


| Basic Information | |
|---|---|
| Family ID | F032796 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Number of Associated Samples | 134 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.41 % |
| % of genes near scaffold ends (potentially truncated) | 27.93 % |
| % of genes from short scaffolds (< 2000 bps) | 84.36 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.246 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.553 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.022 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 10.06 |
| PF00118 | Cpn60_TCP1 | 3.91 |
| PF08281 | Sigma70_r4_2 | 2.79 |
| PF07369 | DUF1488 | 2.23 |
| PF13085 | Fer2_3 | 1.68 |
| PF13183 | Fer4_8 | 1.68 |
| PF04542 | Sigma70_r2 | 1.12 |
| PF00313 | CSD | 1.12 |
| PF14499 | DUF4437 | 1.12 |
| PF13340 | DUF4096 | 1.12 |
| PF03401 | TctC | 0.56 |
| PF12200 | DUF3597 | 0.56 |
| PF13592 | HTH_33 | 0.56 |
| PF13439 | Glyco_transf_4 | 0.56 |
| PF05598 | DUF772 | 0.56 |
| PF13586 | DDE_Tnp_1_2 | 0.56 |
| PF00486 | Trans_reg_C | 0.56 |
| PF00011 | HSP20 | 0.56 |
| PF00588 | SpoU_methylase | 0.56 |
| PF07045 | DUF1330 | 0.56 |
| PF00589 | Phage_integrase | 0.56 |
| PF02517 | Rce1-like | 0.56 |
| PF03979 | Sigma70_r1_1 | 0.56 |
| PF12838 | Fer4_7 | 0.56 |
| PF07690 | MFS_1 | 0.56 |
| PF05115 | PetL | 0.56 |
| PF01527 | HTH_Tnp_1 | 0.56 |
| PF09954 | DUF2188 | 0.56 |
| PF13924 | Lipocalin_5 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 10.06 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 3.91 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.68 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.12 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.12 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.12 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.56 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.56 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.25 % |
| Unclassified | root | N/A | 35.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16656483 | All Organisms → cellular organisms → Bacteria | 5074 | Open in IMG/M |
| 2088090014|GPIPI_16801139 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 2088090014|GPIPI_17392019 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 2162886013|SwBSRL2_contig_12335401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 862 | Open in IMG/M |
| 3300000956|JGI10216J12902_112111295 | Not Available | 864 | Open in IMG/M |
| 3300001431|F14TB_100283818 | Not Available | 617 | Open in IMG/M |
| 3300005445|Ga0070708_100633729 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300005540|Ga0066697_10227145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1108 | Open in IMG/M |
| 3300005552|Ga0066701_10744291 | Not Available | 586 | Open in IMG/M |
| 3300005554|Ga0066661_10189675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300005561|Ga0066699_10532005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 842 | Open in IMG/M |
| 3300005574|Ga0066694_10073955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1571 | Open in IMG/M |
| 3300005575|Ga0066702_10164875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis | 1321 | Open in IMG/M |
| 3300005713|Ga0066905_101523268 | Not Available | 609 | Open in IMG/M |
| 3300006028|Ga0070717_10152629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1999 | Open in IMG/M |
| 3300006028|Ga0070717_10779476 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006028|Ga0070717_10789998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300006028|Ga0070717_11023074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 752 | Open in IMG/M |
| 3300006028|Ga0070717_11479843 | Not Available | 616 | Open in IMG/M |
| 3300006028|Ga0070717_11950437 | Not Available | 529 | Open in IMG/M |
| 3300006032|Ga0066696_10479006 | Not Available | 817 | Open in IMG/M |
| 3300006034|Ga0066656_10900329 | Not Available | 567 | Open in IMG/M |
| 3300006038|Ga0075365_10397402 | Not Available | 973 | Open in IMG/M |
| 3300006049|Ga0075417_10027461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2330 | Open in IMG/M |
| 3300006051|Ga0075364_10005184 | All Organisms → cellular organisms → Bacteria | 7561 | Open in IMG/M |
| 3300006058|Ga0075432_10018658 | Not Available | 2367 | Open in IMG/M |
| 3300006172|Ga0075018_10245271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 865 | Open in IMG/M |
| 3300006172|Ga0075018_10276755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300006173|Ga0070716_101482540 | Not Available | 554 | Open in IMG/M |
| 3300006175|Ga0070712_100158195 | Not Available | 1747 | Open in IMG/M |
| 3300006176|Ga0070765_101402782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300006196|Ga0075422_10039115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1683 | Open in IMG/M |
| 3300006791|Ga0066653_10553027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
| 3300006794|Ga0066658_10218091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1014 | Open in IMG/M |
| 3300006844|Ga0075428_100198447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2170 | Open in IMG/M |
| 3300006844|Ga0075428_100255855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1886 | Open in IMG/M |
| 3300006844|Ga0075428_102175755 | Not Available | 572 | Open in IMG/M |
| 3300006845|Ga0075421_101092873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
| 3300006852|Ga0075433_10698138 | Not Available | 889 | Open in IMG/M |
| 3300006854|Ga0075425_101488786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300006969|Ga0075419_10515048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 832 | Open in IMG/M |
| 3300007258|Ga0099793_10451747 | Not Available | 635 | Open in IMG/M |
| 3300007265|Ga0099794_10279124 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300009012|Ga0066710_100747715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1495 | Open in IMG/M |
| 3300009012|Ga0066710_101074961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1244 | Open in IMG/M |
| 3300009038|Ga0099829_10027137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4030 | Open in IMG/M |
| 3300009090|Ga0099827_11170674 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009147|Ga0114129_10545147 | Not Available | 1509 | Open in IMG/M |
| 3300009147|Ga0114129_12053989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
| 3300009147|Ga0114129_13235601 | Not Available | 529 | Open in IMG/M |
| 3300009156|Ga0111538_12081995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300009162|Ga0075423_11792554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300009168|Ga0105104_10759978 | Not Available | 561 | Open in IMG/M |
| 3300009840|Ga0126313_11158514 | Not Available | 636 | Open in IMG/M |
| 3300010038|Ga0126315_10429029 | Not Available | 834 | Open in IMG/M |
| 3300010038|Ga0126315_11205876 | Not Available | 514 | Open in IMG/M |
| 3300010042|Ga0126314_10143113 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1660 | Open in IMG/M |
| 3300010159|Ga0099796_10115923 | Not Available | 1024 | Open in IMG/M |
| 3300010303|Ga0134082_10301350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 672 | Open in IMG/M |
| 3300010321|Ga0134067_10082852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1077 | Open in IMG/M |
| 3300010362|Ga0126377_10219308 | Not Available | 1834 | Open in IMG/M |
| 3300010373|Ga0134128_10836375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1020 | Open in IMG/M |
| 3300011120|Ga0150983_13510750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 831 | Open in IMG/M |
| 3300011423|Ga0137436_1070506 | Not Available | 906 | Open in IMG/M |
| 3300011444|Ga0137463_1152841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 868 | Open in IMG/M |
| 3300012015|Ga0120187_1031011 | Not Available | 619 | Open in IMG/M |
| 3300012096|Ga0137389_10214730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1607 | Open in IMG/M |
| 3300012096|Ga0137389_10263818 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| 3300012198|Ga0137364_10054904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2667 | Open in IMG/M |
| 3300012198|Ga0137364_10826844 | Not Available | 700 | Open in IMG/M |
| 3300012198|Ga0137364_10875514 | Not Available | 679 | Open in IMG/M |
| 3300012199|Ga0137383_10924489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 637 | Open in IMG/M |
| 3300012199|Ga0137383_11257937 | Not Available | 529 | Open in IMG/M |
| 3300012201|Ga0137365_10075179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2549 | Open in IMG/M |
| 3300012201|Ga0137365_10166893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1650 | Open in IMG/M |
| 3300012202|Ga0137363_11257094 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012202|Ga0137363_11307112 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012203|Ga0137399_11022494 | Not Available | 696 | Open in IMG/M |
| 3300012204|Ga0137374_10031517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5790 | Open in IMG/M |
| 3300012204|Ga0137374_10081643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3128 | Open in IMG/M |
| 3300012204|Ga0137374_10345135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. sBnM-33 | 1203 | Open in IMG/M |
| 3300012206|Ga0137380_10344240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1330 | Open in IMG/M |
| 3300012208|Ga0137376_10168345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1890 | Open in IMG/M |
| 3300012208|Ga0137376_10670573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300012210|Ga0137378_10936753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300012210|Ga0137378_11564031 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012350|Ga0137372_10546133 | Not Available | 856 | Open in IMG/M |
| 3300012350|Ga0137372_11002953 | Not Available | 582 | Open in IMG/M |
| 3300012356|Ga0137371_10612280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300012356|Ga0137371_11307232 | Not Available | 536 | Open in IMG/M |
| 3300012357|Ga0137384_10370045 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300012359|Ga0137385_11010916 | Not Available | 686 | Open in IMG/M |
| 3300012372|Ga0134037_1204633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300012392|Ga0134043_1256958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300012582|Ga0137358_10074877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2276 | Open in IMG/M |
| 3300012892|Ga0157294_10061307 | Not Available | 881 | Open in IMG/M |
| 3300012927|Ga0137416_12263551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300012958|Ga0164299_10026676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2453 | Open in IMG/M |
| 3300012977|Ga0134087_10103558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1195 | Open in IMG/M |
| 3300013500|Ga0120195_1001596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1036 | Open in IMG/M |
| 3300013760|Ga0120188_1052070 | Not Available | 530 | Open in IMG/M |
| 3300014318|Ga0075351_1029154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 919 | Open in IMG/M |
| 3300014325|Ga0163163_12737163 | Not Available | 550 | Open in IMG/M |
| 3300014326|Ga0157380_11704034 | Not Available | 688 | Open in IMG/M |
| 3300015371|Ga0132258_10981737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 2134 | Open in IMG/M |
| 3300015371|Ga0132258_11183978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1932 | Open in IMG/M |
| 3300015372|Ga0132256_101469517 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300015372|Ga0132256_102054078 | Not Available | 677 | Open in IMG/M |
| 3300015372|Ga0132256_102331078 | Not Available | 638 | Open in IMG/M |
| 3300015374|Ga0132255_103965569 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300016319|Ga0182033_10405365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1153 | Open in IMG/M |
| 3300017965|Ga0190266_10714624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 628 | Open in IMG/M |
| 3300018028|Ga0184608_10421008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis hirsuta | 578 | Open in IMG/M |
| 3300018053|Ga0184626_10186132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 882 | Open in IMG/M |
| 3300018075|Ga0184632_10088023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1358 | Open in IMG/M |
| 3300018431|Ga0066655_10587075 | Not Available | 749 | Open in IMG/M |
| 3300018433|Ga0066667_10508940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 993 | Open in IMG/M |
| 3300018433|Ga0066667_11226808 | Not Available | 653 | Open in IMG/M |
| 3300018468|Ga0066662_10071198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2329 | Open in IMG/M |
| 3300018468|Ga0066662_10430203 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
| 3300018468|Ga0066662_10518503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1091 | Open in IMG/M |
| 3300018468|Ga0066662_10758834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter superfactus | 935 | Open in IMG/M |
| 3300018468|Ga0066662_11755265 | Not Available | 649 | Open in IMG/M |
| 3300018482|Ga0066669_10759622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 856 | Open in IMG/M |
| 3300018482|Ga0066669_11126928 | Not Available | 708 | Open in IMG/M |
| 3300018482|Ga0066669_11263251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300020170|Ga0179594_10058175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1321 | Open in IMG/M |
| 3300020581|Ga0210399_10504407 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300023662|Ga0247545_100531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1103 | Open in IMG/M |
| 3300025910|Ga0207684_10134625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2121 | Open in IMG/M |
| 3300025910|Ga0207684_10877409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 755 | Open in IMG/M |
| 3300025915|Ga0207693_10133356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1952 | Open in IMG/M |
| 3300026089|Ga0207648_10127643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2237 | Open in IMG/M |
| 3300026304|Ga0209240_1002076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7690 | Open in IMG/M |
| 3300026320|Ga0209131_1069104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1935 | Open in IMG/M |
| 3300026328|Ga0209802_1314875 | Not Available | 517 | Open in IMG/M |
| 3300026514|Ga0257168_1076803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 739 | Open in IMG/M |
| 3300026515|Ga0257158_1087890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300026529|Ga0209806_1263099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300026532|Ga0209160_1107922 | Not Available | 1395 | Open in IMG/M |
| 3300026536|Ga0209058_1079626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1724 | Open in IMG/M |
| 3300027748|Ga0209689_1104348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1455 | Open in IMG/M |
| 3300027880|Ga0209481_10064426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1721 | Open in IMG/M |
| 3300027880|Ga0209481_10284068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 837 | Open in IMG/M |
| 3300027909|Ga0209382_10111835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3191 | Open in IMG/M |
| 3300027909|Ga0209382_10224809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2141 | Open in IMG/M |
| 3300027909|Ga0209382_11118779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 812 | Open in IMG/M |
| 3300028536|Ga0137415_10999149 | Not Available | 648 | Open in IMG/M |
| 3300028889|Ga0247827_10781052 | Not Available | 631 | Open in IMG/M |
| 3300030563|Ga0247653_1010728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300030571|Ga0247652_1000027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2433 | Open in IMG/M |
| 3300030574|Ga0247648_1105176 | Not Available | 639 | Open in IMG/M |
| 3300030592|Ga0247612_1069658 | Not Available | 749 | Open in IMG/M |
| 3300030604|Ga0247637_1037497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 826 | Open in IMG/M |
| 3300030987|Ga0308155_1029200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300030990|Ga0308178_1105472 | Not Available | 603 | Open in IMG/M |
| 3300031099|Ga0308181_1098792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 628 | Open in IMG/M |
| 3300031099|Ga0308181_1156554 | Not Available | 537 | Open in IMG/M |
| 3300031231|Ga0170824_104949680 | Not Available | 607 | Open in IMG/M |
| 3300031274|Ga0307442_1006016 | All Organisms → cellular organisms → Bacteria | 5356 | Open in IMG/M |
| 3300031446|Ga0170820_17585797 | Not Available | 592 | Open in IMG/M |
| 3300031564|Ga0318573_10513071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300031573|Ga0310915_10016967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4355 | Open in IMG/M |
| 3300031573|Ga0310915_10235367 | Not Available | 1287 | Open in IMG/M |
| 3300031720|Ga0307469_11825411 | Not Available | 588 | Open in IMG/M |
| 3300031724|Ga0318500_10460752 | Not Available | 637 | Open in IMG/M |
| 3300031740|Ga0307468_100632106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300031890|Ga0306925_11324364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Ferrovibrio → unclassified Ferrovibrio → Ferrovibrio sp. | 714 | Open in IMG/M |
| 3300031944|Ga0310884_10060985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1729 | Open in IMG/M |
| 3300031954|Ga0306926_11928471 | Not Available | 666 | Open in IMG/M |
| 3300032035|Ga0310911_10702082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
| 3300032059|Ga0318533_10460863 | Not Available | 930 | Open in IMG/M |
| 3300032180|Ga0307471_100903393 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 13.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.79% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.23% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.23% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.12% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.68% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.56% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.56% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012015 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013500 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T4.rep2 | Environmental | Open in IMG/M |
| 3300013760 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300023662 | Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030563 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030571 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb5 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030592 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Ab1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030604 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb2 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031274 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02022120 | 2088090014 | Soil | MTARYVLADVSTKAAYFSLVAAAFIFVSMLLLTGLHP |
| GPIPI_03463120 | 2088090014 | Soil | MTNGYIVADVAIKTAYFSLVAXAAFIFVSMLLLAGVHP |
| GPIPI_02128450 | 2088090014 | Soil | MTQGIVADVAIKTAYFSLVAAALILVSMLLLAGVHP |
| SwBSRL2_0910.00003950 | 2162886013 | Switchgrass Rhizosphere | MATGYVVSDVATKAVYFCFAAVAFAFVAMLLLTTLHP |
| JGI10216J12902_1121112951 | 3300000956 | Soil | MTKGYIVADVAIKTAYFSFVAVALIFVSMLLLAGVHP* |
| F14TB_1002838182 | 3300001431 | Soil | MTKGYIAADVAIKTAYFSFVVAAFIFVSMLLLAGVHP* |
| Ga0070708_1006337292 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVTPKAVQP |
| Ga0066697_102271452 | 3300005540 | Soil | MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0066701_107442911 | 3300005552 | Soil | MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0066661_101896754 | 3300005554 | Soil | MTSGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0066699_105320053 | 3300005561 | Soil | MTKGYISTDVAIKTAYFSFVAAAFIFVSMLLLAGVHP* |
| Ga0066694_100739551 | 3300005574 | Soil | GYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0066702_101648751 | 3300005575 | Soil | MTTGYALADVATKVVYFSLTAAAFIFVSMLLLTGLHP* |
| Ga0066905_1015232682 | 3300005713 | Tropical Forest Soil | MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP* |
| Ga0081455_100165545 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MAFREEIMTKNPVLADVITKIAYFSLIIAALVFVSMLLLTRLHP* |
| Ga0070717_101526292 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP* |
| Ga0070717_107794761 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYISADVAIKTAYFSFVAAAFIFVSMLLLAGVHP* |
| Ga0070717_107899983 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYIVTDVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0070717_110230742 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0070717_114798432 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKNLVLADVVTKTFYFSLIAAAFVFVSMLLLTGLHS* |
| Ga0070717_119504371 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYIVTDVAIKTAYFSLAAAAFIFVSMLLLAGVHP* |
| Ga0066696_104790061 | 3300006032 | Soil | MTSGDIVADVAIKTACFSLVAAAFIFVSMLLLAGVHP* |
| Ga0066656_109003292 | 3300006034 | Soil | MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0075365_103974023 | 3300006038 | Populus Endosphere | MTTGYVLSDVATKVFYFSLTAAAVIFVSMLLLTGLHP* |
| Ga0075417_100274613 | 3300006049 | Populus Rhizosphere | MATGHALSAVLTKAAYFCLAAAAFVFVAMLLLTRLHP* |
| Ga0075417_105177081 | 3300006049 | Populus Rhizosphere | MASQGEIMTKNPVFADVVTKIAYFSLIIAALVFVSMLLLIASILK |
| Ga0075364_100051843 | 3300006051 | Populus Endosphere | MTTGYIFSDVATKVFYFSLTAVALLFVSMLLLTGLHP* |
| Ga0075432_100186581 | 3300006058 | Populus Rhizosphere | CRRLVMTARYVLADVATKAACFSLVAAAFIFVSMLLLTGLHP* |
| Ga0075018_102452713 | 3300006172 | Watersheds | MTKDYIVADVAIKTAYFSLAAAAFIFVSMLLLAGIHP* |
| Ga0075018_102767552 | 3300006172 | Watersheds | MTKGYIVADVAIKTAYFFFAAAAFIFVSMLLLAGVHP* |
| Ga0070716_1014825402 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQGIVADVAIKTAYFSLVAAALIFVSMLLLAGVHP* |
| Ga0070712_1001581952 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTARYVLADVSTKAAYFSLVAAAFIFVSMLLLTGLHP* |
| Ga0070765_1014027822 | 3300006176 | Soil | MTKGYIVTDVAIKTAYFSLAAAVFIFVSMLLLAGVHP* |
| Ga0075422_100391152 | 3300006196 | Populus Rhizosphere | MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHL* |
| Ga0066653_105530272 | 3300006791 | Soil | MTTGNMLADVATKAVYFSFAAAALVFVSMLLLLTGLHP* |
| Ga0066658_102180912 | 3300006794 | Soil | MQITKLITRRLLETVMTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0075428_1001624112 | 3300006844 | Populus Rhizosphere | MTRNPVFADVITKMAYFSLIVAALVFVSMLLLTRLHP* |
| Ga0075428_1001984473 | 3300006844 | Populus Rhizosphere | VLKNYLAADAITKTAYLSLVAAAFIFVFMLLLTGAHP* |
| Ga0075428_1002558552 | 3300006844 | Populus Rhizosphere | MTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP* |
| Ga0075428_1021757552 | 3300006844 | Populus Rhizosphere | QELNHYFDYRRLVMTTGYIFSDVATKVFYFSLTAAAVIFVSMLLLTGLHP* |
| Ga0075421_1010928731 | 3300006845 | Populus Rhizosphere | IMATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHP* |
| Ga0075431_1003820023 | 3300006847 | Populus Rhizosphere | MAFQGETMTKNPVFADVVTKIAYFSLIIAALVFVSMLLLTRLHP* |
| Ga0075433_106981383 | 3300006852 | Populus Rhizosphere | VVKNYLVADAIAKTAYLSLVAAAFIFVLMVLLTGAHP |
| Ga0075425_1014887862 | 3300006854 | Populus Rhizosphere | MTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP* |
| Ga0075429_1000845461 | 3300006880 | Populus Rhizosphere | MAFQEEIMTRNPVFADVITKMAYFSLIVAALVFVSMLLLTRLHP* |
| Ga0075419_105150481 | 3300006969 | Populus Rhizosphere | NHYFDYRRLVMTTGYIFSDVATKVFYFSLTAVALLFVSMLLLTGLHP* |
| Ga0099793_104517471 | 3300007258 | Vadose Zone Soil | MTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP* |
| Ga0099794_102791241 | 3300007265 | Vadose Zone Soil | MATGYVLSDVVTKMAYFSLAAAAFVFVAMILVTGLHP* |
| Ga0066710_1007477152 | 3300009012 | Grasslands Soil | MTSGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP |
| Ga0066710_1010749612 | 3300009012 | Grasslands Soil | MTSGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0099829_100271373 | 3300009038 | Vadose Zone Soil | MTNGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP* |
| Ga0099827_111706741 | 3300009090 | Vadose Zone Soil | MAAGYVLSDVVTKMAYFSLVAAAFVFVAMILLTGVHP* |
| Ga0114129_105451471 | 3300009147 | Populus Rhizosphere | MTARYVLADVATKAACFSLVAAAFIFISMLLLTGLHP* |
| Ga0114129_120539892 | 3300009147 | Populus Rhizosphere | MSSGYIVADVAIKTAYFSLVAAAVIFVSMLLLAGVHP* |
| Ga0114129_132356012 | 3300009147 | Populus Rhizosphere | MTTGYIVSDVATKVFYFSLTAAAVIFVSMLLLTGLHP* |
| Ga0111538_120819951 | 3300009156 | Populus Rhizosphere | MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLH |
| Ga0075423_117925542 | 3300009162 | Populus Rhizosphere | MTNGYADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0105104_107599782 | 3300009168 | Freshwater Sediment | MTTGYALADVATKVAYFSLTAAAFIFFSMLLLTGLHP* |
| Ga0126313_111585141 | 3300009840 | Serpentine Soil | MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTALHP* |
| Ga0126315_104290292 | 3300010038 | Serpentine Soil | VSNYVLADVATKTAYFSLIAAALIFVSLLVLTTLHP* |
| Ga0126315_112058761 | 3300010038 | Serpentine Soil | MIVSNHVLSDVTTKTYFALMAAAFIFVLLLTLTTLHP* |
| Ga0126314_101431133 | 3300010042 | Serpentine Soil | MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTTLHP* |
| Ga0099796_101159232 | 3300010159 | Vadose Zone Soil | CRRLVMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP* |
| Ga0134082_103013501 | 3300010303 | Grasslands Soil | MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLASVHP* |
| Ga0134067_100828522 | 3300010321 | Grasslands Soil | MTQGVIADVAIKTAYFSLVAAAFIFVLMLLLAGVHP* |
| Ga0126377_102193081 | 3300010362 | Tropical Forest Soil | MTARYVLADVATKAAYFSLVAATFIFVSMLLLTGLHP* |
| Ga0134128_108363751 | 3300010373 | Terrestrial Soil | MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVQP* |
| Ga0150983_135107501 | 3300011120 | Forest Soil | RDDCRRLVMTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP* |
| Ga0137436_10705062 | 3300011423 | Soil | MTRGYVLTDVAIKAAYFSLAAAAVIFVSMLLLTGLHP* |
| Ga0137463_11528412 | 3300011444 | Soil | MWGLAKTVCRRLVMTRGYVLTDVAIKAAYFSLAAAAVIFVSMLLLTGLHP* |
| Ga0120187_10310112 | 3300012015 | Terrestrial | MATGYVSDVVTKAAYFCLAATAAAFVFVAMLLLTGL |
| Ga0137389_102147304 | 3300012096 | Vadose Zone Soil | MTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP* |
| Ga0137389_102638182 | 3300012096 | Vadose Zone Soil | MATGYVLSDVVTKMAYFSLAAAAFVFVAMISLTGLHP* |
| Ga0137364_100549042 | 3300012198 | Vadose Zone Soil | MTQGVVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0137364_108268443 | 3300012198 | Vadose Zone Soil | SRDDCKRLAMTSSYIVADVAIKTAYFSLVAAAFLFFLIVLVVGFHP* |
| Ga0137364_108755142 | 3300012198 | Vadose Zone Soil | MTSSYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0137383_109244892 | 3300012199 | Vadose Zone Soil | MTTGNVLADVATNAVYFSLVAAAFVFVSMLLLTGLHP* |
| Ga0137383_112579372 | 3300012199 | Vadose Zone Soil | MTKGYVVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP* |
| Ga0137365_100751796 | 3300012201 | Vadose Zone Soil | MTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP |
| Ga0137365_101668936 | 3300012201 | Vadose Zone Soil | VMTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP* |
| Ga0137363_112570941 | 3300012202 | Vadose Zone Soil | MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGV |
| Ga0137363_113071121 | 3300012202 | Vadose Zone Soil | MTTGYVFTEVASKVAYFSFAAMAFIFVSMLLLTSLHP* |
| Ga0137399_110224941 | 3300012203 | Vadose Zone Soil | MTTSYVLADVAAKAAYFSLAAAVLIFVSMLLLTALHP* |
| Ga0137374_1003151710 | 3300012204 | Vadose Zone Soil | MSAISVHSDLVTKTVYFSLTAAAFVFVAMLLLTGLHP* |
| Ga0137374_100816435 | 3300012204 | Vadose Zone Soil | MTTSYVLADLATKVAYFSFTAVAFIFVWMLLTGMHP* |
| Ga0137374_103451352 | 3300012204 | Vadose Zone Soil | MTKGYIVADVAIKTTYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0137380_103442404 | 3300012206 | Vadose Zone Soil | MTSGNVLADVATKALYFSLVAAAFVFVSMLLLTGLHP* |
| Ga0137376_101683453 | 3300012208 | Vadose Zone Soil | MICRRLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHS* |
| Ga0137376_106705733 | 3300012208 | Vadose Zone Soil | LVMTTGYALADVATKVVYFSLTAAAFIFVSMLLLTGLHP* |
| Ga0137378_109367531 | 3300012210 | Vadose Zone Soil | MTQGVVADVAIKTAYFSLVAAAFIFVLMLLLAGVHP* |
| Ga0137378_115640312 | 3300012210 | Vadose Zone Soil | DDCRRLVMTKGYVVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP* |
| Ga0137372_105461332 | 3300012350 | Vadose Zone Soil | MTKGYIVADVAIKTAYFSFVAIAFIFVSMLLLAGVHP* |
| Ga0137372_110029531 | 3300012350 | Vadose Zone Soil | MTSGYIVADVAIKTTYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0137371_106122802 | 3300012356 | Vadose Zone Soil | MTKGYIVADVAIKTAYFSLVAAAFVFVSMLLLIGLHP* |
| Ga0137371_113072322 | 3300012356 | Vadose Zone Soil | MTNGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP* |
| Ga0137384_103700451 | 3300012357 | Vadose Zone Soil | MTNGYIVADVAIRTAYFSLVTAALIFVSMLLLAGVHP* |
| Ga0137385_110109161 | 3300012359 | Vadose Zone Soil | TLARRLTMTTGNVLADVATKAAYFFLVAAAFVFVSMLLLTGLHP* |
| Ga0134037_12046333 | 3300012372 | Grasslands Soil | LLETVMTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0134043_12569582 | 3300012392 | Grasslands Soil | DDCRRLVMTSGYIVADVAIKTAYFSLAAAAFIFVSMLLLAGVHP* |
| Ga0137358_100748771 | 3300012582 | Vadose Zone Soil | RLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP* |
| Ga0157294_100613071 | 3300012892 | Soil | VVKNYLAADATAKTVYLSLVAAAFIFVLMLLLTGAHP* |
| Ga0137416_122635511 | 3300012927 | Vadose Zone Soil | RLVMTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP* |
| Ga0164299_100266764 | 3300012958 | Soil | MTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHA* |
| Ga0134087_101035582 | 3300012977 | Grasslands Soil | MIKNFVLSDFGTKTAYFSLVAAAVVFVSMLLLTGLHP* |
| Ga0120195_10015961 | 3300013500 | Terrestrial | MTTGYALADVATKVAYFSLAAAAFIFVSMLLLAGVHP* |
| Ga0120188_10520702 | 3300013760 | Terrestrial | MATGYAVSDVATKTAYFSLVAAAFVFVAMLLLTRLHP* |
| Ga0075351_10291542 | 3300014318 | Natural And Restored Wetlands | MTRGHVLADLATKVAYFSLTAAAFIFVSMLLLTGVHP* |
| Ga0163163_127371631 | 3300014325 | Switchgrass Rhizosphere | MTTSYVLADLATKIVYFSLTAVAFLFVWMLLTGIHP* |
| Ga0157380_117040342 | 3300014326 | Switchgrass Rhizosphere | VVKNYLAADATTKTVYLSLVAAAFIFVLMLLLTGAHP* |
| Ga0132258_109817372 | 3300015371 | Arabidopsis Rhizosphere | MATGYAVSDVATKAAYFGLAAAAFVFVTMLLLTTLHP* |
| Ga0132258_111839781 | 3300015371 | Arabidopsis Rhizosphere | KGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP* |
| Ga0132256_1001411613 | 3300015372 | Arabidopsis Rhizosphere | MASQGEIMTKDPVFADVVTKIAYFSLIIAALVFVSMLLLTHLHP* |
| Ga0132256_1014695172 | 3300015372 | Arabidopsis Rhizosphere | MVMTTGYALADVATKVAYFSLAAAAFIFVSMLLLTGLHP* |
| Ga0132256_1020540781 | 3300015372 | Arabidopsis Rhizosphere | MLGGRLVMATGYAVSDVATKAAYFGLAAAAFVFVTMLLLTTLHP* |
| Ga0132256_1023310782 | 3300015372 | Arabidopsis Rhizosphere | MTTILADLATKVVYFSLTAVAFLFVWMLLTGIHP* |
| Ga0132255_1039655691 | 3300015374 | Arabidopsis Rhizosphere | RRLIVLKNYLAADAITKTAYLSLVAAAFIFVFMLLLTGAHP* |
| Ga0182033_104053653 | 3300016319 | Soil | DDCRRPVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0190266_107146242 | 3300017965 | Soil | MTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP |
| Ga0184608_104210082 | 3300018028 | Groundwater Sediment | MTTGYVLADVATKVAYFSLTAVAFLFVWMLLTGIHP |
| Ga0184626_101861321 | 3300018053 | Groundwater Sediment | MTTGYVLADLATKVAYFSLTAVAFVFVWMLLTGIHP |
| Ga0184632_100880233 | 3300018075 | Groundwater Sediment | MTTGYILADLATKVAYFSLTAVAFLFVWMLLTGIHP |
| Ga0066655_105870751 | 3300018431 | Grasslands Soil | MTKGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0066667_105089402 | 3300018433 | Grasslands Soil | MTQGVVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0066667_112268082 | 3300018433 | Grasslands Soil | MTSGDIVADVAIKTACFSLVAAAFIFVSMLLLAGVHP |
| Ga0066662_100711985 | 3300018468 | Grasslands Soil | LVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0066662_104302032 | 3300018468 | Grasslands Soil | MTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0066662_105185032 | 3300018468 | Grasslands Soil | MTSGNVLADVATKALYFSLVVAAFVFVSMLLLTGLHP |
| Ga0066662_107588341 | 3300018468 | Grasslands Soil | MLARRLTMTTGNVLADVATKAAYFFLVAAAFVFVSMLLLTGLHP |
| Ga0066662_117552651 | 3300018468 | Grasslands Soil | MTKGYIAADVAIKTAYFSFVAAAFIFVSMLLLAGVHP |
| Ga0066669_107596222 | 3300018482 | Grasslands Soil | MTQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0066669_111269281 | 3300018482 | Grasslands Soil | MATGYAVSDVATKAAYFGLAAAAFVFVAMLLLTALHP |
| Ga0066669_112632511 | 3300018482 | Grasslands Soil | MTKGYIVADVAIKTAYLSLVTAALIFVSMLLLAGVHP |
| Ga0179594_100581753 | 3300020170 | Vadose Zone Soil | MTKGYIVADVAIKTAYFFFAAAAFIFVSMLLLAGVHP |
| Ga0210399_105044071 | 3300020581 | Soil | MTKGYIVTDVAIKTAYFSLAAAVFIFVSMLLLAGVHP |
| Ga0247545_1005311 | 3300023662 | Soil | MMKDYVLSDTVPKAAYFSLVVAAFVFVAMLLLTGMHL |
| Ga0207684_101346253 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYIVTDVAIKTAYFSLAAAAFIFVSMLLLAGVHP |
| Ga0207684_108774092 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKGYIVTDVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0207693_101333562 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKNLVLADVVTKTFYFSLIAAAFVFVSMLLLTGLHS |
| Ga0207648_101276433 | 3300026089 | Miscanthus Rhizosphere | VVKNYLAADATAKTVYLSLVAAAFIFVLMLLLTGAHP |
| Ga0209240_10020767 | 3300026304 | Grasslands Soil | MTNGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0209131_10691042 | 3300026320 | Grasslands Soil | MTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP |
| Ga0209802_13148751 | 3300026328 | Soil | RRLVMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP |
| Ga0257168_10768031 | 3300026514 | Soil | NGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0257158_10878901 | 3300026515 | Soil | RLVMTKGYIVADVAIKTAYFLFAAAAFIFVSMLLLAGVHP |
| Ga0209806_12630991 | 3300026529 | Soil | DDCRRLVMTNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0209160_11079221 | 3300026532 | Soil | TNGYIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0209058_10796264 | 3300026536 | Soil | TQGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0209689_11043483 | 3300027748 | Soil | MTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP |
| Ga0209481_100644263 | 3300027880 | Populus Rhizosphere | MATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHL |
| Ga0209481_102840683 | 3300027880 | Populus Rhizosphere | MATGHALSAVLTKAAYFCLAAAAFVFVAMLLLTRLHP |
| Ga0209382_101118354 | 3300027909 | Populus Rhizosphere | VRRLVMTTGYVLADLATKVAYFSLTAVAFLFVWMLLTGIHP |
| Ga0209382_102248092 | 3300027909 | Populus Rhizosphere | MTTGYALADVATKVAYFSLTAAAFIFVSMLLLTGLHP |
| Ga0209382_111187791 | 3300027909 | Populus Rhizosphere | ATGYVLSDVITKAAYVCLAAAAFVFVAMLLMTGLHP |
| Ga0137415_109991491 | 3300028536 | Vadose Zone Soil | MTTSYVLADVAAKAAYFSLAAAVFIFVSMLLLTALHP |
| Ga0247827_107810522 | 3300028889 | Soil | VLKNFLVADAITKTAYLSLVAAAFIFVFMLLLTGAH |
| Ga0247653_10107281 | 3300030563 | Soil | VDALREVIMATDYVLSEVITKKDYVCIAAAALVFVAML |
| Ga0247652_10000273 | 3300030571 | Soil | MATGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL |
| Ga0247648_11051762 | 3300030574 | Soil | MTTGYVLADLATKVAYFSLTTVAFLFVWMLLTGIHP |
| Ga0247612_10696581 | 3300030592 | Soil | MAAGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL |
| Ga0247637_10374971 | 3300030604 | Soil | VDALREVIMATGYVLSDVITKAAYVCLAAAAFVFVAMLLLTGLHL |
| Ga0308155_10292002 | 3300030987 | Soil | ETVMTQGIVADVAIKTAYFSLLAAAFIFVSMLLLAGVHP |
| Ga0308178_11054721 | 3300030990 | Soil | GRLAMTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0308181_10987922 | 3300031099 | Soil | FIMATGRDLTGVATKAAYFCLAAATIVFAAMLLLTGLHP |
| Ga0308181_11565542 | 3300031099 | Soil | DDCGRLAMTSGDIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0170824_1049496801 | 3300031231 | Forest Soil | MTKGIVADVAIKTAYFSLVAAALIFVSMLLLAGVHP |
| Ga0307442_10060161 | 3300031274 | Salt Marsh | MTPGHVLADLATKVAYFSLAAAAFIFVSMLLLTGVHP |
| Ga0170820_175857972 | 3300031446 | Forest Soil | MTKGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0318573_105130713 | 3300031564 | Soil | MTARYVLADVATKAAYFSLVAATFIFVSMLLLTGLHP |
| Ga0310915_100169674 | 3300031573 | Soil | MTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0310915_102353671 | 3300031573 | Soil | MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLH |
| Ga0307469_118254112 | 3300031720 | Hardwood Forest Soil | MTTGYALADVATKVAYFSLAAAAFIFVSMLLLTGLHP |
| Ga0318500_104607521 | 3300031724 | Soil | MTARYVLADVATKAAYFSLVAAAFIFVLMLLLTGLHP |
| Ga0307468_1006321063 | 3300031740 | Hardwood Forest Soil | MTSGGIVADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| Ga0306925_113243642 | 3300031890 | Soil | MTARYVLADVATKATYFSLVAAAFIFVSMLLLTGLHPS |
| Ga0310884_100609852 | 3300031944 | Soil | VVKNYLAADAITKTAYLSLVAAAFIFVLMLLLTGAHP |
| Ga0306926_119284711 | 3300031954 | Soil | MTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGL |
| Ga0310911_107020821 | 3300032035 | Soil | PVMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP |
| Ga0318533_104608631 | 3300032059 | Soil | VMTARYVLADVATKAAYFSLVAAAFIFVSMLLLTGLHP |
| Ga0307471_1009033933 | 3300032180 | Hardwood Forest Soil | MTNGYADVAIKTAYFSLVAAAFIFVSMLLLAGVHP |
| ⦗Top⦘ |