


| Basic Information | |
|---|---|
| Family ID | F032951 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 178 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 178 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 77.53 % |
| % of genes near scaffold ends (potentially truncated) | 37.08 % |
| % of genes from short scaffolds (< 2000 bps) | 82.02 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.551 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (39.326 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.584 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (83.708 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 42.55% Coil/Unstructured: 57.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 178 Family Scaffolds |
|---|---|---|
| PF13506 | Glyco_transf_21 | 2.81 |
| PF13578 | Methyltransf_24 | 1.12 |
| PF00041 | fn3 | 0.56 |
| PF13252 | DUF4043 | 0.56 |
| PF00227 | Proteasome | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 178 Family Scaffolds |
|---|---|---|---|
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.55 % |
| All Organisms | root | All Organisms | 40.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003277|JGI25908J49247_10040484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
| 3300003277|JGI25908J49247_10053587 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300003277|JGI25908J49247_10061667 | Not Available | 955 | Open in IMG/M |
| 3300003393|JGI25909J50240_1117023 | Not Available | 526 | Open in IMG/M |
| 3300003394|JGI25907J50239_1041164 | Not Available | 960 | Open in IMG/M |
| 3300003394|JGI25907J50239_1067822 | Not Available | 709 | Open in IMG/M |
| 3300003394|JGI25907J50239_1109078 | Not Available | 538 | Open in IMG/M |
| 3300003411|JGI25911J50253_10059827 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300003411|JGI25911J50253_10153071 | Not Available | 661 | Open in IMG/M |
| 3300003490|JGI25926J51410_1006216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2488 | Open in IMG/M |
| 3300003493|JGI25923J51411_1001690 | All Organisms → Viruses → Predicted Viral | 4656 | Open in IMG/M |
| 3300003497|JGI25925J51416_10074845 | Not Available | 845 | Open in IMG/M |
| 3300003616|JGI25928J51866_1007215 | All Organisms → Viruses → Predicted Viral | 3242 | Open in IMG/M |
| 3300004763|Ga0007746_1420460 | Not Available | 600 | Open in IMG/M |
| 3300004784|Ga0007744_1245208 | Not Available | 670 | Open in IMG/M |
| 3300004793|Ga0007760_10005796 | Not Available | 698 | Open in IMG/M |
| 3300004794|Ga0007751_11250499 | Not Available | 656 | Open in IMG/M |
| 3300005581|Ga0049081_10013424 | All Organisms → Viruses → Predicted Viral | 3094 | Open in IMG/M |
| 3300005581|Ga0049081_10035574 | All Organisms → Viruses → Predicted Viral | 1893 | Open in IMG/M |
| 3300005581|Ga0049081_10197431 | Not Available | 722 | Open in IMG/M |
| 3300005581|Ga0049081_10260301 | Not Available | 606 | Open in IMG/M |
| 3300005581|Ga0049081_10287067 | Not Available | 569 | Open in IMG/M |
| 3300005581|Ga0049081_10306287 | Not Available | 546 | Open in IMG/M |
| 3300005582|Ga0049080_10025600 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
| 3300005582|Ga0049080_10038423 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300005583|Ga0049085_10194424 | Not Available | 675 | Open in IMG/M |
| 3300005584|Ga0049082_10174712 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005585|Ga0049084_10306161 | Not Available | 527 | Open in IMG/M |
| 3300005943|Ga0073926_10044756 | Not Available | 849 | Open in IMG/M |
| 3300006014|Ga0073919_1027226 | Not Available | 541 | Open in IMG/M |
| 3300006805|Ga0075464_10528420 | Not Available | 723 | Open in IMG/M |
| 3300007708|Ga0102859_1043059 | All Organisms → Viruses → Predicted Viral | 1238 | Open in IMG/M |
| 3300008055|Ga0108970_11372622 | Not Available | 741 | Open in IMG/M |
| 3300008107|Ga0114340_1016077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6436 | Open in IMG/M |
| 3300008258|Ga0114840_1059537 | Not Available | 593 | Open in IMG/M |
| 3300008957|Ga0104239_1021974 | Not Available | 557 | Open in IMG/M |
| 3300009068|Ga0114973_10064512 | All Organisms → Viruses → Predicted Viral | 2131 | Open in IMG/M |
| 3300009068|Ga0114973_10150702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1292 | Open in IMG/M |
| 3300009151|Ga0114962_10098080 | Not Available | 1828 | Open in IMG/M |
| 3300009151|Ga0114962_10249960 | Not Available | 1011 | Open in IMG/M |
| 3300009151|Ga0114962_10370622 | Not Available | 781 | Open in IMG/M |
| 3300009154|Ga0114963_10078517 | All Organisms → Viruses → Predicted Viral | 2050 | Open in IMG/M |
| 3300009154|Ga0114963_10113869 | Not Available | 1639 | Open in IMG/M |
| 3300009154|Ga0114963_10284544 | Not Available | 926 | Open in IMG/M |
| 3300009154|Ga0114963_10652041 | Not Available | 548 | Open in IMG/M |
| 3300009155|Ga0114968_10018132 | All Organisms → Viruses → Predicted Viral | 4890 | Open in IMG/M |
| 3300009155|Ga0114968_10160620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1327 | Open in IMG/M |
| 3300009155|Ga0114968_10485417 | Not Available | 665 | Open in IMG/M |
| 3300009155|Ga0114968_10706163 | Not Available | 528 | Open in IMG/M |
| 3300009158|Ga0114977_10081263 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
| 3300009163|Ga0114970_10158733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1354 | Open in IMG/M |
| 3300009163|Ga0114970_10357789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
| 3300009163|Ga0114970_10707562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300009181|Ga0114969_10140762 | Not Available | 1523 | Open in IMG/M |
| 3300009181|Ga0114969_10257385 | All Organisms → Viruses → Predicted Viral | 1046 | Open in IMG/M |
| 3300009183|Ga0114974_10005505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9437 | Open in IMG/M |
| 3300009183|Ga0114974_10033736 | All Organisms → Viruses → Predicted Viral | 3517 | Open in IMG/M |
| 3300009183|Ga0114974_10041835 | All Organisms → Viruses → Predicted Viral | 3110 | Open in IMG/M |
| 3300009183|Ga0114974_10152649 | All Organisms → Viruses → Predicted Viral | 1443 | Open in IMG/M |
| 3300009183|Ga0114974_10213572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1172 | Open in IMG/M |
| 3300009184|Ga0114976_10173736 | Not Available | 1197 | Open in IMG/M |
| 3300009684|Ga0114958_10085599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1638 | Open in IMG/M |
| 3300010334|Ga0136644_10423170 | Not Available | 752 | Open in IMG/M |
| 3300010885|Ga0133913_10483775 | All Organisms → Viruses → Predicted Viral | 3263 | Open in IMG/M |
| 3300010885|Ga0133913_12916533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1146 | Open in IMG/M |
| 3300010885|Ga0133913_13462547 | Not Available | 1031 | Open in IMG/M |
| 3300011011|Ga0139556_1031648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300011115|Ga0151514_10184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30769 | Open in IMG/M |
| 3300013004|Ga0164293_10143570 | All Organisms → Viruses → Predicted Viral | 1781 | Open in IMG/M |
| 3300013005|Ga0164292_10101046 | Not Available | 2174 | Open in IMG/M |
| 3300013006|Ga0164294_10186548 | Not Available | 1478 | Open in IMG/M |
| 3300013295|Ga0170791_12553381 | Not Available | 608 | Open in IMG/M |
| 3300013372|Ga0177922_10449829 | Not Available | 630 | Open in IMG/M |
| 3300017701|Ga0181364_1020247 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
| 3300017722|Ga0181347_1180906 | Not Available | 562 | Open in IMG/M |
| 3300017722|Ga0181347_1201765 | Not Available | 522 | Open in IMG/M |
| 3300017723|Ga0181362_1027761 | Not Available | 1207 | Open in IMG/M |
| 3300017723|Ga0181362_1106607 | Not Available | 554 | Open in IMG/M |
| 3300017736|Ga0181365_1116548 | Not Available | 641 | Open in IMG/M |
| 3300017736|Ga0181365_1121989 | Not Available | 624 | Open in IMG/M |
| 3300017761|Ga0181356_1079040 | Not Available | 1095 | Open in IMG/M |
| 3300017774|Ga0181358_1112948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300017774|Ga0181358_1210719 | Not Available | 631 | Open in IMG/M |
| 3300017774|Ga0181358_1277951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 517 | Open in IMG/M |
| 3300017777|Ga0181357_1113253 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300017777|Ga0181357_1153989 | Not Available | 845 | Open in IMG/M |
| 3300017777|Ga0181357_1231719 | Not Available | 648 | Open in IMG/M |
| 3300017777|Ga0181357_1242658 | Not Available | 628 | Open in IMG/M |
| 3300017777|Ga0181357_1283515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 567 | Open in IMG/M |
| 3300017777|Ga0181357_1317481 | Not Available | 525 | Open in IMG/M |
| 3300017778|Ga0181349_1104736 | Not Available | 1056 | Open in IMG/M |
| 3300017778|Ga0181349_1125562 | Not Available | 942 | Open in IMG/M |
| 3300017780|Ga0181346_1224248 | Not Available | 667 | Open in IMG/M |
| 3300017780|Ga0181346_1243574 | Not Available | 631 | Open in IMG/M |
| 3300017780|Ga0181346_1302880 | Not Available | 542 | Open in IMG/M |
| 3300017784|Ga0181348_1270043 | Not Available | 581 | Open in IMG/M |
| 3300017784|Ga0181348_1306662 | Not Available | 530 | Open in IMG/M |
| 3300017785|Ga0181355_1382770 | Not Available | 512 | Open in IMG/M |
| 3300019784|Ga0181359_1063193 | Not Available | 1414 | Open in IMG/M |
| 3300019784|Ga0181359_1074706 | Not Available | 1279 | Open in IMG/M |
| 3300019784|Ga0181359_1077231 | All Organisms → Viruses → Predicted Viral | 1253 | Open in IMG/M |
| 3300019784|Ga0181359_1087729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1157 | Open in IMG/M |
| 3300019784|Ga0181359_1133906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300019784|Ga0181359_1140484 | Not Available | 841 | Open in IMG/M |
| 3300019784|Ga0181359_1150589 | Not Available | 798 | Open in IMG/M |
| 3300019784|Ga0181359_1173062 | Not Available | 720 | Open in IMG/M |
| 3300019784|Ga0181359_1178317 | Not Available | 704 | Open in IMG/M |
| 3300020151|Ga0211736_10032874 | Not Available | 683 | Open in IMG/M |
| 3300020159|Ga0211734_10150247 | Not Available | 1272 | Open in IMG/M |
| 3300020160|Ga0211733_10948964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1259 | Open in IMG/M |
| 3300020161|Ga0211726_10822670 | Not Available | 588 | Open in IMG/M |
| 3300020172|Ga0211729_10734416 | Not Available | 657 | Open in IMG/M |
| 3300021963|Ga0222712_10316426 | Not Available | 973 | Open in IMG/M |
| 3300022190|Ga0181354_1110472 | Not Available | 889 | Open in IMG/M |
| 3300022190|Ga0181354_1127942 | Not Available | 811 | Open in IMG/M |
| 3300022190|Ga0181354_1129401 | Not Available | 805 | Open in IMG/M |
| 3300022190|Ga0181354_1164552 | Not Available | 685 | Open in IMG/M |
| 3300022752|Ga0214917_10013349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7337 | Open in IMG/M |
| 3300022752|Ga0214917_10098233 | All Organisms → Viruses → Predicted Viral | 1715 | Open in IMG/M |
| 3300023174|Ga0214921_10006422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16126 | Open in IMG/M |
| 3300023174|Ga0214921_10030450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5309 | Open in IMG/M |
| 3300023174|Ga0214921_10097980 | All Organisms → Viruses → Predicted Viral | 2217 | Open in IMG/M |
| 3300023174|Ga0214921_10108125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2053 | Open in IMG/M |
| 3300023174|Ga0214921_10363268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 762 | Open in IMG/M |
| 3300023184|Ga0214919_10008844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13126 | Open in IMG/M |
| 3300024348|Ga0244776_10765713 | Not Available | 588 | Open in IMG/M |
| 3300027608|Ga0208974_1000419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 17804 | Open in IMG/M |
| 3300027608|Ga0208974_1042296 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
| 3300027659|Ga0208975_1205341 | Not Available | 524 | Open in IMG/M |
| 3300027688|Ga0209553_1185162 | Not Available | 686 | Open in IMG/M |
| 3300027688|Ga0209553_1235615 | Not Available | 579 | Open in IMG/M |
| 3300027689|Ga0209551_1173197 | Not Available | 670 | Open in IMG/M |
| 3300027707|Ga0209443_1286928 | Not Available | 550 | Open in IMG/M |
| 3300027707|Ga0209443_1324534 | Not Available | 506 | Open in IMG/M |
| 3300027712|Ga0209499_1055684 | Not Available | 1609 | Open in IMG/M |
| 3300027712|Ga0209499_1145125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
| 3300027712|Ga0209499_1189577 | Not Available | 733 | Open in IMG/M |
| 3300027732|Ga0209442_1140926 | Not Available | 936 | Open in IMG/M |
| 3300027733|Ga0209297_1076910 | All Organisms → Viruses → Predicted Viral | 1462 | Open in IMG/M |
| 3300027736|Ga0209190_1049948 | All Organisms → Viruses → Predicted Viral | 2121 | Open in IMG/M |
| 3300027741|Ga0209085_1002412 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10668 | Open in IMG/M |
| 3300027744|Ga0209355_1205662 | Not Available | 802 | Open in IMG/M |
| 3300027754|Ga0209596_1022907 | All Organisms → Viruses → Predicted Viral | 3692 | Open in IMG/M |
| 3300027754|Ga0209596_1044837 | All Organisms → Viruses → Predicted Viral | 2357 | Open in IMG/M |
| 3300027759|Ga0209296_1005562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8038 | Open in IMG/M |
| 3300027770|Ga0209086_10037449 | All Organisms → Viruses → Predicted Viral | 2829 | Open in IMG/M |
| 3300027770|Ga0209086_10238389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300027772|Ga0209768_10189668 | Not Available | 931 | Open in IMG/M |
| 3300027772|Ga0209768_10254051 | Not Available | 760 | Open in IMG/M |
| 3300027772|Ga0209768_10311445 | Not Available | 658 | Open in IMG/M |
| 3300027782|Ga0209500_10143964 | Not Available | 1129 | Open in IMG/M |
| 3300027785|Ga0209246_10173434 | Not Available | 846 | Open in IMG/M |
| 3300027798|Ga0209353_10408078 | Not Available | 556 | Open in IMG/M |
| 3300027892|Ga0209550_10460109 | Not Available | 773 | Open in IMG/M |
| 3300027892|Ga0209550_10861359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300027892|Ga0209550_10866317 | Not Available | 500 | Open in IMG/M |
| 3300028025|Ga0247723_1011782 | All Organisms → Viruses → Predicted Viral | 3327 | Open in IMG/M |
| 3300028025|Ga0247723_1025404 | Not Available | 1931 | Open in IMG/M |
| 3300028025|Ga0247723_1049212 | Not Available | 1214 | Open in IMG/M |
| 3300028025|Ga0247723_1114168 | All Organisms → Viruses | 666 | Open in IMG/M |
| 3300031707|Ga0315291_11126765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300031746|Ga0315293_10452492 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300031772|Ga0315288_10713204 | Not Available | 943 | Open in IMG/M |
| 3300031873|Ga0315297_10809905 | Not Available | 781 | Open in IMG/M |
| 3300031885|Ga0315285_10319687 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300031952|Ga0315294_10826143 | Not Available | 795 | Open in IMG/M |
| 3300031952|Ga0315294_11172681 | Not Available | 626 | Open in IMG/M |
| 3300032046|Ga0315289_11207152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 609 | Open in IMG/M |
| 3300032173|Ga0315268_10790112 | Not Available | 950 | Open in IMG/M |
| 3300032177|Ga0315276_11554384 | Not Available | 687 | Open in IMG/M |
| 3300032342|Ga0315286_10737315 | Not Available | 1003 | Open in IMG/M |
| 3300032401|Ga0315275_12519723 | Not Available | 532 | Open in IMG/M |
| 3300033233|Ga0334722_10498291 | Not Available | 874 | Open in IMG/M |
| 3300033994|Ga0334996_0006909 | Not Available | 7689 | Open in IMG/M |
| 3300034018|Ga0334985_0047806 | All Organisms → Viruses → Predicted Viral | 3184 | Open in IMG/M |
| 3300034104|Ga0335031_0304728 | All Organisms → Viruses | 1035 | Open in IMG/M |
| 3300034166|Ga0335016_0645198 | Not Available | 570 | Open in IMG/M |
| 3300034279|Ga0335052_0074335 | All Organisms → Viruses → Predicted Viral | 2074 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 39.33% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.99% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.87% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.30% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.62% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.25% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.12% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.12% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.12% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.56% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.56% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004784 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006014 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008957 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT2 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027688 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25908J49247_100404845 | 3300003277 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTMRKDGTVKVQRDPKTGDIIKGSK*KKQ |
| JGI25908J49247_100535873 | 3300003277 | Freshwater Lake | MSSGQFVRHDGFNKSIVRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| JGI25908J49247_100616672 | 3300003277 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| JGI25909J50240_11170233 | 3300003393 | Freshwater Lake | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| JGI25907J50239_10411642 | 3300003394 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGXK* |
| JGI25907J50239_10678222 | 3300003394 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTMRKDGTVKVQRDPKTGDIIKGSK* |
| JGI25907J50239_11090781 | 3300003394 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| JGI25911J50253_100598275 | 3300003411 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| JGI25911J50253_101530712 | 3300003411 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKG |
| JGI25926J51410_10062166 | 3300003490 | Freshwater Lake | MSSGQFVRSDGFNKTIXXDGLILTLRKDGTVKVQRDPKTGDIIKGNK*QQHGHVKKARTLRVA* |
| JGI25923J51411_10016908 | 3300003493 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK*QQHGHVKKARTLRVA* |
| JGI25925J51416_100748454 | 3300003497 | Freshwater Lake | GQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| JGI25928J51866_10072152 | 3300003616 | Freshwater Lake | MSSGQFVRHDGFNKSIVRDGLILTLRKDGTVKVQRDPKTGDIIKGSK*VQRGHVKKARTLRVA* |
| Ga0007746_14204602 | 3300004763 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK*VQRGHVKKARTL |
| Ga0007744_12452081 | 3300004784 | Freshwater Lake | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGNK*VQRGHVKKARTL |
| Ga0007760_100057963 | 3300004793 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGD |
| Ga0007751_112504992 | 3300004794 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK*QQRGHAKK |
| Ga0049081_100134241 | 3300005581 | Freshwater Lentic | MSSGQFVRHDRFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK* |
| Ga0049081_100355745 | 3300005581 | Freshwater Lentic | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0049081_101974312 | 3300005581 | Freshwater Lentic | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0049081_102603013 | 3300005581 | Freshwater Lentic | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK* |
| Ga0049081_102870674 | 3300005581 | Freshwater Lentic | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0049081_103062872 | 3300005581 | Freshwater Lentic | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGSK* |
| Ga0049080_100256006 | 3300005582 | Freshwater Lentic | MSSGQFVRSDGFNKTIMKDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0049080_100384232 | 3300005582 | Freshwater Lentic | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0049085_101944243 | 3300005583 | Freshwater Lentic | MSSGRFVRHDSFNKTIMKDGLILTLRKDGTVKVQRDPKTGDIIKEKK* |
| Ga0049082_101747123 | 3300005584 | Freshwater Lentic | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGNK* |
| Ga0049084_103061611 | 3300005585 | Freshwater Lentic | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0073926_100447563 | 3300005943 | Sand | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGQK* |
| Ga0073919_10272264 | 3300006014 | Sand | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKG |
| Ga0075464_105284203 | 3300006805 | Aqueous | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGTK* |
| Ga0102859_10430594 | 3300007708 | Estuarine | SSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0108970_113726224 | 3300008055 | Estuary | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114340_101607711 | 3300008107 | Freshwater, Plankton | MSSGQFVRNDSFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114840_10595371 | 3300008258 | Freshwater, Plankton | RSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0104239_10219741 | 3300008957 | Freshwater | KENFRRTKKEIMSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDRIKESK* |
| Ga0114973_100645124 | 3300009068 | Freshwater Lake | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114973_101507021 | 3300009068 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDII |
| Ga0114962_100980806 | 3300009151 | Freshwater Lake | MSSGQFVRHDRFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114962_102499605 | 3300009151 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGSK* |
| Ga0114962_103706223 | 3300009151 | Freshwater Lake | MSSGQFVRNDGFNKTIMRNGLILTLRKDGTVKVQRDPKTGNIIKGNK* |
| Ga0114963_100785176 | 3300009154 | Freshwater Lake | MSSGQFVRNDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0114963_101138692 | 3300009154 | Freshwater Lake | MSSGQFVRSDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGSK* |
| Ga0114963_102845444 | 3300009154 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGIK* |
| Ga0114963_106520411 | 3300009154 | Freshwater Lake | DGFNKTIMRDGLILTLRKDGTVKVRRDPKTKNIIKGNK* |
| Ga0114968_100181327 | 3300009155 | Freshwater Lake | MSSGKFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGTK* |
| Ga0114968_101606206 | 3300009155 | Freshwater Lake | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKANK* |
| Ga0114968_104854173 | 3300009155 | Freshwater Lake | MSSGQFVRNDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114968_107061632 | 3300009155 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK* |
| Ga0114977_100812636 | 3300009158 | Freshwater Lake | MSSGQFVRSDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114970_101587337 | 3300009163 | Freshwater Lake | MSSGQFVRHDRFNKIIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114970_103577894 | 3300009163 | Freshwater Lake | MSSGQFVRNDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKG |
| Ga0114970_107075621 | 3300009163 | Freshwater Lake | ENFRRREKEIMSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKENK* |
| Ga0114969_101407625 | 3300009181 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVRRDPKTGDIIKGSK* |
| Ga0114969_102573851 | 3300009181 | Freshwater Lake | NKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK* |
| Ga0114974_100055051 | 3300009183 | Freshwater Lake | NKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGNK* |
| Ga0114974_100337367 | 3300009183 | Freshwater Lake | MSSGKFIRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0114974_100418355 | 3300009183 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGTK* |
| Ga0114974_101526496 | 3300009183 | Freshwater Lake | MSSGQFVRSDGFNKTIMKDGLILTLRKDGTVKVQRDPKTGDIIKGTK* |
| Ga0114974_102135724 | 3300009183 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVRRDPKTGNIIKGIK* |
| Ga0114976_101737363 | 3300009184 | Freshwater Lake | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0114958_100855998 | 3300009684 | Freshwater Lake | MSSGQFVRNDGFNKTIMRNGLILTLRKDGTVKVQRDPKTGNIIKGSK* |
| Ga0136644_104231705 | 3300010334 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKWIK* |
| Ga0133913_104837755 | 3300010885 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGNK* |
| Ga0133913_129165331 | 3300010885 | Freshwater Lake | GFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK* |
| Ga0133913_134625472 | 3300010885 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKESK* |
| Ga0139556_10316481 | 3300011011 | Freshwater | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRD |
| Ga0151514_1018427 | 3300011115 | Freshwater | MSSGQFVRSDRFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK* |
| Ga0164293_101435703 | 3300013004 | Freshwater | MASSGSYKRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKQ* |
| Ga0164292_101010466 | 3300013005 | Freshwater | MSSGQFKRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKK* |
| Ga0164294_101865484 | 3300013006 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKEKQ* |
| Ga0170791_125533811 | 3300013295 | Freshwater | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKT |
| Ga0177922_104498293 | 3300013372 | Freshwater | SDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKK* |
| Ga0181364_10202474 | 3300017701 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDP |
| Ga0181347_11809063 | 3300017722 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0181347_12017651 | 3300017722 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGAVKVQRDPETGDISKGNK |
| Ga0181362_10277611 | 3300017723 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTMRKDGTVKVQRDPKT |
| Ga0181362_11066074 | 3300017723 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRGPKTGDIIKGNKXQQRGHVK |
| Ga0181365_11165482 | 3300017736 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRAPKTGDIIKGNK |
| Ga0181365_11219891 | 3300017736 | Freshwater Lake | MSSGQFVSSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNNPPFPS |
| Ga0181356_10790403 | 3300017761 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIVKGSK |
| Ga0181358_11129481 | 3300017774 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPK |
| Ga0181358_12107192 | 3300017774 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKEKQ |
| Ga0181358_12779513 | 3300017774 | Freshwater Lake | MSSGRFVRSDSFNKTIMKDGLILTLRKDGTIKVQRDPKTGDIIKEKK |
| Ga0181357_11132533 | 3300017777 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKK |
| Ga0181357_11539894 | 3300017777 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDI |
| Ga0181357_12317194 | 3300017777 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQKDP |
| Ga0181357_12426583 | 3300017777 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRMDGTVKVQRDPKTGDIIKGSK |
| Ga0181357_12835152 | 3300017777 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKEKK |
| Ga0181357_13174811 | 3300017777 | Freshwater Lake | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGSK |
| Ga0181349_11047361 | 3300017778 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTG |
| Ga0181349_11255625 | 3300017778 | Freshwater Lake | SSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0181346_12242484 | 3300017780 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGN |
| Ga0181346_12435741 | 3300017780 | Freshwater Lake | MSSGQFVRHDSFNKSIMRDGLILTLRKDGTVKVQKDPKTGDIIKGQK |
| Ga0181346_13028801 | 3300017780 | Freshwater Lake | FNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0181348_12700434 | 3300017784 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQKD |
| Ga0181348_13066621 | 3300017784 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTMRKDGTVKVQRDPKTGDIVKGNK |
| Ga0181355_13827701 | 3300017785 | Freshwater Lake | MSSGRFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGKK |
| Ga0181359_10631933 | 3300019784 | Freshwater Lake | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0181359_10747065 | 3300019784 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0181359_10772312 | 3300019784 | Freshwater Lake | MSSGQFVRHDGFNKSIVRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181359_10877292 | 3300019784 | Freshwater Lake | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181359_11339065 | 3300019784 | Freshwater Lake | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGD |
| Ga0181359_11404843 | 3300019784 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181359_11505894 | 3300019784 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIK |
| Ga0181359_11730624 | 3300019784 | Freshwater Lake | MSSGQFVRSDGFNKTIIRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181359_11783173 | 3300019784 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0211736_100328743 | 3300020151 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGSK |
| Ga0211734_101502474 | 3300020159 | Freshwater | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK |
| Ga0211733_109489645 | 3300020160 | Freshwater | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGSK |
| Ga0211726_108226702 | 3300020161 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK |
| Ga0211729_107344161 | 3300020172 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGQK |
| Ga0222712_103164263 | 3300021963 | Estuarine Water | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181354_11104722 | 3300022190 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGSK |
| Ga0181354_11279424 | 3300022190 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTG |
| Ga0181354_11294014 | 3300022190 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0181354_11645521 | 3300022190 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGQK |
| Ga0214917_100133498 | 3300022752 | Freshwater | MSSGQFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0214917_100982335 | 3300022752 | Freshwater | MSSGQFVRHDRFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGSK |
| Ga0214921_1000642213 | 3300023174 | Freshwater | MSSGQFVRNDGFNKTIMRDGLILTLRKDGTVKVRRDPKTGDIIKGNK |
| Ga0214921_100304508 | 3300023174 | Freshwater | MSSGQFVRSDGFNKTIMRDGLIFTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0214921_100979808 | 3300023174 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKESK |
| Ga0214921_101081257 | 3300023174 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGTK |
| Ga0214921_103632681 | 3300023174 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRD |
| Ga0214919_100088444 | 3300023184 | Freshwater | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGIK |
| Ga0244776_107657131 | 3300024348 | Estuarine | RFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0208974_100041916 | 3300027608 | Freshwater Lentic | MSSGQFVRHDRFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK |
| Ga0208974_10422966 | 3300027608 | Freshwater Lentic | MSSGQFVRSDGFNKTIMKDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0208975_12053414 | 3300027659 | Freshwater Lentic | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDI |
| Ga0209553_11851621 | 3300027688 | Freshwater Lake | MSSGQFVRHDGFNKSIVRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0209553_12356151 | 3300027688 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPK |
| Ga0209551_11731971 | 3300027689 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQR |
| Ga0209443_12869284 | 3300027707 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRD |
| Ga0209443_13245341 | 3300027707 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0209499_10556844 | 3300027712 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVRRDPKTKNIIKGNK |
| Ga0209499_11451255 | 3300027712 | Freshwater Lake | MSSGQFVRSDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGNIIKGSK |
| Ga0209499_11895773 | 3300027712 | Freshwater Lake | MSSGQFVRHDRFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209442_11409264 | 3300027732 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK |
| Ga0209297_10769105 | 3300027733 | Freshwater Lake | MSSGQFVRSDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209190_10499486 | 3300027736 | Freshwater Lake | MSSGKFVRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGTK |
| Ga0209085_10024123 | 3300027741 | Freshwater Lake | MSSGQFVRNDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0209355_12056621 | 3300027744 | Freshwater Lake | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGN |
| Ga0209596_10229078 | 3300027754 | Freshwater Lake | MSSGQFVRNDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209596_10448379 | 3300027754 | Freshwater Lake | MSSGQFVRHDRFNKIIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209296_100556211 | 3300027759 | Freshwater Lake | MSSGQFVRSDGFNKTIMKDGLILTLRKDGTVKVQRDPKTGDIIKGTK |
| Ga0209086_100374497 | 3300027770 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0209086_102383893 | 3300027770 | Freshwater Lake | RFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209768_101896681 | 3300027772 | Freshwater Lake | FVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209768_102540511 | 3300027772 | Freshwater Lake | GFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0209768_103114453 | 3300027772 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTMRKDGTVKVQRDPKTGDIIKG |
| Ga0209500_101439646 | 3300027782 | Freshwater Lake | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTG |
| Ga0209246_101734343 | 3300027785 | Freshwater Lake | MSSGRFVRHDSFNKTIMRDGLILTMRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209353_104080782 | 3300027798 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKT |
| Ga0209550_104601091 | 3300027892 | Freshwater Lake | MSSGQFVRHDGFNKSIMRDGLILTLRKDGTVKVQRDPKTGDI |
| Ga0209550_108613593 | 3300027892 | Freshwater Lake | RSNMSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0209550_108663173 | 3300027892 | Freshwater Lake | MSSGQFVRSDGFNKTITRDGLILTLRKDGTVKVQRDPKTGDIIKGNKXQQHGHVKKA |
| Ga0247723_10117825 | 3300028025 | Deep Subsurface Sediment | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGNK |
| Ga0247723_10254046 | 3300028025 | Deep Subsurface Sediment | MSSGQFVRNDSFNKTIMRDGLILTLRKDGTVKVRRDPKTGDVIKGSK |
| Ga0247723_10492122 | 3300028025 | Deep Subsurface Sediment | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDVIKGSNEKNKI |
| Ga0247723_11141681 | 3300028025 | Deep Subsurface Sediment | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIVKGTK |
| Ga0315291_111267653 | 3300031707 | Sediment | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKEKK |
| Ga0315293_104524925 | 3300031746 | Sediment | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK |
| Ga0315288_107132041 | 3300031772 | Sediment | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGD |
| Ga0315297_108099051 | 3300031873 | Sediment | GQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0315285_103196871 | 3300031885 | Sediment | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0315294_108261431 | 3300031952 | Sediment | SDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGQK |
| Ga0315294_111726812 | 3300031952 | Sediment | MSSGKFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0315289_112071521 | 3300032046 | Sediment | GQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKEKK |
| Ga0315268_107901124 | 3300032173 | Sediment | MSSGRFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGIK |
| Ga0315276_115543841 | 3300032177 | Sediment | MSSGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRNPKTGD |
| Ga0315286_107373155 | 3300032342 | Sediment | HDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGNK |
| Ga0315275_125197231 | 3300032401 | Sediment | MSSGQFVRHDSFNKTIMRDGLILTLRKDGTVKVQRDPKTGDII |
| Ga0334722_104982914 | 3300033233 | Sediment | MSSGRFVRHDGFNKTIMRDGLILTLRKDGTVKVQKDPKTGDIIKGKK |
| Ga0334996_0006909_4662_4805 | 3300033994 | Freshwater | MSSGQFVRHDGFNKTIIRDGLILTLRKDGTVKVRKDPKTGDIIKESK |
| Ga0334985_0047806_671_823 | 3300034018 | Freshwater | MSSGQFKRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKQ |
| Ga0335031_0304728_488_631 | 3300034104 | Freshwater | MSSGQFKRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0335016_0645198_433_570 | 3300034166 | Freshwater | SGQFVRSDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIIKGSK |
| Ga0335052_0074335_1_168 | 3300034279 | Freshwater | SKEEVMSSGQFKRHDGFNKTIMRDGLILTLRKDGTVKVQRDPKTGDIINQRKGKQ |
| ⦗Top⦘ |