0210400_100701391 | 3300021170 | Soil | LDIVLDRQLVALTNESTKDLLEARYEKFRKMGQFFDLGS |
| Ga0210400_105354812 | 3300021170 | Soil | ARFLDEVLDRQLAALTNQPIRELLQARYEKFRKMGQFFDLGN |
| Ga0210408_107986961 | 3300021178 | Soil | DHEAAARLLDEVLDRQLMVLQNQPVHDLVKARYEKFRNMAQYFDIGS |
| Ga0210396_107959462 | 3300021180 | Soil | LLGEVLDRQLVALTQQSSKDLLNARYEKFRKMGQFFDFGN |
| Ga0210396_108770131 | 3300021180 | Soil | LGEVLDRQLVALTQQPTKDLLDTRYEKFRKMGQFFDFGS |
| Ga0210384_106646972 | 3300021432 | Soil | LDRELVALTQQPTKDLLDARYEKFRKMGQFFDFGD |
| Ga0210391_107434701 | 3300021433 | Soil | AARFLEEVLERQLAALSSESAKSLLASRYEKFRKMGQFFDLQA |
| Ga0210392_107599792 | 3300021475 | Soil | GQLLGEVLDRQLVALSQQPTKDLLDTRYEKFRKMGQFFDFGS |
| Ga0210398_101915575 | 3300021477 | Soil | EVLDRQLVALANETTKDLLDARYEKFRKMGQFFDLGS |
| Ga0210402_115672072 | 3300021478 | Soil | YEAAARSLDVVLDRQLLALSNQATKEMLDARYKKFRNMGQFFDLGA |
| Ga0210409_102805731 | 3300021559 | Soil | DEVLDRQLAALTNQPIRELLDARYEKFRKMGQFFDLGN |
| Ga0210409_111589682 | 3300021559 | Soil | DEVLDRQLTVLLNQPIRELLQARYEKFRNMAQYFDIGS |
| Ga0126371_101240831 | 3300021560 | Tropical Forest Soil | ARLLDEVLDRQLTALSNESPRDLLSARYEKFRKMGQFFDLVGG |
| Ga0224549_10570431 | 3300022840 | Soil | YLDEVLNRQLTTLSQQPMKNLLDERYEKFRKMGQYFDVVSR |
| Ga0247669_10736581 | 3300024182 | Soil | LDRQLMALMNQSTKQLLDARYEKFRNMGQFFDLGA |
| Ga0224572_10717852 | 3300024225 | Rhizosphere | EGAGQLLGEVLDRQLVALSQQPTKDLLDARYEKFRKMGQFFDFGS |
| Ga0207711_101949084 | 3300025941 | Switchgrass Rhizosphere | DYEAAGRSLDAVLDRQLMALSNQPTKELLDARYEKFRNMGQFFDLGA |
| Ga0209863_100719991 | 3300026281 | Prmafrost Soil | DNVLDRQLVALTNESTKDLLDARYEKFRKMGQFFDLGS |
| Ga0209238_10074326 | 3300026301 | Grasslands Soil | EAAARFLDEALDRQLVSLAHESVRELLDARYEKFRKMGQFFDLGN |
| Ga0209265_10018761 | 3300026308 | Soil | LDRQLVALTNEPVRELLAARYEKFRKMGQFFDLSNG |
| Ga0209055_10123421 | 3300026309 | Soil | HEAAARLLDEVLDRQLVALTNQPVPELLDARYEKFRKMGQFFDSGN |
| Ga0209268_10153861 | 3300026314 | Soil | LDRQLVALTNQPVPELLDARYDKFRKMGQFFDLGN |
| Ga0209804_12504302 | 3300026335 | Soil | DEVLDRQLVALTNQPVPELLDARYEKFRKMGQFFDLGN |
| Ga0179587_101151631 | 3300026557 | Vadose Zone Soil | FDEVLDRQLMILLNQPIRDLLQARYEKFRNMAQYFDIGS |
| Ga0209529_10574411 | 3300027334 | Forest Soil | PEEAAKLLDEVLDRQLMALSNESTKSLLDARYQKFRKMGQFFDLGN |
| Ga0209524_10949042 | 3300027521 | Forest Soil | FLDIVLDRQLVMLTNQSTKDLLDARYEKFRKMGQFFTS |
| Ga0209219_10642551 | 3300027565 | Forest Soil | EGAGRLLDAVLDRQLLMLSQQPQKELLEARYEKFRKMGQFFDLGS |
| Ga0209076_10420903 | 3300027643 | Vadose Zone Soil | VLDRQLAALTNQPIRELLQARYQKFRKMGQFFDLGN |
| Ga0209217_10985621 | 3300027651 | Forest Soil | TVLDRQLVALTNQSVRDLLDARYEKFRRMGQYFENVS |
| Ga0209588_11477502 | 3300027671 | Vadose Zone Soil | AAARFLDEVLDRQLVALTNQPVRDLVDARYEKFRKMGQFFDLWN |
| Ga0209588_11781311 | 3300027671 | Vadose Zone Soil | FLDEVLDRQLVALTNQPPRELLDARYEKFRKMGQFFDLGN |
| Ga0209446_10279361 | 3300027698 | Bog Forest Soil | QSLGEVLDRQLVALTNQSTNEVLANRYEKFRKMGQFFDFVN |
| Ga0209328_101737942 | 3300027727 | Forest Soil | QLLDEVLDRQLVALLNQSPRDLLAMRHDKFRLMGQFFEMK |
| Ga0209655_100932992 | 3300027767 | Bog Forest Soil | ARNVDEILNRQLIALSHQPLKDLLDGRYEKFRKMGQYFDFVAR |
| Ga0209448_102620622 | 3300027783 | Bog Forest Soil | FDAAAGLLDEVLDRQLTALSNQPLKEVLDSRYDKFRKMGQFFDFVAR |
| Ga0209074_104518002 | 3300027787 | Agricultural Soil | ILDDVLERQLVTLVNQPIRDLVNTRYEKFRKMGQFFDIAG |
| Ga0209139_1000148213 | 3300027795 | Bog Forest Soil | GEVLDRQLVALTNQSTNEVLANRYEKFRKMGQFFDFVN |
| Ga0209180_106324832 | 3300027846 | Vadose Zone Soil | LDRQLVMLTNQSAADLLAARYEKFRKMGQFFDHVS |
| Ga0209180_107112081 | 3300027846 | Vadose Zone Soil | EGAARFLDEVLDRQLAALTNQPIRELLAARYEKFRKMGQFFDLGN |
| Ga0209526_1000190418 | 3300028047 | Forest Soil | YEAAARFLDEVLDRELVVLTNQSTKGLLEARYEKFRNMGQFFDLGS |
| Ga0209526_109961732 | 3300028047 | Forest Soil | LDTVLERQLLMLSQQPQKELLEARYEKFRKMGQFFDLGS |
| Ga0265338_111825232 | 3300028800 | Rhizosphere | DAAAGFLDEVLSRQLAALSHQPLKALLDGRYEKFRKMGQYFDFVNR |
| Ga0308309_105678611 | 3300028906 | Soil | AAKLLDEVLDRQLMALSNESTKDLLNARYEKFRKMGQFFDLGN |
| Ga0302304_100440141 | 3300029993 | Palsa | ILNRQLTALSQQPMKDLLDGRYEKFRKMGQYFDVVSR |
| Ga0265753_11298492 | 3300030862 | Soil | VIDRQLTVLTNESTKDLVNARYEKFRKMGQFFDLGS |
| Ga0170834_1039720053 | 3300031057 | Forest Soil | RLLDAVIDRQLAVLTNESTKDLVDARYEKFRKMGQFFDLGS |
| Ga0170834_1087432713 | 3300031057 | Forest Soil | GAAQFLDEVLDRQLTELMTEPVKHLVEARYKKFRQMGQFFDLQA |
| Ga0170834_1107826822 | 3300031057 | Forest Soil | FLDEVLDRQLTELTTESVRDLVEARYKKFRQMGQFFDLQA |
| Ga0307475_106872681 | 3300031754 | Hardwood Forest Soil | EGAARLLEEVLDRQLVELLNEPAKSLVAARYDKFRKMGQFFDLQA |
| Ga0307475_115841941 | 3300031754 | Hardwood Forest Soil | FLDEVLDRQLVALTNQSTKELLAARYEKFRNMGQFFDIGS |
| Ga0307478_102678823 | 3300031823 | Hardwood Forest Soil | DDVLDRQLVTLTNQPIRELVQARYEKFRKMGQFFDLGN |
| Ga0307478_108335351 | 3300031823 | Hardwood Forest Soil | EEAAKLLDEVLDRQLMALSNESTKDLLNARYEKFRKMGQFFDLGN |
| Ga0307479_110473712 | 3300031962 | Hardwood Forest Soil | LLDDVLDRQLVALTNEPVRELLAARYEKFRKMGQFFDLPNG |
| Ga0307471_1006654741 | 3300032180 | Hardwood Forest Soil | AAQFLDEVLDRQLVELTSEPIKALVDARYKKFRQMGQFFDILA |
| Ga0307471_1012054242 | 3300032180 | Hardwood Forest Soil | VLDRQLVELMNQPVRELLDARYAKFRKMGQFFDLGN |
| Ga0348332_115630331 | 3300032515 | Plant Litter | LGEVLDRELLALTQQPTKDLLEARYEKFRKMGQFFDFGN |
| Ga0335078_113976651 | 3300032805 | Soil | AARLLGDVLERQLLALTSVATKELLKDRYEKFRKMGQFFDLIR |
| Ga0335083_109828342 | 3300032954 | Soil | GAARLLGDVLERQLLALTSVATKELLKDRYEKFRKMGQFFDLIR |
| Ga0316212_10474732 | 3300033547 | Roots | FDPEGAGRLLGEVLDRQLVALTQQPTKDLLDTRYDKFRKMGQFFDFGG |
| ⦗Top⦘ |