


| Basic Information | |
|---|---|
| Family ID | F032867 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDE |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.71 % |
| % of genes near scaffold ends (potentially truncated) | 14.53 % |
| % of genes from short scaffolds (< 2000 bps) | 83.24 % |
| Associated GOLD sequencing projects | 112 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (44.693 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (24.581 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.715 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.006 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.13% β-sheet: 0.00% Coil/Unstructured: 60.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF13155 | Toprim_2 | 1.12 |
| PF11753 | DUF3310 | 0.56 |
| PF01963 | TraB_PrgY_gumN | 0.56 |
| PF03083 | MtN3_slv | 0.56 |
| PF00476 | DNA_pol_A | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.56 |
| COG1916 | Pheromone shutdown protein TraB, contains GTxH motif (function unknown) | Function unknown [S] | 0.56 |
| COG4095 | Sugar transporter, SemiSWEET family, contains PQ motif | Carbohydrate transport and metabolism [G] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.31 % |
| Unclassified | root | N/A | 44.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10020075 | All Organisms → Viruses → Predicted Viral | 3196 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10080965 | All Organisms → Viruses → Predicted Viral | 1286 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10136914 | Not Available | 858 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10174669 | Not Available | 711 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10240537 | Not Available | 534 | Open in IMG/M |
| 3300000929|NpDRAFT_10104704 | All Organisms → Viruses → Predicted Viral | 1321 | Open in IMG/M |
| 3300001419|JGI11705J14877_10175356 | Not Available | 565 | Open in IMG/M |
| 3300002483|JGI25132J35274_1084710 | Not Available | 653 | Open in IMG/M |
| 3300002483|JGI25132J35274_1095375 | Not Available | 606 | Open in IMG/M |
| 3300004448|Ga0065861_1057115 | All Organisms → Viruses → Predicted Viral | 1351 | Open in IMG/M |
| 3300004448|Ga0065861_1097298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 813 | Open in IMG/M |
| 3300004461|Ga0066223_1145463 | Not Available | 586 | Open in IMG/M |
| 3300005512|Ga0074648_1022978 | All Organisms → Viruses → Predicted Viral | 3399 | Open in IMG/M |
| 3300005512|Ga0074648_1050364 | All Organisms → Viruses → Predicted Viral | 1814 | Open in IMG/M |
| 3300005512|Ga0074648_1215371 | Not Available | 526 | Open in IMG/M |
| 3300005611|Ga0074647_1001055 | All Organisms → cellular organisms → Bacteria | 12228 | Open in IMG/M |
| 3300005613|Ga0074649_1005163 | All Organisms → cellular organisms → Bacteria | 11542 | Open in IMG/M |
| 3300006025|Ga0075474_10042281 | All Organisms → Viruses → Predicted Viral | 1564 | Open in IMG/M |
| 3300006025|Ga0075474_10125255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 817 | Open in IMG/M |
| 3300006025|Ga0075474_10142734 | Not Available | 754 | Open in IMG/M |
| 3300006026|Ga0075478_10113709 | Not Available | 858 | Open in IMG/M |
| 3300006752|Ga0098048_1085051 | Not Available | 964 | Open in IMG/M |
| 3300006752|Ga0098048_1149832 | Not Available | 695 | Open in IMG/M |
| 3300006752|Ga0098048_1213830 | Not Available | 567 | Open in IMG/M |
| 3300006789|Ga0098054_1012186 | All Organisms → Viruses → Predicted Viral | 3528 | Open in IMG/M |
| 3300006793|Ga0098055_1060596 | All Organisms → Viruses → Predicted Viral | 1511 | Open in IMG/M |
| 3300006802|Ga0070749_10522226 | Not Available | 645 | Open in IMG/M |
| 3300006802|Ga0070749_10612260 | Not Available | 587 | Open in IMG/M |
| 3300006802|Ga0070749_10692380 | Not Available | 545 | Open in IMG/M |
| 3300006810|Ga0070754_10218482 | Not Available | 881 | Open in IMG/M |
| 3300006810|Ga0070754_10529491 | Not Available | 505 | Open in IMG/M |
| 3300006868|Ga0075481_10153262 | Not Available | 838 | Open in IMG/M |
| 3300006919|Ga0070746_10170164 | All Organisms → Viruses → Predicted Viral | 1052 | Open in IMG/M |
| 3300006920|Ga0070748_1142149 | Not Available | 896 | Open in IMG/M |
| 3300006921|Ga0098060_1012372 | All Organisms → Viruses → Predicted Viral | 2756 | Open in IMG/M |
| 3300006922|Ga0098045_1038790 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300006922|Ga0098045_1061261 | Not Available | 918 | Open in IMG/M |
| 3300006925|Ga0098050_1063033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 964 | Open in IMG/M |
| 3300006990|Ga0098046_1035342 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300007539|Ga0099849_1054497 | All Organisms → Viruses → Predicted Viral | 1657 | Open in IMG/M |
| 3300007539|Ga0099849_1366545 | Not Available | 510 | Open in IMG/M |
| 3300007540|Ga0099847_1080866 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300007542|Ga0099846_1127097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300007554|Ga0102820_1043752 | All Organisms → Viruses → Predicted Viral | 1089 | Open in IMG/M |
| 3300007640|Ga0070751_1376581 | Not Available | 515 | Open in IMG/M |
| 3300007725|Ga0102951_1228294 | Not Available | 528 | Open in IMG/M |
| 3300007778|Ga0102954_1021874 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
| 3300008012|Ga0075480_10439286 | Not Available | 637 | Open in IMG/M |
| 3300008012|Ga0075480_10559933 | Not Available | 545 | Open in IMG/M |
| 3300009000|Ga0102960_1117645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300009001|Ga0102963_1023099 | All Organisms → Viruses → Predicted Viral | 2614 | Open in IMG/M |
| 3300009080|Ga0102815_10419947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300009149|Ga0114918_10276159 | Not Available | 947 | Open in IMG/M |
| 3300009149|Ga0114918_10352331 | Not Available | 811 | Open in IMG/M |
| 3300009435|Ga0115546_1184494 | Not Available | 726 | Open in IMG/M |
| 3300009472|Ga0115554_1425924 | Not Available | 518 | Open in IMG/M |
| 3300009507|Ga0115572_10143038 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
| 3300010149|Ga0098049_1067030 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
| 3300010296|Ga0129348_1134896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
| 3300010296|Ga0129348_1339049 | Not Available | 500 | Open in IMG/M |
| 3300010297|Ga0129345_1034348 | Not Available | 1968 | Open in IMG/M |
| 3300010297|Ga0129345_1121756 | Not Available | 956 | Open in IMG/M |
| 3300010297|Ga0129345_1193715 | Not Available | 723 | Open in IMG/M |
| 3300010297|Ga0129345_1225738 | Not Available | 659 | Open in IMG/M |
| 3300010299|Ga0129342_1282025 | Not Available | 574 | Open in IMG/M |
| 3300010300|Ga0129351_1209837 | Not Available | 754 | Open in IMG/M |
| 3300010318|Ga0136656_1189243 | Not Available | 693 | Open in IMG/M |
| 3300010368|Ga0129324_10397310 | Not Available | 533 | Open in IMG/M |
| 3300010389|Ga0136549_10028863 | All Organisms → Viruses → Predicted Viral | 3149 | Open in IMG/M |
| 3300011118|Ga0114922_10627749 | Not Available | 884 | Open in IMG/M |
| 3300012920|Ga0160423_11190836 | Not Available | 508 | Open in IMG/M |
| 3300017706|Ga0181377_1007051 | All Organisms → Viruses → Predicted Viral | 2878 | Open in IMG/M |
| 3300017706|Ga0181377_1014294 | All Organisms → Viruses → Predicted Viral | 1838 | Open in IMG/M |
| 3300017706|Ga0181377_1029951 | All Organisms → Viruses → Predicted Viral | 1130 | Open in IMG/M |
| 3300017706|Ga0181377_1042554 | Not Available | 894 | Open in IMG/M |
| 3300017710|Ga0181403_1003760 | All Organisms → Viruses → Predicted Viral | 3369 | Open in IMG/M |
| 3300017713|Ga0181391_1003789 | All Organisms → Viruses → Predicted Viral | 4151 | Open in IMG/M |
| 3300017714|Ga0181412_1114016 | Not Available | 628 | Open in IMG/M |
| 3300017719|Ga0181390_1070887 | Not Available | 980 | Open in IMG/M |
| 3300017719|Ga0181390_1146432 | Not Available | 597 | Open in IMG/M |
| 3300017720|Ga0181383_1055224 | All Organisms → Viruses → Predicted Viral | 1067 | Open in IMG/M |
| 3300017725|Ga0181398_1051739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300017726|Ga0181381_1076040 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 719 | Open in IMG/M |
| 3300017727|Ga0181401_1032687 | All Organisms → Viruses → Predicted Viral | 1489 | Open in IMG/M |
| 3300017730|Ga0181417_1028739 | All Organisms → Viruses → Predicted Viral | 1377 | Open in IMG/M |
| 3300017733|Ga0181426_1053185 | Not Available | 801 | Open in IMG/M |
| 3300017739|Ga0181433_1068142 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 888 | Open in IMG/M |
| 3300017740|Ga0181418_1060972 | Not Available | 931 | Open in IMG/M |
| 3300017742|Ga0181399_1025181 | All Organisms → Viruses → Predicted Viral | 1640 | Open in IMG/M |
| 3300017746|Ga0181389_1005739 | All Organisms → Viruses → Predicted Viral | 4353 | Open in IMG/M |
| 3300017748|Ga0181393_1132749 | Not Available | 627 | Open in IMG/M |
| 3300017755|Ga0181411_1004976 | All Organisms → Viruses → Predicted Viral | 4586 | Open in IMG/M |
| 3300017756|Ga0181382_1143439 | Not Available | 626 | Open in IMG/M |
| 3300017771|Ga0181425_1047130 | All Organisms → Viruses → Predicted Viral | 1406 | Open in IMG/M |
| 3300017772|Ga0181430_1056868 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
| 3300017779|Ga0181395_1108974 | Not Available | 885 | Open in IMG/M |
| 3300017782|Ga0181380_1058680 | All Organisms → Viruses → Predicted Viral | 1367 | Open in IMG/M |
| 3300017782|Ga0181380_1146001 | Not Available | 807 | Open in IMG/M |
| 3300017956|Ga0181580_10336147 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300017963|Ga0180437_10868871 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 649 | Open in IMG/M |
| 3300017967|Ga0181590_10022200 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Xanthomarina → Xanthomarina gelatinilytica | 5133 | Open in IMG/M |
| 3300017967|Ga0181590_10752963 | Not Available | 652 | Open in IMG/M |
| 3300018416|Ga0181553_10117798 | All Organisms → Viruses → Predicted Viral | 1618 | Open in IMG/M |
| 3300018416|Ga0181553_10231659 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300018420|Ga0181563_10044072 | All Organisms → Viruses → Predicted Viral | 3201 | Open in IMG/M |
| 3300019098|Ga0188859_1000698 | All Organisms → Viruses → Predicted Viral | 1473 | Open in IMG/M |
| 3300019751|Ga0194029_1001257 | All Organisms → Viruses → Predicted Viral | 3206 | Open in IMG/M |
| 3300020185|Ga0206131_10111638 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
| 3300020191|Ga0181604_10221963 | Not Available | 903 | Open in IMG/M |
| 3300020438|Ga0211576_10252226 | Not Available | 927 | Open in IMG/M |
| 3300020439|Ga0211558_10023061 | All Organisms → Viruses → Predicted Viral | 3180 | Open in IMG/M |
| 3300021085|Ga0206677_10024364 | All Organisms → Viruses → Predicted Viral | 3548 | Open in IMG/M |
| 3300021368|Ga0213860_10001581 | All Organisms → cellular organisms → Bacteria | 9215 | Open in IMG/M |
| 3300021371|Ga0213863_10315230 | Not Available | 651 | Open in IMG/M |
| 3300021373|Ga0213865_10028736 | All Organisms → Viruses → Predicted Viral | 3123 | Open in IMG/M |
| 3300021389|Ga0213868_10576944 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 592 | Open in IMG/M |
| 3300021425|Ga0213866_10015848 | All Organisms → Viruses → Predicted Viral | 4542 | Open in IMG/M |
| 3300021425|Ga0213866_10094655 | All Organisms → Viruses → Predicted Viral | 1635 | Open in IMG/M |
| 3300021957|Ga0222717_10056819 | All Organisms → Viruses → Predicted Viral | 2522 | Open in IMG/M |
| 3300021957|Ga0222717_10102433 | All Organisms → Viruses → Predicted Viral | 1788 | Open in IMG/M |
| 3300021957|Ga0222717_10119705 | All Organisms → Viruses → Predicted Viral | 1630 | Open in IMG/M |
| 3300021957|Ga0222717_10212428 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300021958|Ga0222718_10019983 | All Organisms → Viruses → Predicted Viral | 4677 | Open in IMG/M |
| 3300021958|Ga0222718_10063891 | All Organisms → Viruses → Predicted Viral | 2277 | Open in IMG/M |
| 3300021958|Ga0222718_10078461 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300021958|Ga0222718_10288721 | Not Available | 856 | Open in IMG/M |
| 3300021959|Ga0222716_10231205 | All Organisms → Viruses → Predicted Viral | 1152 | Open in IMG/M |
| 3300022046|Ga0224897_102049 | Not Available | 628 | Open in IMG/M |
| 3300022050|Ga0196883_1004286 | All Organisms → Viruses → Predicted Viral | 1647 | Open in IMG/M |
| 3300022050|Ga0196883_1040714 | Not Available | 565 | Open in IMG/M |
| 3300022063|Ga0212029_1024370 | Not Available | 828 | Open in IMG/M |
| 3300022065|Ga0212024_1017732 | All Organisms → Viruses → Predicted Viral | 1138 | Open in IMG/M |
| 3300022067|Ga0196895_1024334 | Not Available | 680 | Open in IMG/M |
| 3300022074|Ga0224906_1143937 | Not Available | 676 | Open in IMG/M |
| 3300022159|Ga0196893_1027964 | Not Available | 528 | Open in IMG/M |
| 3300022164|Ga0212022_1067049 | Not Available | 552 | Open in IMG/M |
| 3300022183|Ga0196891_1012063 | All Organisms → Viruses → Predicted Viral | 1698 | Open in IMG/M |
| (restricted) 3300024059|Ga0255040_10378864 | Not Available | 598 | Open in IMG/M |
| (restricted) 3300024062|Ga0255039_10104381 | All Organisms → Viruses → Predicted Viral | 1133 | Open in IMG/M |
| 3300024262|Ga0210003_1371079 | Not Available | 527 | Open in IMG/M |
| 3300025070|Ga0208667_1005550 | All Organisms → Viruses → Predicted Viral | 3380 | Open in IMG/M |
| 3300025070|Ga0208667_1018887 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300025083|Ga0208791_1002801 | All Organisms → cellular organisms → Bacteria | 5595 | Open in IMG/M |
| 3300025083|Ga0208791_1029211 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300025127|Ga0209348_1125281 | Not Available | 775 | Open in IMG/M |
| 3300025151|Ga0209645_1086799 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
| 3300025151|Ga0209645_1091117 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300025151|Ga0209645_1194519 | Not Available | 602 | Open in IMG/M |
| 3300025508|Ga0208148_1110830 | Not Available | 578 | Open in IMG/M |
| 3300025543|Ga0208303_1030580 | All Organisms → Viruses → Predicted Viral | 1435 | Open in IMG/M |
| 3300025647|Ga0208160_1084670 | Not Available | 844 | Open in IMG/M |
| 3300025671|Ga0208898_1129293 | Not Available | 715 | Open in IMG/M |
| 3300025674|Ga0208162_1144826 | Not Available | 657 | Open in IMG/M |
| 3300025674|Ga0208162_1147877 | Not Available | 646 | Open in IMG/M |
| 3300025674|Ga0208162_1188633 | Not Available | 533 | Open in IMG/M |
| 3300025840|Ga0208917_1263719 | Not Available | 547 | Open in IMG/M |
| 3300025853|Ga0208645_1189971 | Not Available | 738 | Open in IMG/M |
| 3300025874|Ga0209533_1138058 | All Organisms → Viruses → Predicted Viral | 1117 | Open in IMG/M |
| 3300025889|Ga0208644_1083155 | All Organisms → Viruses → Predicted Viral | 1631 | Open in IMG/M |
| 3300025889|Ga0208644_1135830 | All Organisms → Viruses → Predicted Viral | 1150 | Open in IMG/M |
| 3300025889|Ga0208644_1357726 | Not Available | 554 | Open in IMG/M |
| 3300025889|Ga0208644_1364762 | Not Available | 545 | Open in IMG/M |
| 3300026138|Ga0209951_1051569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 882 | Open in IMG/M |
| 3300026187|Ga0209929_1066759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 986 | Open in IMG/M |
| 3300026187|Ga0209929_1135809 | Not Available | 611 | Open in IMG/M |
| 3300027188|Ga0208921_1034946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 750 | Open in IMG/M |
| 3300027917|Ga0209536_100877678 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300029448|Ga0183755_1021610 | All Organisms → Viruses → Predicted Viral | 2110 | Open in IMG/M |
| 3300031539|Ga0307380_10175422 | All Organisms → Viruses → Predicted Viral | 2098 | Open in IMG/M |
| 3300031539|Ga0307380_11244931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300031578|Ga0307376_10244425 | All Organisms → Viruses → Predicted Viral | 1212 | Open in IMG/M |
| 3300031669|Ga0307375_10330986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
| 3300031673|Ga0307377_10797938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 653 | Open in IMG/M |
| 3300032254|Ga0316208_1034493 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300032373|Ga0316204_11149165 | Not Available | 543 | Open in IMG/M |
| 3300034374|Ga0348335_013764 | All Organisms → Viruses → Predicted Viral | 4236 | Open in IMG/M |
| 3300034375|Ga0348336_020907 | All Organisms → Viruses → Predicted Viral | 3388 | Open in IMG/M |
| 3300034375|Ga0348336_063632 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300034418|Ga0348337_127263 | Not Available | 767 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 24.58% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 15.08% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 13.97% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 5.03% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.91% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.35% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.79% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.79% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.23% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.12% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.12% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 1.12% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.68% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.68% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.68% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.68% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.56% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.56% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.56% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.56% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.56% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment | 0.56% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.56% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005611 | Saline surface water microbial communities from Etoliko Lagoon, Greece | Environmental | Open in IMG/M |
| 3300005613 | Saline sediment microbial communities from Etoliko Lagoon, Greece - sediment | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022046 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 (v2) | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022067 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v3) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022159 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300024059 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2 | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032254 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100200757 | 3300000115 | Marine | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDENN* |
| DelMOSpr2010_100809655 | 3300000116 | Marine | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDE* |
| DelMOSpr2010_101369141 | 3300000116 | Marine | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDENL* |
| DelMOSpr2010_101746693 | 3300000116 | Marine | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDENI* |
| DelMOWin2010_102405373 | 3300000117 | Marine | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDENN* |
| NpDRAFT_101047044 | 3300000929 | Freshwater And Marine | MDEFRKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDD |
| JGI11705J14877_101753562 | 3300001419 | Saline Water And Sediment | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIGEEDDE* |
| JGI25132J35274_10847101 | 3300002483 | Marine | MDELEKIIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENNN* |
| JGI25132J35274_10953752 | 3300002483 | Marine | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDEN* |
| Ga0065861_10571155 | 3300004448 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEANESEYLADIEEEDNET* |
| Ga0065861_10972983 | 3300004448 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDNET* |
| Ga0066223_11454632 | 3300004461 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEEDEV* |
| Ga0074648_10229786 | 3300005512 | Saline Water And Sediment | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEVDDE* |
| Ga0074648_10503642 | 3300005512 | Saline Water And Sediment | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEDDDE* |
| Ga0074648_12153714 | 3300005512 | Saline Water And Sediment | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEVDDEDLD* |
| Ga0074647_100105512 | 3300005611 | Saline Water And Sediment | MDDMTQMIDDLIDNHYKVQHLIGTEADESEYLADISEDDDE* |
| Ga0074649_100516319 | 3300005613 | Saline Water And Sediment | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDDS* |
| Ga0075474_100422814 | 3300006025 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDDV* |
| Ga0075474_101252552 | 3300006025 | Aqueous | MDDIEKMIDNLVDNHYRVQHLIGTEADESEYLADISEEDDENL* |
| Ga0075474_101427342 | 3300006025 | Aqueous | MDDIEKIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDEC* |
| Ga0075478_101137092 | 3300006026 | Aqueous | MDEIEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE* |
| Ga0098048_10850515 | 3300006752 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQDLKEVDNE*YI* |
| Ga0098048_11498323 | 3300006752 | Marine | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEENDDI* |
| Ga0098048_12138301 | 3300006752 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDMEDKE*DMR* |
| Ga0098054_10121865 | 3300006789 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQDLKEVDNE* |
| Ga0098055_10605966 | 3300006793 | Marine | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEE |
| Ga0070749_105222263 | 3300006802 | Aqueous | MDELEKMIDDLVDNHYRRQHLIGTEADESEYLADISEEDDEDLD* |
| Ga0070749_106122602 | 3300006802 | Aqueous | MDDIEKIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDE* |
| Ga0070749_106923802 | 3300006802 | Aqueous | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDEDLD* |
| Ga0070754_102184825 | 3300006810 | Aqueous | DDIEEIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDE* |
| Ga0070754_105294911 | 3300006810 | Aqueous | DEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDENN* |
| Ga0075481_101532624 | 3300006868 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDE* |
| Ga0070746_101701644 | 3300006919 | Aqueous | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDER** |
| Ga0070748_11421494 | 3300006920 | Aqueous | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENN* |
| Ga0098060_10123727 | 3300006921 | Marine | MDELEQMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDE* |
| Ga0098045_10387902 | 3300006922 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEEDDE* |
| Ga0098045_10612615 | 3300006922 | Marine | VNMDEETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDMEDKE* |
| Ga0098050_10630333 | 3300006925 | Marine | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDE* |
| Ga0098046_10353422 | 3300006990 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEEGDE* |
| Ga0099849_10544975 | 3300007539 | Aqueous | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE* |
| Ga0099849_13665452 | 3300007539 | Aqueous | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEEDDEDLD* |
| Ga0099847_10808662 | 3300007540 | Aqueous | MDEIEKMIDDLIDNHYRRQHLIGTEADESEYLADISVEDDEDLD* |
| Ga0099846_11270971 | 3300007542 | Aqueous | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEVDDDS* |
| Ga0102820_10437524 | 3300007554 | Estuarine | MDELEKMIDNLVDNHYRRQHLIGTEADESEYLADIEEETYESI* |
| Ga0070751_13765813 | 3300007640 | Aqueous | MDELEKMIDDLIDNHYIRQHLIGTEADESEYLADIEEEDDENL* |
| Ga0102951_12282943 | 3300007725 | Water | MTQMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEC* |
| Ga0102954_10218743 | 3300007778 | Water | MDELEKMIDNLVDNHYRRQHLIGTEADESEYLADIEEETYG* |
| Ga0075480_104392861 | 3300008012 | Aqueous | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE* |
| Ga0075480_105599331 | 3300008012 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDE* |
| Ga0102960_11176456 | 3300009000 | Pond Water | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISE |
| Ga0102963_10230991 | 3300009001 | Pond Water | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEC* |
| Ga0102815_104199472 | 3300009080 | Estuarine | MDELEKMIDNLVDNHYMRQHLIGTEADESEYLADIEEETYESI* |
| Ga0114918_102761592 | 3300009149 | Deep Subsurface | MDELEKMIDDLIDNHYRVQHLIGTEANESEYLADIEEEDDDI* |
| Ga0114918_103523313 | 3300009149 | Deep Subsurface | MDELEKMIADLIDNHYRVQHLIGTEANESEYLADISEVDDEDSD* |
| Ga0115546_11844942 | 3300009435 | Pelagic Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDDI* |
| Ga0115554_14259241 | 3300009472 | Pelagic Marine | DDLIDNHYRRQHLIGTEADESEYLADIEEEDDDI* |
| Ga0115572_101430381 | 3300009507 | Pelagic Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDEA* |
| Ga0098049_10670304 | 3300010149 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDIKEADNE* |
| Ga0129348_11348961 | 3300010296 | Freshwater To Marine Saline Gradient | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEETYG* |
| Ga0129348_13390491 | 3300010296 | Freshwater To Marine Saline Gradient | MDDIEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEETYG* |
| Ga0129345_10343486 | 3300010297 | Freshwater To Marine Saline Gradient | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEDLD* |
| Ga0129345_11217564 | 3300010297 | Freshwater To Marine Saline Gradient | MDEIEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDEDLD* |
| Ga0129345_11937154 | 3300010297 | Freshwater To Marine Saline Gradient | MIDDLIDNHYRVQHLIGTEADESEYLADISEEDDE* |
| Ga0129345_12257384 | 3300010297 | Freshwater To Marine Saline Gradient | MDDIEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDE* |
| Ga0129342_12820253 | 3300010299 | Freshwater To Marine Saline Gradient | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDENLD* |
| Ga0129351_12098371 | 3300010300 | Freshwater To Marine Saline Gradient | MDDIEKMIDNLVDNHYRRQHLIGTEADESEYLADISEEDDE* |
| Ga0136656_11892433 | 3300010318 | Freshwater To Marine Saline Gradient | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEEDDENLD* |
| Ga0129324_103973102 | 3300010368 | Freshwater To Marine Saline Gradient | MDELEKMIDDLVDNHYRRQYLIGTEADESEYLADISEEDDEDLD* |
| Ga0136549_100288635 | 3300010389 | Marine Methane Seep Sediment | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE* |
| Ga0114922_106277495 | 3300011118 | Deep Subsurface | MDDMTQMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDE* |
| Ga0160423_111908361 | 3300012920 | Surface Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDENL* |
| Ga0181377_10070516 | 3300017706 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDEXLDRRN |
| Ga0181377_10142944 | 3300017706 | Marine | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDDSI |
| Ga0181377_10299513 | 3300017706 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDMEDKE |
| Ga0181377_10425541 | 3300017706 | Marine | EETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDIKEADNE |
| Ga0181403_10037603 | 3300017710 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEN |
| Ga0181391_10037899 | 3300017713 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDDI |
| Ga0181412_11140161 | 3300017714 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEETYESI |
| Ga0181390_10708874 | 3300017719 | Seawater | MDEFRKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDERME |
| Ga0181390_11464322 | 3300017719 | Seawater | MEDLEKIIDDLIDNHYSKQHLIGTEEEESEYLQDMEVDDEXYI |
| Ga0181383_10552243 | 3300017720 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENN |
| Ga0181398_10517393 | 3300017725 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYRADIEEEDDENN |
| Ga0181381_10760402 | 3300017726 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEENDDNTNT |
| Ga0181401_10326874 | 3300017727 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDEXLDRRN |
| Ga0181417_10287394 | 3300017730 | Seawater | MEDLEKMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEEDDE |
| Ga0181426_10531852 | 3300017733 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDES |
| Ga0181433_10681424 | 3300017739 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDDV |
| Ga0181418_10609721 | 3300017740 | Seawater | MEDLEKMIDDLIDNHYSKQHLIGTEEEESEYLQDMEVDNDT |
| Ga0181399_10251812 | 3300017742 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDENN |
| Ga0181389_100573911 | 3300017746 | Seawater | MEDLEKIIDDLIDNHYSKQHLIGTEEEESEYLQDLKEVDDE |
| Ga0181393_11327493 | 3300017748 | Seawater | MEDLEKIIDDLIDNHYSKQHLIGTEEEESEYLQDMEVDDE |
| Ga0181411_10049764 | 3300017755 | Seawater | MDEFRKIVDDLIDNHYRRQHLIGTEEEESEYLQDLKEVDDE |
| Ga0181382_11434391 | 3300017756 | Seawater | EKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENN |
| Ga0181425_10471305 | 3300017771 | Seawater | MDELEKMIDNLVDNHYDSQHLIGTEADESEYLADIEEEDDENN |
| Ga0181430_10568682 | 3300017772 | Seawater | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEEDDDV |
| Ga0181395_11089743 | 3300017779 | Seawater | MEDLEKMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEEDDEXYI |
| Ga0181380_10586804 | 3300017782 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDECX |
| Ga0181380_11460011 | 3300017782 | Seawater | GVNMDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEETYESI |
| Ga0181580_103361474 | 3300017956 | Salt Marsh | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDEXI |
| Ga0180437_108688711 | 3300017963 | Hypersaline Lake Sediment | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDEDLD |
| Ga0181590_100222004 | 3300017967 | Salt Marsh | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENLD |
| Ga0181590_107529633 | 3300017967 | Salt Marsh | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDE |
| Ga0181553_101177987 | 3300018416 | Salt Marsh | MDELEKMIDDLIDKHDRRQHLIGTEADESEYLADISEDDDEN |
| Ga0181553_102316595 | 3300018416 | Salt Marsh | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEA |
| Ga0181563_100440722 | 3300018420 | Salt Marsh | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE |
| Ga0188859_10006982 | 3300019098 | Freshwater Lake | MDDMTQMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDDV |
| Ga0194029_10012577 | 3300019751 | Freshwater | MDELEKMIDDLVDNHYRRQHLIGTEADESEYLADISEEDDEDLD |
| Ga0206131_101116382 | 3300020185 | Seawater | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDEA |
| Ga0181604_102219632 | 3300020191 | Salt Marsh | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDERX |
| Ga0211576_102522262 | 3300020438 | Marine | MDEFRKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDES |
| Ga0211558_100230617 | 3300020439 | Marine | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENI |
| Ga0206677_100243643 | 3300021085 | Seawater | MEDLEKMIDDLIDNHYSKQHLIGTEEEESEYLQDMEVDSDT |
| Ga0213860_1000158118 | 3300021368 | Seawater | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEDDDEV |
| Ga0213863_103152301 | 3300021371 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDEV |
| Ga0213865_100287369 | 3300021373 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEC |
| Ga0213868_105769441 | 3300021389 | Seawater | DDLIDNHYRVQHLIGTEADESEYLADISEEDDEINL |
| Ga0213866_100158484 | 3300021425 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDDS |
| Ga0213866_100946553 | 3300021425 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDECX |
| Ga0222717_100568199 | 3300021957 | Estuarine Water | DEFSKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDDI |
| Ga0222717_101024334 | 3300021957 | Estuarine Water | MEDLEKMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEVDDE |
| Ga0222717_101197057 | 3300021957 | Estuarine Water | MDEFRKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDDI |
| Ga0222717_102124284 | 3300021957 | Estuarine Water | MDEFRKIVDDLIDNHYRRQHLIGTEVDESEYLSDIEEEDDERME |
| Ga0222718_1001998310 | 3300021958 | Estuarine Water | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDEXI |
| Ga0222718_100638914 | 3300021958 | Estuarine Water | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDDI |
| Ga0222718_100784618 | 3300021958 | Estuarine Water | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDDI |
| Ga0222718_102887213 | 3300021958 | Estuarine Water | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDENL |
| Ga0222716_102312054 | 3300021959 | Estuarine Water | MEDLEKMIDDLIDNHYRVQHLIGTEEEESEYLQNIKEVDDEXYI |
| Ga0224897_1020493 | 3300022046 | Seawater | MEDLEKIIDDLIDNHYSKQHLIGTEEEESEYLQDLKEVDDEXYI |
| Ga0196883_10042864 | 3300022050 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADI |
| Ga0196883_10407142 | 3300022050 | Aqueous | MDDIEKIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDEC |
| Ga0212029_10243703 | 3300022063 | Aqueous | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEDLD |
| Ga0212024_10177322 | 3300022065 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDE |
| Ga0196895_10243343 | 3300022067 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDDV |
| Ga0224906_11439373 | 3300022074 | Seawater | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDDI |
| Ga0196893_10279641 | 3300022159 | Aqueous | IEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDE |
| Ga0212022_10670493 | 3300022164 | Aqueous | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENN |
| Ga0196891_10120633 | 3300022183 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDENN |
| (restricted) Ga0255040_103788642 | 3300024059 | Seawater | MDELEKMIDNLVDNHYRRQHLIGTEADESEYLADIEEETYG |
| (restricted) Ga0255039_101043811 | 3300024062 | Seawater | MDEFRKIVDDLIDNHYRRQYLIGTEVDESEYLSDIEEEDDE |
| Ga0210003_13710793 | 3300024262 | Deep Subsurface | MDDMTQMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDDI |
| Ga0208667_10055502 | 3300025070 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQDLKEVDNEXYI |
| Ga0208667_10188873 | 3300025070 | Marine | MDEETKQLIDYLVDGYYRDAYLIGTEEEESEYLQDIKEADNE |
| Ga0208791_100280114 | 3300025083 | Marine | MDDMIQMIDDLIDNHYRVQHLIGTEEEESEYLQDLKEVDNE |
| Ga0208791_10292113 | 3300025083 | Marine | MDELEKMIDNLVDNHYRVQHLIGTEADESEYLADIEEENDDI |
| Ga0209348_11252814 | 3300025127 | Marine | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEVDDES |
| Ga0209645_10867993 | 3300025151 | Marine | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDET |
| Ga0209645_10911173 | 3300025151 | Marine | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEDDDEN |
| Ga0209645_11945191 | 3300025151 | Marine | MDELEKIIDDLIDNHYRRQHLIGTEADESEYLADISEEDDENNN |
| Ga0208148_11108301 | 3300025508 | Aqueous | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADI |
| Ga0208303_10305802 | 3300025543 | Aqueous | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDER |
| Ga0208160_10846702 | 3300025647 | Aqueous | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEVDDDS |
| Ga0208898_11292934 | 3300025671 | Aqueous | ELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDE |
| Ga0208162_11448262 | 3300025674 | Aqueous | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDEC |
| Ga0208162_11478773 | 3300025674 | Aqueous | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEXL |
| Ga0208162_11886332 | 3300025674 | Aqueous | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADIEEEDDEDLD |
| Ga0208917_12637191 | 3300025840 | Aqueous | VHMDELEKMIDDLVDNHYRVQHLIGTEADESEYLADISEEDDE |
| Ga0208645_11899711 | 3300025853 | Aqueous | EKIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDE |
| Ga0209533_11380584 | 3300025874 | Pelagic Marine | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDNDT |
| Ga0208644_10831554 | 3300025889 | Aqueous | MDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDEXFKQXYK |
| Ga0208644_11358305 | 3300025889 | Aqueous | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDEXFKQXYK |
| Ga0208644_13577261 | 3300025889 | Aqueous | MDDIEKIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDE |
| Ga0208644_13647621 | 3300025889 | Aqueous | NNLLRRYNMDEETKQLIDYLVDGYYRDAYLIGTEADESEYLADIEEEDDDV |
| Ga0209951_10515692 | 3300026138 | Pond Water | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDEC |
| Ga0209929_10667593 | 3300026187 | Pond Water | MDDFEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDDECX |
| Ga0209929_11358094 | 3300026187 | Pond Water | MDELEKMIDNLVDNHYRRQHLIGTEADESEYLADIEEETY |
| Ga0208921_10349461 | 3300027188 | Estuarine | MDELEKMIDNLVDNHYRRQHLIGTEADESEYLADIEEETYESI |
| Ga0209536_1008776782 | 3300027917 | Marine Sediment | MDELEKMIDDLVDNHYRVQHLIGTEADESEYLADISEEDDEXFKQXYK |
| Ga0183755_10216106 | 3300029448 | Marine | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEVDD |
| Ga0307380_101754225 | 3300031539 | Soil | MDDMTQMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDE |
| Ga0307380_112449312 | 3300031539 | Soil | MDELEKMIDDLIDNHYRRQHLIGTEADESEYLADISEEDNDI |
| Ga0307376_102444255 | 3300031578 | Soil | MDDMTQMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDE |
| Ga0307375_103309863 | 3300031669 | Soil | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADISEEDDE |
| Ga0307377_107979382 | 3300031673 | Soil | MDDMTQMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDNE |
| Ga0316208_10344932 | 3300032254 | Microbial Mat | MDDMTQMIDNLVDNHYRRQHLIGTEADESEYLADIEEEDDDV |
| Ga0316204_111491651 | 3300032373 | Microbial Mat | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDDI |
| Ga0348335_013764_3504_3629 | 3300034374 | Aqueous | MDEFEKMIDDLIDNHYRRQHLIGTEADESEYLADIEEEDDE |
| Ga0348336_020907_1_111 | 3300034375 | Aqueous | MDEIEKMIDDLIDNHYRRQHLIGTEADESEYLADISE |
| Ga0348336_063632_706_831 | 3300034375 | Aqueous | MDELEKMIDDLIDNHYRVQHLIGTEADESEYLADIEEEDDE |
| Ga0348337_127263_657_767 | 3300034418 | Aqueous | KIVNDLVDNHYRVQHLIGTEADESEYLADISEEDDE |
| ⦗Top⦘ |