


| Basic Information | |
|---|---|
| Family ID | F033085 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 42 residues |
| Representative Sequence | YHKDKFRIDKDGYVLAPTEPGLGYPIDRDALDKIMKRIDR |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.31 % |
| % of genes from short scaffolds (< 2000 bps) | 89.33 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.067 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog (19.663 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.315 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.079 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.29% β-sheet: 2.94% Coil/Unstructured: 86.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF00701 | DHDPS | 12.36 |
| PF04199 | Cyclase | 6.74 |
| PF07690 | MFS_1 | 3.37 |
| PF13378 | MR_MLE_C | 3.37 |
| PF01435 | Peptidase_M48 | 2.25 |
| PF00801 | PKD | 2.25 |
| PF13442 | Cytochrome_CBB3 | 2.25 |
| PF01557 | FAA_hydrolase | 1.69 |
| PF13561 | adh_short_C2 | 1.12 |
| PF04542 | Sigma70_r2 | 1.12 |
| PF13620 | CarboxypepD_reg | 1.12 |
| PF03485 | Arg_tRNA_synt_N | 1.12 |
| PF07883 | Cupin_2 | 1.12 |
| PF13470 | PIN_3 | 0.56 |
| PF01614 | IclR | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF16757 | Fucosidase_C | 0.56 |
| PF02837 | Glyco_hydro_2_N | 0.56 |
| PF14509 | GH97_C | 0.56 |
| PF07944 | Glyco_hydro_127 | 0.56 |
| PF14559 | TPR_19 | 0.56 |
| PF01408 | GFO_IDH_MocA | 0.56 |
| PF03328 | HpcH_HpaI | 0.56 |
| PF02449 | Glyco_hydro_42 | 0.56 |
| PF04015 | DUF362 | 0.56 |
| PF04909 | Amidohydro_2 | 0.56 |
| PF01261 | AP_endonuc_2 | 0.56 |
| PF07676 | PD40 | 0.56 |
| PF07638 | Sigma70_ECF | 0.56 |
| PF02746 | MR_MLE_N | 0.56 |
| PF09339 | HTH_IclR | 0.56 |
| PF13231 | PMT_2 | 0.56 |
| PF10518 | TAT_signal | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 24.72 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 6.74 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.69 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.12 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.12 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.12 |
| COG4948 | L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.12 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.56 |
| COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.56 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.56 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3533 | Beta-L-arabinofuranosidase, GH127 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.07 % |
| Unclassified | root | N/A | 3.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005356|Ga0070674_101957069 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005364|Ga0070673_101660997 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005364|Ga0070673_101967081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300005466|Ga0070685_10932767 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005614|Ga0068856_101553724 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300006050|Ga0075028_100475278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 726 | Open in IMG/M |
| 3300006237|Ga0097621_101433120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300006638|Ga0075522_10202074 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300006795|Ga0075520_1116788 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300006950|Ga0075524_10103645 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300009177|Ga0105248_12145740 | Not Available | 635 | Open in IMG/M |
| 3300009551|Ga0105238_11697788 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300009629|Ga0116119_1079961 | Not Available | 827 | Open in IMG/M |
| 3300009633|Ga0116129_1130121 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 720 | Open in IMG/M |
| 3300009636|Ga0116112_1054816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1172 | Open in IMG/M |
| 3300009665|Ga0116135_1042377 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1572 | Open in IMG/M |
| 3300009672|Ga0116215_1520065 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009764|Ga0116134_1261593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300010379|Ga0136449_101312119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1127 | Open in IMG/M |
| 3300010399|Ga0134127_11003598 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300013105|Ga0157369_11918752 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300014151|Ga0181539_1118236 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300014152|Ga0181533_1101690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300014152|Ga0181533_1284416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 605 | Open in IMG/M |
| 3300014156|Ga0181518_10425266 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300014156|Ga0181518_10455775 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300014158|Ga0181521_10098008 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300014158|Ga0181521_10371133 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46 | 712 | Open in IMG/M |
| 3300014158|Ga0181521_10539361 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300014159|Ga0181530_10431166 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300014160|Ga0181517_10081925 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300014161|Ga0181529_10104979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300014162|Ga0181538_10072864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2077 | Open in IMG/M |
| 3300014162|Ga0181538_10301821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 870 | Open in IMG/M |
| 3300014164|Ga0181532_10260568 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300014165|Ga0181523_10740343 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300014168|Ga0181534_10156303 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300014168|Ga0181534_10864891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300014169|Ga0181531_10830198 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300014199|Ga0181535_10336226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300014199|Ga0181535_10555829 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300014200|Ga0181526_10797308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 595 | Open in IMG/M |
| 3300014200|Ga0181526_10847805 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300014201|Ga0181537_11035070 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300014201|Ga0181537_11219897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 508 | Open in IMG/M |
| 3300014492|Ga0182013_10261752 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300014494|Ga0182017_10164789 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300014496|Ga0182011_10465564 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300014496|Ga0182011_10875940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter acidisoli | 560 | Open in IMG/M |
| 3300014496|Ga0182011_10929042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300014498|Ga0182019_10560374 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300014498|Ga0182019_11258722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300014499|Ga0182012_10377161 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300014501|Ga0182024_10793393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1155 | Open in IMG/M |
| 3300014501|Ga0182024_11431248 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300014502|Ga0182021_11963812 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300014502|Ga0182021_12466815 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300014638|Ga0181536_10239169 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300014638|Ga0181536_10364509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 654 | Open in IMG/M |
| 3300014638|Ga0181536_10383062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300014655|Ga0181516_10145306 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300014657|Ga0181522_10164858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 1298 | Open in IMG/M |
| 3300014657|Ga0181522_10663045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300014658|Ga0181519_10251290 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300014658|Ga0181519_10888614 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300014838|Ga0182030_11583235 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300014838|Ga0182030_11624683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 528 | Open in IMG/M |
| 3300014839|Ga0182027_10035403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6432 | Open in IMG/M |
| 3300014839|Ga0182027_10174969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2509 | Open in IMG/M |
| 3300014839|Ga0182027_10369601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1602 | Open in IMG/M |
| 3300014839|Ga0182027_11472873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 671 | Open in IMG/M |
| 3300014839|Ga0182027_11657963 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300014839|Ga0182027_11726683 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300014839|Ga0182027_11899631 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300015374|Ga0132255_102166945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300016700|Ga0181513_1387270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 708 | Open in IMG/M |
| 3300016728|Ga0181500_1370913 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300016730|Ga0181515_1161274 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
| 3300017929|Ga0187849_1273214 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300017935|Ga0187848_10258759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46 | 733 | Open in IMG/M |
| 3300017938|Ga0187854_10040744 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300017946|Ga0187879_10317022 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300017988|Ga0181520_10424077 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 959 | Open in IMG/M |
| 3300017988|Ga0181520_10871488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300017988|Ga0181520_10975051 | Not Available | 562 | Open in IMG/M |
| 3300018008|Ga0187888_1005838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8415 | Open in IMG/M |
| 3300018017|Ga0187872_10115887 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300018017|Ga0187872_10499083 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018033|Ga0187867_10673494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 564 | Open in IMG/M |
| 3300018038|Ga0187855_10557482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 667 | Open in IMG/M |
| 3300018042|Ga0187871_10159984 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300018042|Ga0187871_10268232 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300018043|Ga0187887_10350277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300018043|Ga0187887_10615835 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300018043|Ga0187887_10850224 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300018044|Ga0187890_10574464 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300018044|Ga0187890_10792638 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300019270|Ga0181512_1381553 | Not Available | 525 | Open in IMG/M |
| 3300019787|Ga0182031_1369455 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300019788|Ga0182028_1299133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1167 | Open in IMG/M |
| 3300019788|Ga0182028_1320823 | All Organisms → cellular organisms → Bacteria | 2738 | Open in IMG/M |
| 3300022516|Ga0224542_1043982 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300022520|Ga0224538_1030324 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300022593|Ga0236338_1121134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 536 | Open in IMG/M |
| 3300023091|Ga0224559_1091946 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300025453|Ga0208455_1013376 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
| 3300025506|Ga0208937_1093349 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300025507|Ga0208188_1023937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1742 | Open in IMG/M |
| 3300025891|Ga0209585_10244661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter | 710 | Open in IMG/M |
| 3300025924|Ga0207694_10977701 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300025960|Ga0207651_11147306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300026456|Ga0255351_1026997 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300027570|Ga0208043_1019813 | All Organisms → cellular organisms → Bacteria | 2145 | Open in IMG/M |
| 3300027662|Ga0208565_1229584 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300027898|Ga0209067_10482962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300028558|Ga0265326_10017347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2078 | Open in IMG/M |
| 3300028562|Ga0302151_10207775 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300028565|Ga0302145_10087851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1064 | Open in IMG/M |
| 3300028666|Ga0265336_10170257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 648 | Open in IMG/M |
| 3300028731|Ga0302301_1143093 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300028747|Ga0302219_10082804 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300028748|Ga0302156_10008871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6624 | Open in IMG/M |
| 3300028748|Ga0302156_10186857 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300028762|Ga0302202_10341360 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Opitutus → unclassified Opitutus → Opitutus sp. ER46 | 710 | Open in IMG/M |
| 3300028779|Ga0302266_10312296 | Not Available | 573 | Open in IMG/M |
| 3300028783|Ga0302279_10264500 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300028798|Ga0302222_10108389 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300028813|Ga0302157_10036059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3715 | Open in IMG/M |
| 3300028882|Ga0302154_10154134 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300028906|Ga0308309_11346738 | Not Available | 613 | Open in IMG/M |
| 3300029817|Ga0247275_1135493 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300029882|Ga0311368_10689330 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300029883|Ga0311327_10001070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 23249 | Open in IMG/M |
| 3300029910|Ga0311369_10859387 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300029910|Ga0311369_11186246 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300029914|Ga0311359_10418742 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300029916|Ga0302148_1005717 | All Organisms → cellular organisms → Bacteria | 3754 | Open in IMG/M |
| 3300029917|Ga0311326_10155370 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300029917|Ga0311326_10434947 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300029920|Ga0302142_1121583 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300029951|Ga0311371_10110968 | All Organisms → cellular organisms → Bacteria | 4328 | Open in IMG/M |
| 3300029952|Ga0311346_11350267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300029955|Ga0311342_10115504 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300029985|Ga0302280_1173121 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300029993|Ga0302304_10355606 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300030020|Ga0311344_10393255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1278 | Open in IMG/M |
| 3300030225|Ga0302196_10054361 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300030294|Ga0311349_12231051 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300030399|Ga0311353_11060044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 676 | Open in IMG/M |
| 3300030524|Ga0311357_10367656 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
| 3300030580|Ga0311355_10010465 | All Organisms → cellular organisms → Bacteria | 12009 | Open in IMG/M |
| 3300030617|Ga0311356_10860687 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300030618|Ga0311354_10743901 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300030688|Ga0311345_10821568 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300030688|Ga0311345_11205236 | Not Available | 550 | Open in IMG/M |
| 3300030906|Ga0302314_11129313 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031232|Ga0302323_102063136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 648 | Open in IMG/M |
| 3300031234|Ga0302325_11045069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1109 | Open in IMG/M |
| 3300031234|Ga0302325_12452041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 624 | Open in IMG/M |
| 3300031242|Ga0265329_10347766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 507 | Open in IMG/M |
| 3300031249|Ga0265339_10329479 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300031249|Ga0265339_10480337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031344|Ga0265316_10073452 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300031524|Ga0302320_10559979 | All Organisms → cellular organisms → Bacteria | 1355 | Open in IMG/M |
| 3300031524|Ga0302320_11943702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 554 | Open in IMG/M |
| 3300031711|Ga0265314_10393934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300031788|Ga0302319_10655007 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300031902|Ga0302322_101518986 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031938|Ga0308175_103029023 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031939|Ga0308174_11946500 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032675|Ga0316225_1050383 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
| 3300032676|Ga0316229_1017619 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300032829|Ga0335070_10468418 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300033004|Ga0335084_11013863 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300033402|Ga0326728_10562235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
| 3300033890|Ga0334810_143808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 575 | Open in IMG/M |
| 3300034091|Ga0326724_0420920 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300034282|Ga0370492_0101173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 19.66% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 13.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 11.24% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 9.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 3.93% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.25% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.25% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.25% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 2.81% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.81% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 1.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.12% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016700 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022516 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 30-34 | Environmental | Open in IMG/M |
| 3300022520 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E2 20-24 | Environmental | Open in IMG/M |
| 3300022593 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026456 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2 | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
| 3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028783 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029916 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029920 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029985 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_1 | Environmental | Open in IMG/M |
| 3300029993 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Host-Associated | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
| 3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033890 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0070674_1019570691 | 3300005356 | Miscanthus Rhizosphere | HKHKFRVEKDGHIPAPTEPGLGYPIDRDALDKMLVRIDR* |
| Ga0070673_1016609972 | 3300005364 | Switchgrass Rhizosphere | MPHPANLVDRPYHKEIFRVDKEGYVHAPTAPGLSLPLDRNGLDKMLKRIDT* |
| Ga0070673_1019670812 | 3300005364 | Switchgrass Rhizosphere | ADRPYHKHKFRVEKDGHIPAPTELGLGYPIDSSCADKMLVRVDR* |
| Ga0070685_109327672 | 3300005466 | Switchgrass Rhizosphere | ADRPYHKHKFRVEKDGHIPAPTEPGLGYPIDRDVLDKMLVRIDR* |
| Ga0068856_1015537242 | 3300005614 | Corn Rhizosphere | YHKDKFRIDKDGYVLAPTEPGLGYPIDRDALDKIMKRIDR* |
| Ga0075028_1004752782 | 3300006050 | Watersheds | DKIRIDKDGYVHAPTAPGLGYPIDRDALEKMTKRVEVG* |
| Ga0097621_1014331201 | 3300006237 | Miscanthus Rhizosphere | RPYFMNKIRIDDKGFVHAPTEPGLGYPIDKNELDKVTIRIDR* |
| Ga0075522_102020741 | 3300006638 | Arctic Peat Soil | YADRPEYKDKFRPDADGYVSAPTAPGLGYPIDHDALDKITKRIDR* |
| Ga0075520_11167882 | 3300006795 | Arctic Peat Soil | FYKDKFRVDKDGYIYAPTAPGLGYPIDHDALDNITARIER* |
| Ga0075524_101036452 | 3300006950 | Arctic Peat Soil | RTDANGFVLAPTEPGLGYPFDRAALDKIMIRIDR* |
| Ga0105248_121457401 | 3300009177 | Switchgrass Rhizosphere | QRDPPVDKEGYVHAPTAPRLSLPLDRNGLDNMLKRIDT* |
| Ga0105238_116977882 | 3300009551 | Corn Rhizosphere | KFRPDAEGYIHAPTEPGLGYPIDRAALDRITKRIER* |
| Ga0116119_10799611 | 3300009629 | Peatland | YHKDKFRVDRDGYVNAPTEPGLGYPIDRDALDKIMVRIDT* |
| Ga0116129_11301212 | 3300009633 | Peatland | FRPDAEGYIHAPTLPGMGVVINRSELDRLTKQVLR* |
| Ga0116112_10548161 | 3300009636 | Peatland | RPYQAKFRIDKDGYVLAPTEPGLGYPIDHDALDKIMKRIDR* |
| Ga0116135_10423773 | 3300009665 | Peatland | YYPQKLRIDKDGYVQAPTEPGLGYAIDHNVLDKMLKRVDS* |
| Ga0116215_15200651 | 3300009672 | Peatlands Soil | YADRPYYKDKFRIDADGYVHAPAAPGLGYPLDMDALDNMTKRIDR* |
| Ga0116134_12615931 | 3300009764 | Peatland | DRVYHKDKFRIDQDGYIHAPTEPGLGYPLDRDALDKIMVRIDR* |
| Ga0136449_1013121192 | 3300010379 | Peatlands Soil | DKFRIDKDGYVLATAEPGLGVALDRAALDKMTKTINR* |
| Ga0134127_110035981 | 3300010399 | Terrestrial Soil | PSEYTDRPFYKDKFRIDQDGFVLAPTAPGLGYPLDMDALANVTKRIDR* |
| Ga0157369_119187522 | 3300013105 | Corn Rhizosphere | DHPYFNYKFRPDKDGYIAAPTQPGLGYPIDRAALDKVTKRIDR* |
| Ga0181539_11182361 | 3300014151 | Bog | IRPDKDGYVIAPTAPGLGYPIDHDALDKMLIRIDR* |
| Ga0181533_11016901 | 3300014152 | Bog | HKDKFRIDKDGYIIAPTAPGLGYPFDRDVLDKMTKRIDV* |
| Ga0181533_12844162 | 3300014152 | Bog | VDRPYQAKFRVDQDGYVLAPTEPGLGYPIDHNALDKIMKRIDR* |
| Ga0181518_104252662 | 3300014156 | Bog | HKDKFRVDKDGYVNAPTEPGLGYPVDRDALDKIMVRIDR* |
| Ga0181518_104557752 | 3300014156 | Bog | KFRPDADGYVPAPTAPGLGYPIDRAALDKVTTRIDR* |
| Ga0181521_100980081 | 3300014158 | Bog | PYQPQFRIDRDGYVLAPAEPGLGVPIDHNALDKIMKRVDR* |
| Ga0181521_103711331 | 3300014158 | Bog | FSYKFRPDKDGYIPAPTDPGLGYAIDRAALDKVTLRIDR* |
| Ga0181521_105393611 | 3300014158 | Bog | YQDKFRIDADGYVHAPTAPGLGYPLDMNALDNMTLRIDR* |
| Ga0181530_104311662 | 3300014159 | Bog | YYKDKFRIDADGYVHAPTAPGLGYPLDFDALDKMTLRIDR* |
| Ga0181517_100819251 | 3300014160 | Bog | EYADRPYYKDKFRIDADGYVHAPTAPGLGYPLDMDALDNMTTRIDR* |
| Ga0181529_101049791 | 3300014161 | Bog | HPVTFADRPYQPQFRIDKDGYVLASKEPGLGCPIDFNALDKLLIRIDR* |
| Ga0181538_100728644 | 3300014162 | Bog | WPMEYADRVYHKDKFRVDQDGYVNAPTEPGLGYPIDRDALDKIMVRIDR* |
| Ga0181538_103018211 | 3300014162 | Bog | KFRVDQDGYINAPTAPGLGYPIDRDALDKIMIRIDR* |
| Ga0181532_102605681 | 3300014164 | Bog | DKFRVDQDGYINAPTAPGLGYPIDRDALDKMMVRIDR* |
| Ga0181523_107403432 | 3300014165 | Bog | TDRSYFSYKFRPDADGYVPAPTAPGLGYPIDRAALDKVTTRIDR* |
| Ga0181534_101563032 | 3300014168 | Bog | RPDADGYVPAPTAPGLGYPIDRDALDKVTKRIDR* |
| Ga0181534_108648911 | 3300014168 | Bog | PYYTPRLRIDRDGYVAAPTEPGLGYSIDHNALDKVLKRVDS* |
| Ga0181531_108301982 | 3300014169 | Bog | EYSYKFRPDADGYVPAPTAPGLGYAIDRAALDKVTLKINR* |
| Ga0181535_103362261 | 3300014199 | Bog | FRVDKDGYIAAPTAPGLGYPIDRDELDKMTKRIDA* |
| Ga0181535_105558292 | 3300014199 | Bog | EYADRPFYKDKFRIDADGYVHAPTAPGLGYPLDMDALDNMTKRIDR* |
| Ga0181526_107973081 | 3300014200 | Bog | AVDRPYQAKFRVDTDGYVLAPTEPGLGYPIDHDALDKIMKRVDR* |
| Ga0181526_108478052 | 3300014200 | Bog | PEYKDKFRVNEEGYVLAPTAPGLGYPIDRDALDKVTKRIDR* |
| Ga0181537_110350702 | 3300014201 | Bog | DRPEYKDKFRINEDGYVLAPTAPGLGYPIDRDALDKMTKRIDR* |
| Ga0181537_112198971 | 3300014201 | Bog | KFRLDKDGYVNAPPGPGLGMELDRDGLDRILLRIDR* |
| Ga0182013_102617522 | 3300014492 | Bog | SDRAYHKDKFRVDAEGYIHAPTAPGLGYPFDRDVLDKMTKRIDV* |
| Ga0182017_101647892 | 3300014494 | Fen | QDRSYHKDKIRIDKDGYVPAPTAPGLGYPLDRDVMDKIMINIER* |
| Ga0182011_104655641 | 3300014496 | Fen | EYSDRVYHKDKFRVDQNGYINAPTEPGLGYPIDRDALDKIMVRIDR* |
| Ga0182011_108759402 | 3300014496 | Fen | YHKDKFRIDENGYVNAPTEPGLGYPIDHDALDKMMVRVDK* |
| Ga0182011_109290422 | 3300014496 | Fen | PWPMGSFDRVYHKDKIRPDADGYVHAPTAPGLGYPLDRDALDKITKRIDR* |
| Ga0182019_105603741 | 3300014498 | Fen | DRPFYKDRFRIDADGYVHAPTAPGLGYPLDMDALDNMTKRIDR* |
| Ga0182019_112587222 | 3300014498 | Fen | YHKDKIRPDADGYVHAPTAPGLGYPLDRDALDKITKRIDR* |
| Ga0182012_103771611 | 3300014499 | Bog | ADRPYYKDKFRINEEGFVLAPTEPGLGYPINHDTLANMTIRINR* |
| Ga0182024_107933931 | 3300014501 | Permafrost | FRVDKDGYIPAPTAPGLGYPIDRDALDKITKRIDA* |
| Ga0182024_114312481 | 3300014501 | Permafrost | PEYKDKFRINEEGYVLAPTAPGLGYPIDRDALDKMTKRIDR* |
| Ga0182021_119638122 | 3300014502 | Fen | RAYSKTKFRVDQDGYVNATADPGLGCPIDHDALDKIMIRVDR* |
| Ga0182021_124668152 | 3300014502 | Fen | ADRPYQEKFRIDKDGYVLAPTEPGLGYPINRDALDKIMKRIDR* |
| Ga0181536_102391691 | 3300014638 | Bog | EYADRAYHKDKFRVDQDGYINAPTAPGLGYPIDRDALDKMMVRIDR* |
| Ga0181536_103645091 | 3300014638 | Bog | MPHPASYVDRPYHKDKFRIDKDSYVIASAAPGLGYPIDHDALDKMTKRIDR* |
| Ga0181536_103830622 | 3300014638 | Bog | VYHKDKFRVDKDGYVNAPAEPGLGYPIDRDALDKIMVRIDR* |
| Ga0181516_101453062 | 3300014655 | Bog | YADRPEYSYKFRPDADGYVPAPTEPGLGYPIDRAALDKITKRIDR* |
| Ga0181522_101648582 | 3300014657 | Bog | HKDKFRIDKDGYVLAPTAPGLGYPFDRDVLDKMTKRVDV* |
| Ga0181522_106630451 | 3300014657 | Bog | HKDRFRVDKDGYIAAPAAPGLGYPIDRDTLDKMTKRIDA* |
| Ga0181519_102512901 | 3300014658 | Bog | YHKDKFRVDKDGYIAAPTAPGLGYPIDRDELDKMTKRIDA* |
| Ga0181519_108886142 | 3300014658 | Bog | RPYHKDKFRIDKDGYIMAPTAPGLGYPFDRDVLDKMTKRVDV* |
| Ga0182030_115832351 | 3300014838 | Bog | SDRVYHKDKFRIDQEGYVNAPTEPGLGYPIDRDALDRIMVRIDR* |
| Ga0182030_116246831 | 3300014838 | Bog | PYQAKFRIDKDGYVLAPTEPGLGYPIDRNELDKIMKRIDR* |
| Ga0182027_100354031 | 3300014839 | Fen | RVYHKDKFRVDKDGYINAPTEPGLGYPIDRDALDKIMVRIDR* |
| Ga0182027_101749693 | 3300014839 | Fen | YHKDKFRIDKDSYVIASAEPGLGYPIDRDVLDKMTKRIDR* |
| Ga0182027_103696011 | 3300014839 | Fen | PYHKDKCRIDKDSYVIASAAPGLGYPIDHDALDKMTKKIDR* |
| Ga0182027_114728731 | 3300014839 | Fen | PHPSSYVDRPYHKDKFRIDKDSYVIASAAPGLGYPIDHDALDKMTKRIDR* |
| Ga0182027_116579632 | 3300014839 | Fen | FRIDADGYVHAPTAPGLGYPLDFDALEKMTIRIDR* |
| Ga0182027_117266831 | 3300014839 | Fen | KFRIDADGYVVAPTAPGLGYPMDMDALDKMLIRVDK* |
| Ga0182027_118996311 | 3300014839 | Fen | WPMEYSDRAYHKDKFRIDQEGYVIAPTEPGLGYPLDRDALDKMMVRIDR* |
| Ga0132255_1021669452 | 3300015374 | Arabidopsis Rhizosphere | RIDKDGYVFAPTEPGLGYPIDRDALDKILKKIDR* |
| Ga0181513_13872702 | 3300016700 | Peatland | PHPVTAVDRPYHKDKFRIDKDGYVLAPTQPGLGYPIDRNELDKIMKRVET |
| Ga0181500_13709132 | 3300016728 | Peatland | YADRPFYKDKFRIDADGYVHAPTAPGLGYPLDMNALDNMTKRIDR |
| Ga0181515_11612743 | 3300016730 | Peatland | FRIDKDSYVIASAEPGLGYPLDRDALDKMTKRIDR |
| Ga0187849_12732141 | 3300017929 | Peatland | YHKDKFRIDQDGYIHAPTEPGLGYPLDRDALDKIMVRIDR |
| Ga0187848_102587591 | 3300017935 | Peatland | TDPSYFSYKFRPDKDGYIPAPTDPGLGYPIDRAALDKVTTRIDR |
| Ga0187854_100407441 | 3300017938 | Peatland | PFPAEYADRPYYQDKFRIDADGYVHAPTAPGLGYPLDMNALDNMTLRIDR |
| Ga0187879_103170222 | 3300017946 | Peatland | TFRIDAEGYVQAPTQPGLGYPIDRDALDKMIKRIDR |
| Ga0181520_104240772 | 3300017988 | Bog | GQFRVDKDSYILASTAPGLGITLDRDALDKITTRIDR |
| Ga0181520_108714881 | 3300017988 | Bog | PAEYADRPYHKDKFRIDKDGYIAAPTAPRLGYPLDRDALDKMTKRIDV |
| Ga0181520_109750511 | 3300017988 | Bog | DKFRIDKSGYVVATAEPGLGVALDRGALDKMTKTINR |
| Ga0187888_10058381 | 3300018008 | Peatland | SYVDRPYHKDKFRIDKDSYVIASAEPGLGYPLDRDALDKMTKRIDR |
| Ga0187872_101158872 | 3300018017 | Peatland | SYFSYKFRPDKDGYIPAPTDPGLGYPIDRAALDKVTTRIDR |
| Ga0187872_104990831 | 3300018017 | Peatland | DRPYYKDNFRIDADGYVHAPTAPGLGYPLDFDALEKMTIRIDR |
| Ga0187867_106734941 | 3300018033 | Peatland | QFRVDKDSYILASTAPGLGITLDRDALDKITTRIDR |
| Ga0187855_105574821 | 3300018038 | Peatland | PKFRIDQEGYVHAPTEPGLGYPIDRDALDKIMNRIDR |
| Ga0187871_101599842 | 3300018042 | Peatland | SYFSYKFRPDADGYIPAPTEPGLGYPIDRAALDKVTTRIDR |
| Ga0187871_102682321 | 3300018042 | Peatland | YQDKFRIDADGYVHAPTAPGLGYPLDMNALDNMTKRIDR |
| Ga0187887_103502771 | 3300018043 | Peatland | PAEYADRPYHKYKFRVDADGYIPAPTAPGLGYPLDRGALDKMTTRVDV |
| Ga0187887_106158352 | 3300018043 | Peatland | FYKDKFRIDAEGYVVAPTAPGLGYPLDMDALDKMLIRIDR |
| Ga0187887_108502242 | 3300018043 | Peatland | FYKDKFRIDADGYVHAPTLPGLGYPLDMDALDKMIKRIDR |
| Ga0187890_105744642 | 3300018044 | Peatland | DRSYFSYKFRPDADGYIPAPTEPGLGYPIDRAALDKVTLRIDR |
| Ga0187890_107926381 | 3300018044 | Peatland | YADRPFYKDKFRIDAEGYVVAPTAPGLGYPLDMDALDKMLIRIDR |
| Ga0181512_13815532 | 3300019270 | Peatland | FEMPHPSSYVDRPWARDKFRIDKSGYVVATAEPGLGVALDRGALDKMTKTINR |
| Ga0182031_13694552 | 3300019787 | Bog | LVRDAASGHAADRPYQAKFRIDKDGYVLAPTEPGWISIDRNELDKIMKRIDR |
| Ga0182028_12991331 | 3300019788 | Fen | DRPYQAKFRIEKDGYVLAPTEPGLGYPIDRDALDKIMKRIDR |
| Ga0182028_13208234 | 3300019788 | Fen | MKEKFRLDPNGSVLAPKYPGLGYPLDRDALDKIMIRIDR |
| Ga0224542_10439822 | 3300022516 | Soil | KFRPDQDGYISAPTAPGIGYPIDRDALDKRLKRIDR |
| Ga0224538_10303242 | 3300022520 | Soil | HPLFKVKFRPDQDGYISAPTAPGIGYPIDRDALDKRLKRIDR |
| Ga0236338_11211341 | 3300022593 | Freshwater | ATAADRPYQAKFRIDKDGYVLAPTEPGLGYPIDRNALDKIMKRIDR |
| Ga0224559_10919461 | 3300023091 | Soil | PYFNYKFRPDKDGNILAPTAPGLGYPIDRDALDKIIKRIDH |
| Ga0208455_10133763 | 3300025453 | Peatland | YHKDKFRIDKDSYVIASAEPGLGYPLDRDALDKMTKRIDR |
| Ga0208937_10933491 | 3300025506 | Peatland | VDRPYHKDKFRIDKDSYVIASAEPGLGYPLDRDALDKMTKRIDR |
| Ga0208188_10239373 | 3300025507 | Peatland | PVTAADRPYQPKFRIDPDGYVLAPTEPGLGYPIDRDALDKILKRIDR |
| Ga0209585_102446611 | 3300025891 | Arctic Peat Soil | FRTDANGFVLAPTEPGLGYPFDRAALDKIMIRIDR |
| Ga0207694_109777012 | 3300025924 | Corn Rhizosphere | FNHKFRPDAEGYIHAPTEPGLGYPIDRAALDRITKRIER |
| Ga0207651_111473061 | 3300025960 | Switchgrass Rhizosphere | WFEVPHPAEYADRPYHKHKFRVEKDGHIPAPTELGLGYPIDSSCADKMLVRVDR |
| Ga0255351_10269971 | 3300026456 | Soil | PEYKDKFRINKDGYILAPTEPGLGYPIDRDALDKVTKRIDR |
| Ga0208043_10198133 | 3300027570 | Peatlands Soil | YQAQFRIDKDGYVLAPTEPGLGYPIDRNALDKLMKRIDR |
| Ga0208565_12295841 | 3300027662 | Peatlands Soil | YADRPYYKDKFRIDADGYVHAPAAPGLGYPLDMDALDNMTKRIDR |
| Ga0209067_104829622 | 3300027898 | Watersheds | VEYSDRPYHKDKFRIDAEGYIHAPTAPGLGYPFDRDVLDKMTKRVDV |
| Ga0265326_100173471 | 3300028558 | Rhizosphere | KFRIDSEGYIPAPTEPGLGYPIDHDALDKITKKISR |
| Ga0302151_102077752 | 3300028562 | Bog | YYKDKFRIDAEGFVSAPTAPGLGYPLDYDALDKMMKRIDK |
| Ga0302145_100878513 | 3300028565 | Bog | FKYQFRIDKDGYVPAPTEPGLGCPIDKDALDNITQRINR |
| Ga0265336_101702571 | 3300028666 | Rhizosphere | KFRLDKDGYVNAPPGPGLGLELDRDALDKILLRIDR |
| Ga0302301_11430931 | 3300028731 | Palsa | DRPYFKYKFRINEEGYVMAPTEAGLGYPIDRDALDKLTKRIDR |
| Ga0302219_100828042 | 3300028747 | Palsa | AYLKNKFRIDADSYILAPTDPGLGLPIDRDALDKVTKQINR |
| Ga0302156_100088711 | 3300028748 | Bog | EYADRPYYKDKFRIDADGFVSAPTAPGLGYPLDFDELDKMLKRVDK |
| Ga0302156_101868572 | 3300028748 | Bog | KFRIDAEGYIHAPTAPGLGYPFDRNVLDKMTKSITVG |
| Ga0302202_103413602 | 3300028762 | Bog | PYYKDKFRIDADGFVAAPTAPGLGYPLDHDALEKVLLRIDR |
| Ga0302266_103122962 | 3300028779 | Bog | KYRPDVDGYIHAPTLPGLGVPINRAELDRLTKRIDR |
| Ga0302279_102645001 | 3300028783 | Bog | DKFRIDADGFVSAPTAPGLGYPLDFDALDKMLKRVDK |
| Ga0302222_101083892 | 3300028798 | Palsa | PYLKNKFRIDADSYVLAPTDPGLGLPIDRDALDKLTKQINR |
| Ga0302157_100360591 | 3300028813 | Bog | ADHPYFSHKFRPDKDGYIHAPTDPGMGYAIDRAALDKAIKRIDR |
| Ga0302154_101541342 | 3300028882 | Bog | PAEYADRPFYKDKFRIDAEGYVHAPTAPGLGYPLDMNALDNMTKRIDR |
| Ga0308309_113467381 | 3300028906 | Soil | LKNKFRIDQDSYILAPTEPGLGLLIDRAALDKITKQILR |
| Ga0247275_11354932 | 3300029817 | Soil | DKFRIDADGYVHAPTAPGLGYPLDMNALDNMTLRIDR |
| Ga0311368_106893301 | 3300029882 | Palsa | KYKFRIDSDGCVAAPTEPGLGYPIDRTELDKVTKQVLR |
| Ga0311327_100010701 | 3300029883 | Bog | KFRPDKDGYIHAPTDPGMGYAIDRAALDKAIKRIDR |
| Ga0311369_108593871 | 3300029910 | Palsa | YKFRPDQDGYIPAPTEPGLGYPIDRAALDKVTTKIAR |
| Ga0311369_111862461 | 3300029910 | Palsa | YKDKFRINEEGYVLAPTAPGLGYPIDRDALDKVTKRIDR |
| Ga0311359_104187421 | 3300029914 | Bog | KDKFRIDADGYVHAPTSPGLGYPLDMDALDNMTKRIDR |
| Ga0302148_10057171 | 3300029916 | Bog | PYYKDKFRIDADGFVSAPTAPGLGYPLDFDALDKMLKRVDK |
| Ga0311326_101553702 | 3300029917 | Bog | YADRPEYKDKFRINKDGYILAPTEPGLGYPIDHDALDKVTKRIDR |
| Ga0311326_104349472 | 3300029917 | Bog | KFRPDADGYVPAPTAPGLGYAIDRAALDKVTLKINR |
| Ga0302142_11215832 | 3300029920 | Bog | DRPYYKDKFRIDADGFVSAPTAPGLGYPLDFDALDKMLKRVDK |
| Ga0311371_101109681 | 3300029951 | Palsa | DRPYYKDKFRIDEEGYVLAPTAPGLGYPIDHDALANLTKRIDR |
| Ga0311346_113502671 | 3300029952 | Bog | DKFRIDSEGYVHAPTAPGLGYPFDKAILDKLTLRVDV |
| Ga0311342_101155041 | 3300029955 | Bog | PELADHPYFNYKFRPDKDGNILAPTAPGLGYPIDRDALDKIIKRIDH |
| Ga0302280_11731212 | 3300029985 | Fen | EYADRPYYKDKFRIDADGFVSAPTAPGLGYPLDFDALDKMLKRVDK |
| Ga0302304_103556061 | 3300029993 | Palsa | YLKTKLRINQDSYVLAPTEPGLGLVIDHDALDRITKKINI |
| Ga0311344_103932552 | 3300030020 | Bog | YHKDKFRIDAEGYVHAPTAPGLGYPFDRDVLDKLTLRIDV |
| Ga0302196_100543613 | 3300030225 | Bog | PYFSHKFRPDKDGYIHAPTDPGMGYPIDRAALDKAIKRIDR |
| Ga0311349_122310512 | 3300030294 | Fen | RPYHKDRLRIDKDGYVPAPKAPGLGYPLDRDALDKITKRIDR |
| Ga0311353_110600442 | 3300030399 | Palsa | EYADRPYYKDKFRINEEGYVLAPTAPGLGYPIDHDSLANITKRIDR |
| Ga0311357_103676562 | 3300030524 | Palsa | NKFRIDADSYILAPTDPGLGLPIDRDALDKVTKQINR |
| Ga0311355_1001046510 | 3300030580 | Palsa | KNKFRIDADSYILAPTDPGLGLPIDRDALDKVTKQINR |
| Ga0311356_108606871 | 3300030617 | Palsa | YYKDKFRIDEEGYVLAPTAPGLGYPIDHDALANLTKRIDR |
| Ga0311354_107439011 | 3300030618 | Palsa | PEYADRPYYKDKFRINEEGFVLAPTEPGLGYPINHDTLANMTIRINR |
| Ga0311345_108215681 | 3300030688 | Bog | PEEYADRPEYKDKFRINKDGYILAPTEPGLGYPIDRDALDKVTKRIDR |
| Ga0311345_112052361 | 3300030688 | Bog | FTDRGYLKQRFRIDQDSNVLAPTAPGLGLPLDRDALDKLTVRIER |
| Ga0302314_111293131 | 3300030906 | Palsa | KFRIDEEGYVLAPTAPGLGYPIDHDALANLTKRIDR |
| Ga0302323_1020631361 | 3300031232 | Fen | AKFRIDKDGYVLAPTEPGLGYPIDRNELDKIMKRIDR |
| Ga0302325_110450692 | 3300031234 | Palsa | RPYLKNKFRIDQDSYVLAPTDPGLGLPIDRAALDKLTTKILR |
| Ga0302325_124520412 | 3300031234 | Palsa | PATAVDRPYQAQFRIDKDGYVPAPTEPGLGYPIDRNALDKLLKRIDR |
| Ga0265329_103477661 | 3300031242 | Rhizosphere | DKFRIDKDGYVLAPTAPGLGYPIDRDELDKLMKRIDK |
| Ga0265339_103294791 | 3300031249 | Rhizosphere | PNSAEHTDRVYMKEKFRIDKDGYVLAPKYPGLGYPLDRDALDKIMIRIDR |
| Ga0265339_104803372 | 3300031249 | Rhizosphere | FRIDKDGYLLAPTEPGLGYPIDRNALDKLLKRIDR |
| Ga0265316_100734521 | 3300031344 | Rhizosphere | VYHKDKFRVDQDGYVSAPTQPGLGYPIDRDALDKIMVRIDR |
| Ga0302320_105599793 | 3300031524 | Bog | KFRVDQDGYVNAPTEPGLGYPIDRDALDKIMVRIDR |
| Ga0302320_119437022 | 3300031524 | Bog | QTLTDRNYLKNKWRINKDGYVEAPTEPGLGCPLDRDNLDKMLTRIDR |
| Ga0265314_103939341 | 3300031711 | Rhizosphere | FPAEYADRAYHKDKFRIDADGYVLAPTAPGLGYPIDRDVLDKMILRIDR |
| Ga0302319_106550071 | 3300031788 | Bog | YTDRSYFNYKFRPDADGYVPAPTAPGLGYPIDRAALDKVTTRIDR |
| Ga0302322_1015189861 | 3300031902 | Fen | AEQTDRVYMKEKFRIDKDGYVLAPKYPGLGYPLDRDALDKIMIRIDR |
| Ga0308175_1030290232 | 3300031938 | Soil | FRPDAEGYIHAPTEPGLGYPIDRAALDRITKRIER |
| Ga0308174_119465001 | 3300031939 | Soil | YADRPYYKDKFRINEEGYVLAPTGPGLGYPIDRDALDKLTRRIDR |
| Ga0316225_10503832 | 3300032675 | Freshwater | TDRAYFKYQFRIDKDGYVPAPTEPGLGYPIDRAALDKLTTRIDR |
| Ga0316229_10176191 | 3300032676 | Freshwater | TDRAYFKYQFRIDKDGYVPAPTEPGLGYPIDRAALDKVTTRIDR |
| Ga0335070_104684181 | 3300032829 | Soil | YMRDKIRADENGYVHAPTEPGLGYPLDRAALDKITKRIDR |
| Ga0335084_110138631 | 3300033004 | Soil | KFRIDKDSYVLASTAPGLGYPIDHNALDKMTKRIDR |
| Ga0326728_105622352 | 3300033402 | Peat Soil | HKDKFRIDAEGYIHAPTAPGLGYPFDRAVLDKMTKRVDVG |
| Ga0334810_143808_429_575 | 3300033890 | Soil | HPATAVDRPYQDKFRIDKDGYVLAPTAPGLGYPINRNELDKLMKRIDR |
| Ga0326724_0420920_551_703 | 3300034091 | Peat Soil | PDLTIKEVKVYHKDKFRIDEDSFVIASAEPGLGYPIDRDALDKMTKRIDR |
| Ga0370492_0101173_8_163 | 3300034282 | Untreated Peat Soil | MPHPIEYADRPYHKDKFRVDKDGYIAAPTAPGLGYPFDKDVLDKMTIRIDS |
| ⦗Top⦘ |