


| Basic Information | |
|---|---|
| Family ID | F032781 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAG |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.21 % |
| % of genes near scaffold ends (potentially truncated) | 92.18 % |
| % of genes from short scaffolds (< 2000 bps) | 85.47 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.156 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.905 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.050 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.955 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.29% Coil/Unstructured: 79.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF00378 | ECH_1 | 45.25 |
| PF13561 | adh_short_C2 | 6.70 |
| PF00230 | MIP | 4.47 |
| PF13376 | OmdA | 1.68 |
| PF00578 | AhpC-TSA | 1.68 |
| PF10517 | DM13 | 1.68 |
| PF01668 | SmpB | 1.12 |
| PF13602 | ADH_zinc_N_2 | 1.12 |
| PF00106 | adh_short | 0.56 |
| PF08843 | AbiEii | 0.56 |
| PF13730 | HTH_36 | 0.56 |
| PF00175 | NAD_binding_1 | 0.56 |
| PF11412 | DsbC | 0.56 |
| PF16576 | HlyD_D23 | 0.56 |
| PF00970 | FAD_binding_6 | 0.56 |
| PF06912 | DUF1275 | 0.56 |
| PF07080 | DUF1348 | 0.56 |
| PF00872 | Transposase_mut | 0.56 |
| PF03992 | ABM | 0.56 |
| PF04224 | DUF417 | 0.56 |
| PF01850 | PIN | 0.56 |
| PF03328 | HpcH_HpaI | 0.56 |
| PF10130 | PIN_2 | 0.56 |
| PF00512 | HisKA | 0.56 |
| PF00753 | Lactamase_B | 0.56 |
| PF07730 | HisKA_3 | 0.56 |
| PF12697 | Abhydrolase_6 | 0.56 |
| PF08570 | DUF1761 | 0.56 |
| PF11172 | DUF2959 | 0.56 |
| PF03466 | LysR_substrate | 0.56 |
| PF07689 | KaiB | 0.56 |
| PF13628 | DUF4142 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 4.47 |
| COG0691 | tmRNA-binding protein | Posttranslational modification, protein turnover, chaperones [O] | 1.12 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.56 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 0.56 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.56 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.56 |
| COG3619 | Uncharacterized membrane protein YoaK, UPF0700 family | Function unknown [S] | 0.56 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.56 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.56 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.56 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.16 % |
| Unclassified | root | N/A | 31.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JSYKU | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300001661|JGI12053J15887_10083035 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1760 | Open in IMG/M |
| 3300001661|JGI12053J15887_10217990 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100660025 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300002916|JGI25389J43894_1034797 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005174|Ga0066680_10924985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005184|Ga0066671_10391493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 888 | Open in IMG/M |
| 3300005436|Ga0070713_102236716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300005468|Ga0070707_101042382 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300005468|Ga0070707_102258525 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005540|Ga0066697_10223289 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300005554|Ga0066661_10518117 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005555|Ga0066692_10022164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3244 | Open in IMG/M |
| 3300005558|Ga0066698_10364673 | Not Available | 997 | Open in IMG/M |
| 3300005559|Ga0066700_10179138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1453 | Open in IMG/M |
| 3300005561|Ga0066699_10448400 | Not Available | 923 | Open in IMG/M |
| 3300005568|Ga0066703_10560208 | Not Available | 670 | Open in IMG/M |
| 3300005598|Ga0066706_10008263 | All Organisms → cellular organisms → Bacteria | 5513 | Open in IMG/M |
| 3300005598|Ga0066706_10041618 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300005602|Ga0070762_10604003 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005617|Ga0068859_100969277 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300005764|Ga0066903_104172433 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005834|Ga0068851_10471075 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005921|Ga0070766_10007140 | All Organisms → cellular organisms → Bacteria | 5667 | Open in IMG/M |
| 3300005921|Ga0070766_10120425 | All Organisms → cellular organisms → Bacteria | 1577 | Open in IMG/M |
| 3300006028|Ga0070717_10019071 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5371 | Open in IMG/M |
| 3300006047|Ga0075024_100801678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300006052|Ga0075029_100820563 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006173|Ga0070716_100100417 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300006173|Ga0070716_100684101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300006176|Ga0070765_100824395 | Not Available | 877 | Open in IMG/M |
| 3300006176|Ga0070765_101053725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 769 | Open in IMG/M |
| 3300006796|Ga0066665_11122463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300006797|Ga0066659_10234282 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300006893|Ga0073928_10098600 | All Organisms → cellular organisms → Bacteria | 2458 | Open in IMG/M |
| 3300007982|Ga0102924_1227688 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 786 | Open in IMG/M |
| 3300009012|Ga0066710_101316503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1120 | Open in IMG/M |
| 3300009038|Ga0099829_11533568 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009089|Ga0099828_10094947 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300009090|Ga0099827_10817879 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300009090|Ga0099827_11155626 | Not Available | 673 | Open in IMG/M |
| 3300009094|Ga0111539_10654734 | Not Available | 1223 | Open in IMG/M |
| 3300009094|Ga0111539_12923014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300009137|Ga0066709_101638851 | Not Available | 918 | Open in IMG/M |
| 3300009137|Ga0066709_103948941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300010046|Ga0126384_10772128 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010343|Ga0074044_10835614 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010358|Ga0126370_11523048 | Not Available | 637 | Open in IMG/M |
| 3300010359|Ga0126376_11374705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300010361|Ga0126378_11315571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 817 | Open in IMG/M |
| 3300010361|Ga0126378_12397858 | Not Available | 602 | Open in IMG/M |
| 3300010376|Ga0126381_104801556 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300010379|Ga0136449_102367794 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300010398|Ga0126383_12658584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 584 | Open in IMG/M |
| 3300011269|Ga0137392_11508083 | Not Available | 531 | Open in IMG/M |
| 3300011269|Ga0137392_11548872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300011270|Ga0137391_10091187 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300012189|Ga0137388_10578488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300012200|Ga0137382_10952430 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300012201|Ga0137365_10728676 | Not Available | 724 | Open in IMG/M |
| 3300012202|Ga0137363_10937032 | Not Available | 735 | Open in IMG/M |
| 3300012205|Ga0137362_11143224 | Not Available | 661 | Open in IMG/M |
| 3300012206|Ga0137380_11590829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300012285|Ga0137370_10778536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300012361|Ga0137360_10780669 | Not Available | 822 | Open in IMG/M |
| 3300012362|Ga0137361_11769471 | Not Available | 536 | Open in IMG/M |
| 3300012582|Ga0137358_10461980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 856 | Open in IMG/M |
| 3300012582|Ga0137358_10491549 | Not Available | 827 | Open in IMG/M |
| 3300012911|Ga0157301_10281335 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012917|Ga0137395_11266673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012918|Ga0137396_10058451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2666 | Open in IMG/M |
| 3300012918|Ga0137396_11151259 | Not Available | 551 | Open in IMG/M |
| 3300012923|Ga0137359_10323124 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1372 | Open in IMG/M |
| 3300012923|Ga0137359_11392942 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012923|Ga0137359_11614918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300012923|Ga0137359_11620444 | Not Available | 535 | Open in IMG/M |
| 3300012925|Ga0137419_10192965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300012925|Ga0137419_10990200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300012929|Ga0137404_12210444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300012944|Ga0137410_10347603 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300012957|Ga0164303_10117272 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300012971|Ga0126369_10986598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 930 | Open in IMG/M |
| 3300012971|Ga0126369_11710258 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012976|Ga0134076_10514363 | Not Available | 548 | Open in IMG/M |
| 3300012977|Ga0134087_10487563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
| 3300012986|Ga0164304_11363291 | Not Available | 581 | Open in IMG/M |
| 3300014969|Ga0157376_10295594 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300015053|Ga0137405_1098325 | Not Available | 1102 | Open in IMG/M |
| 3300015241|Ga0137418_10060687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3462 | Open in IMG/M |
| 3300016341|Ga0182035_10421739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1125 | Open in IMG/M |
| 3300016371|Ga0182034_11363540 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300018433|Ga0066667_11207773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300018468|Ga0066662_10589717 | Not Available | 1037 | Open in IMG/M |
| 3300020170|Ga0179594_10227867 | Not Available | 701 | Open in IMG/M |
| 3300020199|Ga0179592_10233242 | Not Available | 829 | Open in IMG/M |
| 3300020583|Ga0210401_10293845 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1485 | Open in IMG/M |
| 3300020583|Ga0210401_10440046 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300021046|Ga0215015_10164705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300021086|Ga0179596_10118524 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300021086|Ga0179596_10648741 | Not Available | 535 | Open in IMG/M |
| 3300021088|Ga0210404_10128855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
| 3300021168|Ga0210406_10984892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300021170|Ga0210400_10068799 | All Organisms → cellular organisms → Bacteria | 2769 | Open in IMG/M |
| 3300021170|Ga0210400_10970368 | Not Available | 692 | Open in IMG/M |
| 3300021170|Ga0210400_11163498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300021171|Ga0210405_10030240 | All Organisms → cellular organisms → Bacteria | 4342 | Open in IMG/M |
| 3300021178|Ga0210408_11236786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300021180|Ga0210396_10086253 | All Organisms → cellular organisms → Bacteria | 2847 | Open in IMG/M |
| 3300021180|Ga0210396_10777965 | Not Available | 822 | Open in IMG/M |
| 3300021181|Ga0210388_10780988 | Not Available | 829 | Open in IMG/M |
| 3300021402|Ga0210385_10795842 | Not Available | 725 | Open in IMG/M |
| 3300021404|Ga0210389_11245259 | Not Available | 571 | Open in IMG/M |
| 3300021405|Ga0210387_10177214 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300021420|Ga0210394_10017923 | All Organisms → cellular organisms → Bacteria | 6647 | Open in IMG/M |
| 3300021432|Ga0210384_11340419 | Not Available | 620 | Open in IMG/M |
| 3300021477|Ga0210398_10092674 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300021479|Ga0210410_10724573 | Not Available | 877 | Open in IMG/M |
| 3300021559|Ga0210409_10154259 | All Organisms → cellular organisms → Bacteria | 2103 | Open in IMG/M |
| 3300022557|Ga0212123_10000924 | All Organisms → cellular organisms → Bacteria | 87714 | Open in IMG/M |
| 3300025910|Ga0207684_10598011 | Not Available | 942 | Open in IMG/M |
| 3300025922|Ga0207646_10449148 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300025928|Ga0207700_10244334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
| 3300025972|Ga0207668_12016199 | Not Available | 520 | Open in IMG/M |
| 3300026301|Ga0209238_1020122 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300026309|Ga0209055_1070995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1453 | Open in IMG/M |
| 3300026326|Ga0209801_1180502 | Not Available | 867 | Open in IMG/M |
| 3300026328|Ga0209802_1174688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
| 3300026329|Ga0209375_1062099 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300026361|Ga0257176_1016411 | Not Available | 1034 | Open in IMG/M |
| 3300026508|Ga0257161_1097887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300026514|Ga0257168_1042675 | Not Available | 987 | Open in IMG/M |
| 3300026538|Ga0209056_10112291 | Not Available | 2188 | Open in IMG/M |
| 3300026548|Ga0209161_10525259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300026552|Ga0209577_10370007 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300026552|Ga0209577_10742562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026557|Ga0179587_10962248 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300027635|Ga0209625_1083027 | Not Available | 718 | Open in IMG/M |
| 3300027655|Ga0209388_1069813 | Not Available | 1012 | Open in IMG/M |
| 3300027663|Ga0208990_1013650 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300027663|Ga0208990_1056033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1168 | Open in IMG/M |
| 3300027667|Ga0209009_1041221 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300027681|Ga0208991_1080466 | Not Available | 981 | Open in IMG/M |
| 3300027855|Ga0209693_10510267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300027889|Ga0209380_10009564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5678 | Open in IMG/M |
| 3300027903|Ga0209488_10302187 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027903|Ga0209488_10844091 | Not Available | 646 | Open in IMG/M |
| 3300027903|Ga0209488_11239138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300028036|Ga0265355_1015251 | Not Available | 649 | Open in IMG/M |
| 3300028536|Ga0137415_10054199 | All Organisms → cellular organisms → Bacteria | 3878 | Open in IMG/M |
| 3300028792|Ga0307504_10115462 | Not Available | 874 | Open in IMG/M |
| 3300031057|Ga0170834_105672708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300031057|Ga0170834_113905486 | Not Available | 707 | Open in IMG/M |
| 3300031114|Ga0308187_10453103 | Not Available | 518 | Open in IMG/M |
| 3300031122|Ga0170822_16178376 | Not Available | 758 | Open in IMG/M |
| 3300031128|Ga0170823_16202994 | Not Available | 621 | Open in IMG/M |
| 3300031231|Ga0170824_111219155 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300031474|Ga0170818_104856885 | Not Available | 598 | Open in IMG/M |
| 3300031708|Ga0310686_109334045 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031708|Ga0310686_119640181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
| 3300031715|Ga0307476_11090314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300031715|Ga0307476_11248813 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300031715|Ga0307476_11311307 | Not Available | 528 | Open in IMG/M |
| 3300031744|Ga0306918_10022755 | All Organisms → cellular organisms → Bacteria | 3832 | Open in IMG/M |
| 3300031754|Ga0307475_10091866 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300031754|Ga0307475_10385259 | Not Available | 1126 | Open in IMG/M |
| 3300031754|Ga0307475_10990023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300031781|Ga0318547_10900348 | Not Available | 552 | Open in IMG/M |
| 3300031823|Ga0307478_10560236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300031947|Ga0310909_11499830 | Not Available | 537 | Open in IMG/M |
| 3300031962|Ga0307479_10083848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 3086 | Open in IMG/M |
| 3300032180|Ga0307471_100174840 | All Organisms → cellular organisms → Bacteria | 2108 | Open in IMG/M |
| 3300032180|Ga0307471_103235359 | Not Available | 577 | Open in IMG/M |
| 3300032205|Ga0307472_100792877 | Not Available | 864 | Open in IMG/M |
| 3300032515|Ga0348332_14120615 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300032783|Ga0335079_10258794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae | 1911 | Open in IMG/M |
| 3300032805|Ga0335078_10372863 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300032805|Ga0335078_11436223 | Not Available | 776 | Open in IMG/M |
| 3300032898|Ga0335072_11088270 | Not Available | 723 | Open in IMG/M |
| 3300032898|Ga0335072_11774326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.73% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.47% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_07630500 | 2170459003 | Grass Soil | MKRTESTSSAQILKKMQPEEFDIVILGGGTGATLAASI |
| JGI12053J15887_100830351 | 3300001661 | Forest Soil | MKRTESTSSAQVLRKTQPEEFDLVILGGGTGSTIAAW |
| JGI12053J15887_102179903 | 3300001661 | Forest Soil | MKSTETSPSAHVFKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| JGIcombinedJ26739_1006600251 | 3300002245 | Forest Soil | MNRTADLSSPRVLEKTEPEEFDLVILGGGTGSTVAAWTFAGEGKR |
| JGI25389J43894_10347972 | 3300002916 | Grasslands Soil | MNTLESVSSAQLLTKTDPEEFDLVVLGGGTGSTIAAWTFASGESVWR* |
| Ga0066680_109249851 | 3300005174 | Soil | MKSNETCPSAPVLKKSQPEEFDLVILDGGTGSTIAAWTFAGE |
| Ga0066671_103914931 | 3300005184 | Soil | MNTLESVSSAQLLTKTDPEEFDLVVLGGGTGSTIAAWTFASGESV |
| Ga0070713_1022367161 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTESSPSAHLLKKSQPEEIDLVILGGGTGSTVAAWTFAGEGKR |
| Ga0070707_1010423821 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTETSPSAHVKKSQPEEFDLVILGGGTGSTIAAWTFAGE |
| Ga0070707_1022585252 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSFETSPSAHVFKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0066697_102232894 | 3300005540 | Soil | MKSTETSPSAHGLKKSQPEEYDLVILGGGTGSTVAAWTFAAE |
| Ga0066661_105181172 | 3300005554 | Soil | MKSTESSPSAHVLKKSQPEEFDLVILGGGTGSTVAAWTFAGEGKR |
| Ga0066692_100221641 | 3300005555 | Soil | MNSTKSISSTQARRTQPEEFDFVILGGGTRSTIAAWT |
| Ga0066698_103646731 | 3300005558 | Soil | MNSTKSISSAQARRTQPEEFDFVILGGGTRSTIAAWTLAGE |
| Ga0066700_101791381 | 3300005559 | Soil | MKSTEDPSPSAHVFKKSQPEEFDLVILGGGTGSTIAAW |
| Ga0066699_104484001 | 3300005561 | Soil | MKRTEITSSPQVLKKSQPEEFDLVILGGGTGSTIA |
| Ga0066703_105602081 | 3300005568 | Soil | MNSTKTSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTF |
| Ga0066706_100082638 | 3300005598 | Soil | MKSNETCPSAPVLKKSQPEEFDLVILDGGTGSTIAAWTFAGEGKRV |
| Ga0066706_100416185 | 3300005598 | Soil | MKSNETSPSAPVLKKSQPEEFDLVILDGGTGSTIAAWTFAGEGKRV |
| Ga0070762_106040031 | 3300005602 | Soil | MKRTERTPSPQVLKKAQPEEFDLLILGGGTGSTIAAWTFAGEGK |
| Ga0068859_1009692771 | 3300005617 | Switchgrass Rhizosphere | MNSTKNASSAQARKRQPEEFDLVILGGGTGSTIAAWTFAGEGKQV |
| Ga0066903_1041724331 | 3300005764 | Tropical Forest Soil | MKSTTNTSSAQSLKQTDSEAYDLVILGGGTGSTIAAWTFAKQGQ |
| Ga0068851_104710751 | 3300005834 | Corn Rhizosphere | MKRTESTSSPQVVKKTQPEEFDLVILGGGTGSTIAAWT |
| Ga0070766_100071404 | 3300005921 | Soil | MKSTENTSGQGCTKKQPEEFDLVILGGSMGWTIAAWFPHY* |
| Ga0070766_101204251 | 3300005921 | Soil | MKSTESTSSAQVLKKAQPEEFDLVILGGGTGLTIDAWTFAGEGKRVAV |
| Ga0070717_100190717 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0075024_1008016781 | 3300006047 | Watersheds | MTTTGSSSTGRLIKDTQPEEFDLVILGGGTGSTVAA |
| Ga0075029_1008205632 | 3300006052 | Watersheds | MKNTKNTSSPQPREKTQPEEFDLVILGGGTGSTIAAWTFAGE |
| Ga0070716_1001004173 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKGTVTSPSAHVKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0070716_1006841012 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNSTESTSSAQVLKNAQLEEFDLVILGGGTGSTIAAWTFAGEGKRVA |
| Ga0070765_1008243953 | 3300006176 | Soil | MKRTESTSSPQVHKKAQPEEFDLVILGGGTGSTIA |
| Ga0070765_1010537253 | 3300006176 | Soil | MKSTETSPSANVLKNSQQEEFDLVILGGGTGSTVAAWTFAGEGK |
| Ga0066665_111224631 | 3300006796 | Soil | MKRTESISSAQVIKKTQPEESDLVILGRGTGSTIAAWW* |
| Ga0066659_102342821 | 3300006797 | Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTVAAWTFAGEGKRV |
| Ga0073928_100986003 | 3300006893 | Iron-Sulfur Acid Spring | MRSTESTLSAQVRNKTQPEEFDLVILAGGTGSTDQR* |
| Ga0102924_12276881 | 3300007982 | Iron-Sulfur Acid Spring | MKRTQSTSSPQVLKKAQPEEFDLVILGGGTGSTIAAWTFAGE |
| Ga0066710_1013165033 | 3300009012 | Grasslands Soil | MKSTETSPSDHVLKKSQAEEFDLVILGGGTGSTIAAWTFAGEG |
| Ga0099829_115335681 | 3300009038 | Vadose Zone Soil | MKSLENTPSAQGLQKTQPEAFDLVMLGGGTGSTIAAWTFAGPLLL |
| Ga0099828_100949474 | 3300009089 | Vadose Zone Soil | MKSLENTPSAQGLQKTQPEAFDLVMLGGGTGSTIAAWTFAG |
| Ga0099827_108178791 | 3300009090 | Vadose Zone Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAA |
| Ga0099827_111556261 | 3300009090 | Vadose Zone Soil | MKSTETSPSAHVFKKSQPKEFDLVILGGGTSSTIAAWTFGGEGKRVA |
| Ga0111539_106547341 | 3300009094 | Populus Rhizosphere | MKSLENTPSAQGVTKTQPEAFDLVILGGGTGSTIAAWTFAGQ |
| Ga0111539_129230141 | 3300009094 | Populus Rhizosphere | MDSMENTSPSQPFKKPQAEKFDVVILGGGTGSTIAAWTFAAEGK |
| Ga0066709_1016388511 | 3300009137 | Grasslands Soil | MKSTKNTSSAQALKKTQLEEFDLVILGGGTGSTIAT* |
| Ga0066709_1039489412 | 3300009137 | Grasslands Soil | MKNTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0126384_107721282 | 3300010046 | Tropical Forest Soil | MNSTKKSSSLQVTTSLQPEEFDLVFLGGGTGSTVAAWTFAGEGK |
| Ga0074044_108356141 | 3300010343 | Bog Forest Soil | MTRTETASVTQTLTLQTTDVEEFDLVILGGGTGSTVAAWTFAAQ |
| Ga0126370_115230482 | 3300010358 | Tropical Forest Soil | MKSTEKTSFTQTLENVEPEEFDLVILGGGTGSTIAAWTFA |
| Ga0126376_113747052 | 3300010359 | Tropical Forest Soil | MQSVENTSFAQVLKKRQPEEFDLVILGGGTGSTIAAWTFAGQGK |
| Ga0126378_113155713 | 3300010361 | Tropical Forest Soil | MNSIENTSSTHTVKSTRPEDFDLVILGGGTGSTVAAWTFAAEGK |
| Ga0126378_123978581 | 3300010361 | Tropical Forest Soil | MKSTETSLSSHVLKQSQPEEFDLVILGGGTGSTIAAWT |
| Ga0126381_1048015562 | 3300010376 | Tropical Forest Soil | MKSIENTSPTKASNNTQPEEFDVVILGGGTGSTIAAWTFAG |
| Ga0136449_1023677941 | 3300010379 | Peatlands Soil | MKQTESTSSAQVLKKMQPEEFDLVILGGGTGSTIAAWTFA |
| Ga0126383_126585842 | 3300010398 | Tropical Forest Soil | MKSMENTSSPQVLKKTQPEESDLVILGSGTGSTIAAWTFAG |
| Ga0137392_115080832 | 3300011269 | Vadose Zone Soil | MKTLEHTSSISSPQKSTPEEYDLVILGGGTGGTIAAWTFAGQG |
| Ga0137392_115488722 | 3300011269 | Vadose Zone Soil | MKSTEISPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGKR |
| Ga0137391_100911875 | 3300011270 | Vadose Zone Soil | MKRTESTSAAQALKKTQPEECDLVILGGGTGSTIAAWTFAG |
| Ga0137388_105784881 | 3300012189 | Vadose Zone Soil | MKRTEGTSSAQVLKKTQPEEFDLVILGGGTGSTIAAWTF |
| Ga0137382_109524302 | 3300012200 | Vadose Zone Soil | MENVSSAQLPKKADLEEFDLVILGGGTGSTIAAWTFAHQGQR |
| Ga0137365_107286762 | 3300012201 | Vadose Zone Soil | MKRTESTSSAQVLEKTQPEEFDLVILGGGTGSTIAV* |
| Ga0137363_109370322 | 3300012202 | Vadose Zone Soil | MNSTKNASSAQARRKTQPEEFDLVILGGGTGSTIAAWTFAGEG |
| Ga0137362_111432242 | 3300012205 | Vadose Zone Soil | VNGQAQPSSAQSAKGSKPEEFDLVILGGGTGSTIAAWTFAAQG |
| Ga0137380_115908291 | 3300012206 | Vadose Zone Soil | MKGTETSPSAHVKKSQPEEFDLVILGGGTGSTIAAWTFAGEGKR |
| Ga0137370_107785362 | 3300012285 | Vadose Zone Soil | MNSTKNISSAQGRKTQPEEFDLVILGGGTGSTIAAWTFAGEG* |
| Ga0137360_107806691 | 3300012361 | Vadose Zone Soil | MKSTETSPSSQVLKKSQPEEFDLVILGGGTGSTVAAWT |
| Ga0137361_117694712 | 3300012362 | Vadose Zone Soil | MKTRERTSSTPSPQKSTPEEYDLVILGGGTGSTIATWTFAGQGK |
| Ga0137358_104619802 | 3300012582 | Vadose Zone Soil | MENVSSVHQAKAADPEEYDIVILSGGTGSTIAAWTFAAEGKRV |
| Ga0137358_104915492 | 3300012582 | Vadose Zone Soil | MSSTKNASLAQARKKTQPEEFDLVILGGGTGSTIAAWTFAAEGKQVA |
| Ga0157301_102813352 | 3300012911 | Soil | MKNTKEVSLAQVSENMQPQEFDLVMLGGGTGSTVAAWTFAGE |
| Ga0137395_112666731 | 3300012917 | Vadose Zone Soil | MNSTKNISSAQAHKTQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0137396_100584511 | 3300012918 | Vadose Zone Soil | MKSLENTPFAQGVTQTQPEAFYGGVLGGGTGATFS |
| Ga0137396_111512592 | 3300012918 | Vadose Zone Soil | MKRPEPSPSAHVLKQSQPEEFDLVILGGGTGSTIAAWT |
| Ga0137359_103231242 | 3300012923 | Vadose Zone Soil | MKRTESTSSAQVLKKTQPEEFDLVILGGGTGTKKTAWTFAGE |
| Ga0137359_113929422 | 3300012923 | Vadose Zone Soil | MKRTESTSPPQVLNKTQPEEFDLVILGGGTGSTIAAW |
| Ga0137359_116149182 | 3300012923 | Vadose Zone Soil | MNSTKNTSSAQSRKTKTQPEEFDLVILGGGTGSTVAAWTFAGEG |
| Ga0137359_116204441 | 3300012923 | Vadose Zone Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTVAA |
| Ga0137419_101929651 | 3300012925 | Vadose Zone Soil | MKTTESTSSTQVFKKTQPEEFDLVILGGGTGSTIAA |
| Ga0137419_109902003 | 3300012925 | Vadose Zone Soil | MKGSESTSSAQILKKTQPEDFDLVILGGGTGSTIAAWTFAGEGKKVA |
| Ga0137404_122104442 | 3300012929 | Vadose Zone Soil | MKSSKNASPAEASSKTQPEEFDLVILGGGTGSTVAAW |
| Ga0137410_103476031 | 3300012944 | Vadose Zone Soil | MNSTKNTSSAQSRKKKTQPEEFDLVILGGGTGSTVA |
| Ga0164303_101172721 | 3300012957 | Soil | MNRTESTSSTKVLKKTQPEKFDLVILGGGTGSTVAAW |
| Ga0126369_109865981 | 3300012971 | Tropical Forest Soil | MKNTKQISAVEISRNMQPEEFDLVILGGGTGSTDAAWT |
| Ga0126369_117102582 | 3300012971 | Tropical Forest Soil | MNNTKEISTAQLNKSLQPEEFDLVILGGGTGSTIAAWTFAG |
| Ga0134076_105143631 | 3300012976 | Grasslands Soil | MKSIETSPSAHVLKRSQPEEFDLVILGGGSGSTVAAWTF |
| Ga0134087_104875632 | 3300012977 | Grasslands Soil | MKRTESTSSAQVLKKTQPEEFDLVILGGGTGSTIAA* |
| Ga0164304_113632911 | 3300012986 | Soil | MKTTETSPSARVLRKSQPEEFDLVILGGGTGSTVAAWTF |
| Ga0157376_102955941 | 3300014969 | Miscanthus Rhizosphere | MKSAETSPSAPVLKKSQPEEFDLVILGGGTGSTVAAWTF |
| Ga0137405_10983252 | 3300015053 | Vadose Zone Soil | MSSTKNASLAQARKKTQPEELDLVILGGGTGSTIAAWTFAAEGKQVAVV |
| Ga0137418_100606878 | 3300015241 | Vadose Zone Soil | MKRTESISSAQVLKKTQPEEFDLVILGGGRGSTIAAWTFAGEGKQVA |
| Ga0182035_104217391 | 3300016341 | Soil | MEKISSAQSPEKTNPEEHDLVILGGGTGSTIAAWTFARQGQH |
| Ga0182034_113635402 | 3300016371 | Soil | MTSLENTRSVPTIQRAQPEDFDLVILGGGTGSTVAAW |
| Ga0066667_112077732 | 3300018433 | Grasslands Soil | MKSNETSPSAPVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGK |
| Ga0066662_105897172 | 3300018468 | Grasslands Soil | MKSTESSPSAHVLKKSQPEEFDLVILGGGTGSTVAAWTFAGEGKRV |
| Ga0179594_102278671 | 3300020170 | Vadose Zone Soil | MRRTESTSSAQVLKKTQPEEFDLVILGGGTGSTIA |
| Ga0179592_102332421 | 3300020199 | Vadose Zone Soil | MKSTKNASPAQARKKTQPEEFDLVILGGGTGSTIA |
| Ga0210401_102938453 | 3300020583 | Soil | MNSTKNTSSAQAGKNTQPEEFDLVILGGGTGSTVAAWTFASEGKQV |
| Ga0210401_104400461 | 3300020583 | Soil | MKSTEPSPSAEVLKKSQPEEFDLVILGGGTGSTVAAW |
| Ga0215015_101647052 | 3300021046 | Soil | MNTLEGVSSAQLLKKTDPEEFDLVILGGGTGSTIAAWTFASEGER |
| Ga0179596_101185243 | 3300021086 | Vadose Zone Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAG |
| Ga0179596_106487411 | 3300021086 | Vadose Zone Soil | MNSMKNASPAQARKQTQPEEFDLVILGGGTGSTVAAW |
| Ga0210404_101288551 | 3300021088 | Soil | MNTMESVSSAPLLKKTDPEEYDLVILGGGTGSTIAAWTFASQ |
| Ga0210406_109848921 | 3300021168 | Soil | MKRTESTSSAQILKKTQPEEFDLVILGGGTGSTIAAWTFAGEGKQ |
| Ga0210400_100687995 | 3300021170 | Soil | MKGTETSPSAHVMQSQPEEFDLLILGGGTGSTVAAWTFAGEGKR |
| Ga0210400_109703681 | 3300021170 | Soil | MKNTETSPSAYVLESTQLEEFDLVILGGGTGSTIAAW |
| Ga0210400_111634981 | 3300021170 | Soil | MKRTESTSSAQILKKTQPEEFDLVILGGGTGSTIAAW |
| Ga0210405_100302401 | 3300021171 | Soil | MKNTETSPSAHVLENTQQEEFDLVILGGGTGSTIAA |
| Ga0210408_112367862 | 3300021178 | Soil | MNSTKNISSAQTRNMQPEEFDLVILGSGTGSTIAAWAFAV |
| Ga0210396_100862534 | 3300021180 | Soil | MNSTETSLSPQASKNTQPEDFDLVILGGGTGSTVAAWTFA |
| Ga0210396_107779651 | 3300021180 | Soil | MKSTEPSPSAEVLKKSQPEEFDLVILGGGTGSTVA |
| Ga0210388_107809881 | 3300021181 | Soil | MNTLEGVSSAQLLKKTDPEEFDLVILGGGTGSTIAAWTFASEGKRVA |
| Ga0210385_107958422 | 3300021402 | Soil | MSTLENVSSAQLLNKTAPEEFDLVILGGGTGSTIAAWTFA |
| Ga0210389_112452591 | 3300021404 | Soil | MTRTESTLSAQVLKKTQPEEFDLVILGGGTGSTIAAW |
| Ga0210387_101772143 | 3300021405 | Soil | MNTAEEVTSAQPLKNRQPEEFDLVILGGGTGSTIAAWT |
| Ga0210394_100179236 | 3300021420 | Soil | MKRTEINSSAQVLKKTQPEEFDLVILGGGTGSTVAAW |
| Ga0210384_113404191 | 3300021432 | Soil | MKSTEPSPSAEVLKKSQPEEFDLVILGGGTGSTVAAWTFAGEGKRV |
| Ga0210398_100926744 | 3300021477 | Soil | MKRTESTSSAQAIRKTQPEEFDLVILGGGTGSTIAAWTFAGEDKHVAV |
| Ga0210410_107245731 | 3300021479 | Soil | MNSTETTPSAHVLKKSQPEEFDVVILGGGTGSTIAAWTFAGE |
| Ga0210409_101542593 | 3300021559 | Soil | MTTEKPSSAKLRKQNQPEEYDLVILGGGTGSTIAAWTFASEG |
| Ga0212123_1000092472 | 3300022557 | Iron-Sulfur Acid Spring | MRSTESTLSAQVRNKTQPEEFDLVILAGGTGSTDQR |
| Ga0207684_105980111 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKATETSPSAHVKKSQPEEFDLLILGGGTGSTIAAWTFA |
| Ga0207646_104491483 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTGETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAAEG |
| Ga0207700_102443341 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRSTESSPSAHLLKKSQPEEIDLVILGGGTGSTVAAWTFAGE |
| Ga0207668_120161991 | 3300025972 | Switchgrass Rhizosphere | MKRTESTSSAQVLEKTKPEEFDLVILGGGTGSTIAALLA |
| Ga0209238_10201224 | 3300026301 | Grasslands Soil | MNTLESVSSAQLLTKTDPEEFDLVVLGGGTGSTIAAWTFASGESVWR |
| Ga0209055_10709953 | 3300026309 | Soil | MKGIESTASPQVLEKSQPEEFDLVILGGGTGSTIAAWTFAG |
| Ga0209801_11805022 | 3300026326 | Soil | MKGTETSPSAHVKKSQPEEFDLVILGGGTGSTVAAWPFAG |
| Ga0209802_11746883 | 3300026328 | Soil | MKSTEDPSPSAHVFKKSQPEEFDLVILGGGTGSTIAAWT |
| Ga0209375_10620993 | 3300026329 | Soil | MKSTEISPSAHVLKKSQPEEFDLVIFGGGTGSTVA |
| Ga0257176_10164111 | 3300026361 | Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWT |
| Ga0257161_10978871 | 3300026508 | Soil | MKRTESTSSAQILKKTQPEEFDLVILGGGTGSTIAAWTF |
| Ga0257168_10426751 | 3300026514 | Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGKR |
| Ga0209056_101122912 | 3300026538 | Soil | MKRTESISSAQVIKKTQPEESDLVILGRGTGSTIAAWW |
| Ga0209161_105252592 | 3300026548 | Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEGKQV |
| Ga0209577_103700072 | 3300026552 | Soil | MNSTKNISSAQGRKTQPEEFDLVILGGGTGSTIAAWTFAGEG |
| Ga0209577_107425622 | 3300026552 | Soil | MKSTEDPSPSAHVFKKSQPEEFDLVILGGGTGSTIAAWTFAGEG |
| Ga0179587_109622482 | 3300026557 | Vadose Zone Soil | MKRAETSPTAHVLKKTQPEKFDLVILGGGTGSTVAAGTFAGEGKRVAVVDRRY |
| Ga0209625_10830271 | 3300027635 | Forest Soil | MKRTESTSSTQVLTKTQPEEFDLVILGGGTGATIAAWTFA |
| Ga0209388_10698131 | 3300027655 | Vadose Zone Soil | MKSTETSSSAHGLKKSQPEEFDLVIFGGGTGSTVAAWTFAGEGKR |
| Ga0208990_10136503 | 3300027663 | Forest Soil | MKSTKNTLPAQARKKTQPEEFDLVILGGGTGSTIAAWTFAG |
| Ga0208990_10560333 | 3300027663 | Forest Soil | MKSTETSPSAHVLKKSQPEEFDLVILGGGTGSTVAAWTFA |
| Ga0209009_10412213 | 3300027667 | Forest Soil | MNKKNTSSAPASKKTQPEEFDLVILGGGTGSTIAAWTFAS |
| Ga0208991_10804662 | 3300027681 | Forest Soil | MKRTESTSSAQVLKKTQPEEFDLVILGGGTGSTIAA |
| Ga0209693_105102672 | 3300027855 | Soil | MKPTESISSPRILKKTQQEEFDLVILGGGTGSTIAAWTFAGE |
| Ga0209380_100095644 | 3300027889 | Soil | MKSTENTSGQGCTKKQPEEFDLVILGGSMGWTIAAWFPHY |
| Ga0209488_103021871 | 3300027903 | Vadose Zone Soil | MNRTESTSSAQVLKTQPEEFDLVILGGGTGSTIAAWTFAGEGKR |
| Ga0209488_108440911 | 3300027903 | Vadose Zone Soil | MKSTKNASPAQARKKTQPEEFDLVILGGGTGSTIAAWIFAGEGKQVAV |
| Ga0209488_112391381 | 3300027903 | Vadose Zone Soil | MKTTESTASAQILTKTQPEEFDLVILGGGTGSTIAAWTFAGEGKRV |
| Ga0265355_10152512 | 3300028036 | Rhizosphere | MNRMESPSAAHRVKKSQPEEFDLVILGGGTGSTVAAWTFAGEGKRR |
| Ga0137415_100541997 | 3300028536 | Vadose Zone Soil | MKTLEHTSSISSPQKSTPEEYDLVILGGGTGGTIAAWTFAGQ |
| Ga0307504_101154622 | 3300028792 | Soil | MKSTETSPSAHVLEKSQPEEFDLVILGGGTGSTVAAWTFAGEGK |
| Ga0170834_1056727082 | 3300031057 | Forest Soil | MKRTENISSAPILKKSQPEEFDLVILGGGTGSTIAAWTFAGE |
| Ga0170834_1139054861 | 3300031057 | Forest Soil | MKSTENTSSTPAPKKTQPEEFDLVILGGGTGSTVAAWTFAAEG |
| Ga0308187_104531032 | 3300031114 | Soil | MKSLENTPSAQVLKQTPPEEFDLVILGGGTGSTIAA |
| Ga0170822_161783761 | 3300031122 | Forest Soil | MKSTETSPSADVLKKTQPEEFDLVILGGGTGSTVAAW |
| Ga0170823_162029942 | 3300031128 | Forest Soil | MNNTKNTSSAQARKNTQPEEFDLVILGGGTGSTIAAWTFAGEGKQVA |
| Ga0170824_1112191552 | 3300031231 | Forest Soil | MKRTESTSSAQILKKTQPEEFDIVILGGGTGATLAASI |
| Ga0170818_1048568852 | 3300031474 | Forest Soil | MKSTETSPSSHVLKKSQPEEFDLVILGGGTGSTIAAWTFAGEG |
| Ga0310686_1093340451 | 3300031708 | Soil | MNTLEGVSSAQLLKKTDPEEFDLVILGGGTGSTIAAWTFASE |
| Ga0310686_1196401811 | 3300031708 | Soil | MNSTKNISSAQAHKTQPEEFDLVILGGGTGSTIAAWTF |
| Ga0307476_110903141 | 3300031715 | Hardwood Forest Soil | MNRTETTSSPQVFKKSQPEEFDLVILGGGTGSTVAA |
| Ga0307476_112488132 | 3300031715 | Hardwood Forest Soil | VKVGSKVKQVSTETPLQTNPEEFDIVILGGGTGGTVAAWTFAGEGR |
| Ga0307476_113113072 | 3300031715 | Hardwood Forest Soil | MKRTKSTSSPQVLKKAQPEEFDLVILGGGTGSTIAAWTF |
| Ga0306918_100227557 | 3300031744 | Soil | MQSTSNSSSAKVFTKTQPEEFDLVILGGGTGSTIAA |
| Ga0307475_100918661 | 3300031754 | Hardwood Forest Soil | MNHTESTSSSSVQIFKKSQPEEFDLVILGGGTGSTIAAWTFAG |
| Ga0307475_103852593 | 3300031754 | Hardwood Forest Soil | MKSTKTPPSDHVLKKSQPEEFDLVILGGGTGSTIAAWTF |
| Ga0307475_109900231 | 3300031754 | Hardwood Forest Soil | MKSAETTSSAQVLKQTQPEEFDLVILGGGTGSTIAAWTFAGEGKR |
| Ga0318547_109003481 | 3300031781 | Soil | MNPIESSSATAKTTQPEEFDLVILGGGTGSTIAAWT |
| Ga0307478_105602361 | 3300031823 | Hardwood Forest Soil | MKGTESISSAQVLKKTEPEEFDLVILGGGTGSTIAAWTFAGEGKRV |
| Ga0310909_114998301 | 3300031947 | Soil | MKSTETSLSSHVLKQSQPEEFDLVILGGGTGSTIAAWTFAGEEKRVA |
| Ga0307479_100838481 | 3300031962 | Hardwood Forest Soil | MKSTETSPSAHVFKKTQPEEFDLLILGGGTGSTIA |
| Ga0307471_1001748404 | 3300032180 | Hardwood Forest Soil | MKSAKTSPSAHVLKRSQPEEFDLVILGGGTGSTVAAW |
| Ga0307471_1032353591 | 3300032180 | Hardwood Forest Soil | MTSTKNDSATQARKKTLPEEFDLVILGGGTGSTIAAWTFA |
| Ga0307472_1007928772 | 3300032205 | Hardwood Forest Soil | MNSTKNASSAQARKNTQPEEFDLVILGGGTGSTIAAWTFAGEGKQ |
| Ga0348332_141206151 | 3300032515 | Plant Litter | MKTADNNSAAESNNQTAAEEYDVVILGGGTGSTVAAWTFA |
| Ga0335079_102587941 | 3300032783 | Soil | MQTTEKASSAEAVTRAKPEEYDLVIFGGGTGSTLAA |
| Ga0335078_103728631 | 3300032805 | Soil | MKSRDNSSHAQVVKNTQPEEFDVVILGGGTGSTVAAWTFASEGKR |
| Ga0335078_114362233 | 3300032805 | Soil | MTRSESSSSVHSVRSVQAEDFDLSILGGGTGWTIAAWTFAS |
| Ga0335072_110882701 | 3300032898 | Soil | MNGTANNSSPPVPKPHIEEFDLVILGGGTGSTIAAWTFAGRG |
| Ga0335072_117743261 | 3300032898 | Soil | MATTEAVPSAQLVKDTKPEEYDLVILGGGTGSTVAAWTFAGQGKR |
| ⦗Top⦘ |