


| Basic Information | |
|---|---|
| Family ID | F032764 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 63.28 % |
| % of genes near scaffold ends (potentially truncated) | 44.69 % |
| % of genes from short scaffolds (< 2000 bps) | 84.36 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (63.687 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (30.726 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.754 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.190 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 80.95% β-sheet: 0.00% Coil/Unstructured: 19.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF00132 | Hexapep | 35.75 |
| PF06035 | Peptidase_C93 | 11.73 |
| PF11324 | DUF3126 | 2.79 |
| PF06426 | SATase_N | 2.23 |
| PF13356 | Arm-DNA-bind_3 | 1.68 |
| PF01694 | Rhomboid | 1.68 |
| PF14602 | Hexapep_2 | 1.12 |
| PF03401 | TctC | 0.56 |
| PF12307 | DUF3631 | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF13560 | HTH_31 | 0.56 |
| PF00571 | CBS | 0.56 |
| PF10028 | DUF2270 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 11.73 |
| COG1045 | Serine acetyltransferase | Amino acid transport and metabolism [E] | 2.23 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 1.68 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.69 % |
| Unclassified | root | N/A | 36.31 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908016|OU_2_1_1_newblercontig36799 | Not Available | 541 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1244514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig541499 | Not Available | 699 | Open in IMG/M |
| 3300000559|F14TC_101953656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1428 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10031231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1437 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10142492 | Not Available | 579 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1006715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2201 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1025139 | Not Available | 1113 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1049119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10004714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3152 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10033980 | Not Available | 1187 | Open in IMG/M |
| 3300000955|JGI1027J12803_101646063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300001867|JGI12627J18819_10138464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 995 | Open in IMG/M |
| 3300002906|JGI25614J43888_10011563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2850 | Open in IMG/M |
| 3300002914|JGI25617J43924_10289471 | Not Available | 562 | Open in IMG/M |
| 3300004267|Ga0066396_10027498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 809 | Open in IMG/M |
| 3300004479|Ga0062595_100715756 | Not Available | 807 | Open in IMG/M |
| 3300004629|Ga0008092_11321994 | Not Available | 599 | Open in IMG/M |
| 3300004633|Ga0066395_10723022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005166|Ga0066674_10232776 | Not Available | 876 | Open in IMG/M |
| 3300005332|Ga0066388_100515801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1829 | Open in IMG/M |
| 3300005332|Ga0066388_102041323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1029 | Open in IMG/M |
| 3300005332|Ga0066388_102536139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 932 | Open in IMG/M |
| 3300005332|Ga0066388_104140873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 739 | Open in IMG/M |
| 3300005332|Ga0066388_105326487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 652 | Open in IMG/M |
| 3300005332|Ga0066388_105524269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300005332|Ga0066388_106222013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 602 | Open in IMG/M |
| 3300005332|Ga0066388_106243773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300005332|Ga0066388_106856072 | Not Available | 573 | Open in IMG/M |
| 3300005434|Ga0070709_10058185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2451 | Open in IMG/M |
| 3300005467|Ga0070706_101787789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300005553|Ga0066695_10300622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1012 | Open in IMG/M |
| 3300005554|Ga0066661_10127419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1544 | Open in IMG/M |
| 3300005558|Ga0066698_10553897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 780 | Open in IMG/M |
| 3300005713|Ga0066905_100181853 | Not Available | 1552 | Open in IMG/M |
| 3300005713|Ga0066905_100869846 | Not Available | 786 | Open in IMG/M |
| 3300005713|Ga0066905_101071456 | Not Available | 714 | Open in IMG/M |
| 3300005713|Ga0066905_101563779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300005713|Ga0066905_102180324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300005713|Ga0066905_102207491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300005764|Ga0066903_104160203 | Not Available | 775 | Open in IMG/M |
| 3300005764|Ga0066903_106358312 | Not Available | 616 | Open in IMG/M |
| 3300005937|Ga0081455_10003815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17198 | Open in IMG/M |
| 3300005937|Ga0081455_10463070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300006173|Ga0070716_100967723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 671 | Open in IMG/M |
| 3300006800|Ga0066660_10195156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1539 | Open in IMG/M |
| 3300006854|Ga0075425_101914686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 664 | Open in IMG/M |
| 3300009090|Ga0099827_10130746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2033 | Open in IMG/M |
| 3300009094|Ga0111539_13156402 | Not Available | 531 | Open in IMG/M |
| 3300009100|Ga0075418_10133517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2639 | Open in IMG/M |
| 3300009137|Ga0066709_100475932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1753 | Open in IMG/M |
| 3300009137|Ga0066709_101891314 | Not Available | 831 | Open in IMG/M |
| 3300009147|Ga0114129_10064374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5116 | Open in IMG/M |
| 3300009147|Ga0114129_10635570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1379 | Open in IMG/M |
| 3300009792|Ga0126374_10458600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 908 | Open in IMG/M |
| 3300009792|Ga0126374_11230471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300010041|Ga0126312_11253620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300010043|Ga0126380_11252312 | Not Available | 643 | Open in IMG/M |
| 3300010046|Ga0126384_10066649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2543 | Open in IMG/M |
| 3300010046|Ga0126384_10431726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1120 | Open in IMG/M |
| 3300010046|Ga0126384_11283055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
| 3300010047|Ga0126382_12185971 | Not Available | 532 | Open in IMG/M |
| 3300010366|Ga0126379_12121620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300010366|Ga0126379_12148485 | Not Available | 660 | Open in IMG/M |
| 3300010376|Ga0126381_101296647 | Not Available | 1053 | Open in IMG/M |
| 3300010376|Ga0126381_104860557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300010398|Ga0126383_12511756 | Not Available | 599 | Open in IMG/M |
| 3300010863|Ga0124850_1011565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2807 | Open in IMG/M |
| 3300012200|Ga0137382_10015166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4264 | Open in IMG/M |
| 3300012202|Ga0137363_10080099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2430 | Open in IMG/M |
| 3300012205|Ga0137362_11708668 | Not Available | 516 | Open in IMG/M |
| 3300012207|Ga0137381_11402804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 591 | Open in IMG/M |
| 3300012210|Ga0137378_11747998 | Not Available | 527 | Open in IMG/M |
| 3300012285|Ga0137370_10269860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1011 | Open in IMG/M |
| 3300012353|Ga0137367_10037042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3737 | Open in IMG/M |
| 3300012355|Ga0137369_10571296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 790 | Open in IMG/M |
| 3300012356|Ga0137371_11045260 | Not Available | 617 | Open in IMG/M |
| 3300012361|Ga0137360_10292476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1350 | Open in IMG/M |
| 3300012362|Ga0137361_10772183 | Not Available | 875 | Open in IMG/M |
| 3300012948|Ga0126375_10202877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1304 | Open in IMG/M |
| 3300012958|Ga0164299_10461850 | Not Available | 834 | Open in IMG/M |
| 3300012960|Ga0164301_10505055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 873 | Open in IMG/M |
| 3300012961|Ga0164302_10018215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 2976 | Open in IMG/M |
| 3300012971|Ga0126369_10278489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1662 | Open in IMG/M |
| 3300012971|Ga0126369_10693000 | Not Available | 1095 | Open in IMG/M |
| 3300016270|Ga0182036_10897182 | Not Available | 726 | Open in IMG/M |
| 3300016341|Ga0182035_10942236 | Not Available | 763 | Open in IMG/M |
| 3300016357|Ga0182032_11399813 | Not Available | 605 | Open in IMG/M |
| 3300016371|Ga0182034_10540099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300016371|Ga0182034_10978593 | Not Available | 730 | Open in IMG/M |
| 3300016371|Ga0182034_11063993 | Not Available | 700 | Open in IMG/M |
| 3300016422|Ga0182039_10696377 | Not Available | 895 | Open in IMG/M |
| 3300018431|Ga0066655_10342834 | Not Available | 979 | Open in IMG/M |
| 3300018431|Ga0066655_11388656 | Not Available | 509 | Open in IMG/M |
| 3300018433|Ga0066667_10097679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1945 | Open in IMG/M |
| 3300018433|Ga0066667_10301438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300018433|Ga0066667_11498207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300018433|Ga0066667_11631947 | Not Available | 576 | Open in IMG/M |
| 3300018468|Ga0066662_12283445 | Not Available | 568 | Open in IMG/M |
| 3300018482|Ga0066669_10546174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300020580|Ga0210403_10760981 | Not Available | 772 | Open in IMG/M |
| 3300021372|Ga0213877_10123097 | Not Available | 804 | Open in IMG/M |
| 3300021479|Ga0210410_11581915 | Not Available | 549 | Open in IMG/M |
| 3300021560|Ga0126371_10460009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1419 | Open in IMG/M |
| 3300021560|Ga0126371_10651683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1202 | Open in IMG/M |
| 3300021560|Ga0126371_11008890 | Not Available | 974 | Open in IMG/M |
| 3300021560|Ga0126371_11240788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 881 | Open in IMG/M |
| 3300025885|Ga0207653_10005704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3884 | Open in IMG/M |
| 3300025922|Ga0207646_11215630 | Not Available | 660 | Open in IMG/M |
| 3300026304|Ga0209240_1066802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1341 | Open in IMG/M |
| 3300026313|Ga0209761_1174279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 986 | Open in IMG/M |
| 3300026319|Ga0209647_1015240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4963 | Open in IMG/M |
| 3300026319|Ga0209647_1092123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1466 | Open in IMG/M |
| 3300026326|Ga0209801_1351722 | Not Available | 519 | Open in IMG/M |
| 3300026482|Ga0257172_1090975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
| 3300027874|Ga0209465_10360578 | Not Available | 728 | Open in IMG/M |
| 3300027882|Ga0209590_10246635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1139 | Open in IMG/M |
| 3300027903|Ga0209488_10570573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 823 | Open in IMG/M |
| 3300027909|Ga0209382_10653428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1137 | Open in IMG/M |
| 3300028784|Ga0307282_10484905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300031544|Ga0318534_10453966 | Not Available | 734 | Open in IMG/M |
| 3300031545|Ga0318541_10103375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1531 | Open in IMG/M |
| 3300031545|Ga0318541_10404923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300031546|Ga0318538_10176644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1135 | Open in IMG/M |
| 3300031573|Ga0310915_10249208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1249 | Open in IMG/M |
| 3300031640|Ga0318555_10142672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1280 | Open in IMG/M |
| 3300031640|Ga0318555_10207934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1055 | Open in IMG/M |
| 3300031668|Ga0318542_10045937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1963 | Open in IMG/M |
| 3300031668|Ga0318542_10112407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1325 | Open in IMG/M |
| 3300031668|Ga0318542_10334636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300031668|Ga0318542_10554701 | Not Available | 598 | Open in IMG/M |
| 3300031679|Ga0318561_10052768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2039 | Open in IMG/M |
| 3300031681|Ga0318572_10953292 | Not Available | 509 | Open in IMG/M |
| 3300031682|Ga0318560_10141434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1269 | Open in IMG/M |
| 3300031682|Ga0318560_10402679 | Not Available | 740 | Open in IMG/M |
| 3300031682|Ga0318560_10734157 | Not Available | 533 | Open in IMG/M |
| 3300031719|Ga0306917_10005103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7009 | Open in IMG/M |
| 3300031723|Ga0318493_10030401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2451 | Open in IMG/M |
| 3300031723|Ga0318493_10075492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1651 | Open in IMG/M |
| 3300031747|Ga0318502_10188603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1189 | Open in IMG/M |
| 3300031763|Ga0318537_10379253 | Not Available | 521 | Open in IMG/M |
| 3300031765|Ga0318554_10108829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1560 | Open in IMG/M |
| 3300031771|Ga0318546_10258975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1198 | Open in IMG/M |
| 3300031792|Ga0318529_10113643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1229 | Open in IMG/M |
| 3300031793|Ga0318548_10090859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1452 | Open in IMG/M |
| 3300031798|Ga0318523_10028256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2520 | Open in IMG/M |
| 3300031799|Ga0318565_10069498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1660 | Open in IMG/M |
| 3300031805|Ga0318497_10286438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 916 | Open in IMG/M |
| 3300031821|Ga0318567_10034250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2549 | Open in IMG/M |
| 3300031832|Ga0318499_10343090 | Not Available | 574 | Open in IMG/M |
| 3300031845|Ga0318511_10093970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1268 | Open in IMG/M |
| 3300031846|Ga0318512_10047116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1911 | Open in IMG/M |
| 3300031879|Ga0306919_10053639 | Not Available | 2681 | Open in IMG/M |
| 3300031879|Ga0306919_10165140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1625 | Open in IMG/M |
| 3300031896|Ga0318551_10032348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2543 | Open in IMG/M |
| 3300031896|Ga0318551_10148663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1277 | Open in IMG/M |
| 3300031910|Ga0306923_11281382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300031941|Ga0310912_10238818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1396 | Open in IMG/M |
| 3300031941|Ga0310912_10726000 | Not Available | 769 | Open in IMG/M |
| 3300031942|Ga0310916_10451085 | Not Available | 1095 | Open in IMG/M |
| 3300031946|Ga0310910_10219648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1478 | Open in IMG/M |
| 3300032041|Ga0318549_10109044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1212 | Open in IMG/M |
| 3300032044|Ga0318558_10112305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici | 1285 | Open in IMG/M |
| 3300032051|Ga0318532_10059524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1319 | Open in IMG/M |
| 3300032051|Ga0318532_10293331 | Not Available | 577 | Open in IMG/M |
| 3300032055|Ga0318575_10147635 | Not Available | 1167 | Open in IMG/M |
| 3300032055|Ga0318575_10197606 | Not Available | 1009 | Open in IMG/M |
| 3300032059|Ga0318533_10039846 | Not Available | 3087 | Open in IMG/M |
| 3300032059|Ga0318533_10666645 | Not Available | 763 | Open in IMG/M |
| 3300032060|Ga0318505_10075080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1496 | Open in IMG/M |
| 3300032066|Ga0318514_10269074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300032089|Ga0318525_10297940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 828 | Open in IMG/M |
| 3300032091|Ga0318577_10269919 | Not Available | 814 | Open in IMG/M |
| 3300032094|Ga0318540_10004453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5038 | Open in IMG/M |
| 3300032261|Ga0306920_100058047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5641 | Open in IMG/M |
| 3300033290|Ga0318519_10543988 | Not Available | 702 | Open in IMG/M |
| 3300033290|Ga0318519_10928326 | Not Available | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 30.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 11.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.61% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.23% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.12% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.56% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.56% | |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004629 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome P72I A01 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_00430200 | 2124908016 | GVMLAERVDFCVLAVGFAIAGCWSMVSGAVVVLALRAFGLGVG | |
| KansclcFeb2_07414030 | 2124908045 | Soil | MVAERVDFLVLAIGFAIAGCWSLVSGTVVVLALRAFGIIAG |
| KansclcFeb2_07303100 | 2124908045 | Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| F14TC_1019536562 | 3300000559 | Soil | MVAERVDFLVLAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| AF_2010_repII_A1DRAFT_100312313 | 3300000597 | Forest Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMALRAFGVPVG* |
| AF_2010_repII_A1DRAFT_101424921 | 3300000597 | Forest Soil | HVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| AF_2010_repII_A100DRAFT_10067155 | 3300000655 | Forest Soil | AQRVDVFALAIAFAIAGCWSLVSGAVVVMGLRALGISAG* |
| AF_2010_repII_A100DRAFT_10251392 | 3300000655 | Forest Soil | VIQAGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| AF_2010_repII_A100DRAFT_10491192 | 3300000655 | Forest Soil | MTAQRVDVFSLAIAFAIAGCWSLVSGAVVVLGLRAFGII |
| AF_2010_repII_A001DRAFT_100047142 | 3300000793 | Forest Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVMGLRALGISAG* |
| AF_2010_repII_A001DRAFT_100339802 | 3300000793 | Forest Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVLGLRAFGIIAG* |
| JGI1027J12803_1016460631 | 3300000955 | Soil | FGTSGGDMTAERVDIFALAIGFTIASCWSLVSGAVVVMGLRAFGITAG* |
| JGI12627J18819_101384641 | 3300001867 | Forest Soil | MLAERVDFCALAVGFAIAGCWSMVSGAVVVLALRAFGLGVG* |
| JGI25614J43888_100115635 | 3300002906 | Grasslands Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG* |
| JGI25617J43924_102894712 | 3300002914 | Grasslands Soil | TTGRVDFFALAIGFAISSCWSLVSGAVVVMGLRAFGLVVG* |
| Ga0066396_100274982 | 3300004267 | Tropical Forest Soil | MTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG* |
| Ga0062595_1007157562 | 3300004479 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0008092_113219942 | 3300004629 | Tropical Rainforest Soil | MTVERVDVFALAIAFAIAGCWSLVSGAVVVMGLRAFSIVAG* |
| Ga0066395_107230222 | 3300004633 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSLIGGAIVVMGLRAFGISAG* |
| Ga0066674_102327762 | 3300005166 | Soil | MTTDRVDFFALAIGFAISGCWSLVSGAVVVMGLGAFGLVVG* |
| Ga0066388_1005158013 | 3300005332 | Tropical Forest Soil | MTAEQVEHVFALAIGFAIAGCWSLIGGAIVVMALRAFGISAG* |
| Ga0066388_1020413231 | 3300005332 | Tropical Forest Soil | GLMTAERVDFFALAIGCAIAGCWSMVSGAVVVMALRAFGLAG* |
| Ga0066388_1025361392 | 3300005332 | Tropical Forest Soil | MTTDRVDFFALAIGFAISSCWSLVSGAVVVIGLRAFGLVVG* |
| Ga0066388_1041408732 | 3300005332 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVTGGAIVVMGLRAFGVPVG* |
| Ga0066388_1053264871 | 3300005332 | Tropical Forest Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVMGLRAFGIIAG* |
| Ga0066388_1055242691 | 3300005332 | Tropical Forest Soil | VIRAGRIMTAERVEHVFALAIGFAIAGCWSVTGGAILVMGLRAFGVPVG* |
| Ga0066388_1062220132 | 3300005332 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVAVG* |
| Ga0066388_1062437732 | 3300005332 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0066388_1068560721 | 3300005332 | Tropical Forest Soil | HRGGNMTAERVDTFALAIGFAIAGCWSVVSGAIVVMGLRAFGITVG* |
| Ga0070709_100581855 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLAERVDFCVLAVGFAIAGCWSMVSGAVVVLALRAFGLGVG* |
| Ga0066687_108206301 | 3300005454 | Soil | DIGVGLMTAERVDFFALAIGCAIAGCWSMVSGAVVVMALRAFGLVAG* |
| Ga0070706_1017877892 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAERVEHVFALAIGFAIASCWSLIGGAIVVMGLRAFGISAG* |
| Ga0066695_103006222 | 3300005553 | Soil | MGMGRMVAERVDFLALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0066661_101274193 | 3300005554 | Soil | MGMGRMVAERVGFFALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0066698_105538972 | 3300005558 | Soil | MGMGRMVAERVDFFALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0066905_1001818534 | 3300005713 | Tropical Forest Soil | MTAERVDTFALAIGFAIAGCWSVVSGAIVVMGLRAFGITVG* |
| Ga0066905_1008698462 | 3300005713 | Tropical Forest Soil | EHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0066905_1010714562 | 3300005713 | Tropical Forest Soil | DRVDFFALAIGFAISSCWSLVSGAVVVIGLRAFGLVVG* |
| Ga0066905_1015637791 | 3300005713 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGV |
| Ga0066905_1021803241 | 3300005713 | Tropical Forest Soil | VIRAGRIMTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0066905_1022074912 | 3300005713 | Tropical Forest Soil | VIRAGRIMTAERVEHVFALAIGFAIAGCWSVTGGAIVVMGLRAFGVPVG* |
| Ga0066903_1041602032 | 3300005764 | Tropical Forest Soil | MTAEWVEHVFALAIGFAMAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0066903_1063583122 | 3300005764 | Tropical Forest Soil | MTAERVDHVFALAIGFAIAGCWSLIGGAIVAMWLRAFGISAG* |
| Ga0081455_1000381518 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MVAERVDFLALAIGFAIAGCWSLVSGMVVVLALRAFGILPG* |
| Ga0081455_104630702 | 3300005937 | Tabebuia Heterophylla Rhizosphere | SRGVIRVGRVMTAERVEHVFALAMGFAIAGCWSVICGAIVVMGLRAFGISAG* |
| Ga0070716_1009677232 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAERVDFFALAIGCAIAGCWSMVSGTVVVMALRAFGLVAG* |
| Ga0066660_101951562 | 3300006800 | Soil | MTAEQVEHVFALAIGFAIASCWSLIGGAIVVMGLRAFGISAG* |
| Ga0075425_1019146861 | 3300006854 | Populus Rhizosphere | MTAERVDFVALAIGFAITGCWSLVSGTVVVMGLRAFGITAG* |
| Ga0099827_101307461 | 3300009090 | Vadose Zone Soil | MTEERVDIFALAIGFAIAGCWSLVSGAVVVMGLRAFGITAG* |
| Ga0111539_131564022 | 3300009094 | Populus Rhizosphere | MLAERVDFCVLAVGFAIAVCWSMVSGAVVVLALRAFGLGVG* |
| Ga0075418_101335172 | 3300009100 | Populus Rhizosphere | MVAERVDLLALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0066709_1004759323 | 3300009137 | Grasslands Soil | MTAERVDFFALAIGCAIAGCWSMVSGAVVVMALREFGLVAG* |
| Ga0066709_1018913142 | 3300009137 | Grasslands Soil | MTTDRVDFFALAVGFAISGCWSLVSGAVVVMGLGAFGLVVG* |
| Ga0099792_106899442 | 3300009143 | Vadose Zone Soil | MTWEHGVGVMTAERVDFFALAIGCAIAGCWSMVSGTVVVMALRAFGLVAG* |
| Ga0114129_100643747 | 3300009147 | Populus Rhizosphere | MGRMVAERVDLLALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0114129_106355703 | 3300009147 | Populus Rhizosphere | MGRMVAERVDFFALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0126374_104586001 | 3300009792 | Tropical Forest Soil | MTAERVDFFALAIGCAIAGCWSMVSGAVVVMALRAFGLAAG* |
| Ga0126374_112304711 | 3300009792 | Tropical Forest Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPV |
| Ga0126312_112536202 | 3300010041 | Serpentine Soil | MGRMVAERVDFLVLAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0126380_112523121 | 3300010043 | Tropical Forest Soil | MGRMLAERVDLTALAIGFAIAGCWSLVSGTVLVLALRAFGIIAG* |
| Ga0126384_100666494 | 3300010046 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSLICGAIVVMGLRAFGIAAG* |
| Ga0126384_104317262 | 3300010046 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVTGGAILVMGLRAFGVPVG* |
| Ga0126384_112830551 | 3300010046 | Tropical Forest Soil | MTAERVDFFALAIGCAIAGCWSMVSGAVVVMALRAFGLVAG* |
| Ga0126382_121859711 | 3300010047 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSLIGGAIVVMGLRAFGISVG* |
| Ga0126379_121216201 | 3300010366 | Tropical Forest Soil | MTVERVDVFALAIAFAIAGCWSLVSGAVVVMGLRAFSIV |
| Ga0126379_121484851 | 3300010366 | Tropical Forest Soil | RVDVFALAIAFAIAGCWSLVSGAVVVMGLRAFGISAG* |
| Ga0126381_1012966471 | 3300010376 | Tropical Forest Soil | MTAERVDVFALAIAFSIAGCWSLVSGAVVVMGLRAFSIVAG* |
| Ga0126381_1048605572 | 3300010376 | Tropical Forest Soil | MTAERVDHVFALAIGFAIAGCWSLIGGAIVVMGLRAFGISVG* |
| Ga0126383_125117561 | 3300010398 | Tropical Forest Soil | MTAERVEHVFALVIGFAIAGCWSVTGGAIVVMGLRAFGVPVG* |
| Ga0124850_10115654 | 3300010863 | Tropical Forest Soil | MTAEQVEHVFGLAIGFAIAGCWSVMSGAIVVMALRAFGVPVG* |
| Ga0137382_100151661 | 3300012200 | Vadose Zone Soil | MTAERVDFFALAIGFAIAGCWSMVSGAVVVMALRALSLVAG* |
| Ga0137363_100800995 | 3300012202 | Vadose Zone Soil | MTTGRVDFFALAIGFAISSCWSQVSGAVVVMGLRAFGLVVG* |
| Ga0137362_117086681 | 3300012205 | Vadose Zone Soil | MTTGRVDFFALAIGFAISSCWSLVSGAVVVMGLRAFGLVVG* |
| Ga0137381_114028042 | 3300012207 | Vadose Zone Soil | MTAERVDIFALAIGFAIAGCWSLVSGAVVVMGLRAFGITAG* |
| Ga0137378_117479981 | 3300012210 | Vadose Zone Soil | QTGLFEGGVMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG* |
| Ga0137370_102698601 | 3300012285 | Vadose Zone Soil | ERVDFFALAIGFAIAGCWSMVSGAVVVMALRALSLVAG* |
| Ga0137367_100370422 | 3300012353 | Vadose Zone Soil | MGMGRMIAERVDFLALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG* |
| Ga0137369_105712962 | 3300012355 | Vadose Zone Soil | MTAERVEHVFTLAVGFAIASCWSLIGGAIVVMGLRAFGISAG* |
| Ga0137371_110452601 | 3300012356 | Vadose Zone Soil | MTTDRVDFFALAIGFAISGCWSLVSGAVVVMGLGAFGLGVG* |
| Ga0137360_102924763 | 3300012361 | Vadose Zone Soil | VEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG* |
| Ga0137361_107721831 | 3300012362 | Vadose Zone Soil | MTTDRVDYFALAIGFAISSCWSLVSGAVVVMGLRTFGLGVG* |
| Ga0126375_102028772 | 3300012948 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAILVMGLRAFGVPVG* |
| Ga0164299_104618501 | 3300012958 | Soil | EGGVMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG* |
| Ga0164301_105050552 | 3300012960 | Soil | MLAERVDFCVLAVGFAIAGCWSMISGAVVVLALRAFGLGVG* |
| Ga0164302_100182151 | 3300012961 | Soil | MLAERVDFCVLAVGFAIAGCWSMVSGAVVVLALRAFGLG |
| Ga0126369_102784893 | 3300012971 | Tropical Forest Soil | MTAERVDHVFALAIGFAIAGCWSLIGGAIVVMGLRAFGISAG* |
| Ga0126369_106930001 | 3300012971 | Tropical Forest Soil | RIMTAEPVEHVFALAIGFAIAGCWSVMSGAIVVMALRAFGVPVG* |
| Ga0182036_108971821 | 3300016270 | Soil | RIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0182035_109422361 | 3300016341 | Soil | MTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRA |
| Ga0182032_113998131 | 3300016357 | Soil | AERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0182034_105400992 | 3300016371 | Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVLGLRAFG |
| Ga0182034_109785932 | 3300016371 | Soil | GRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0182034_110639931 | 3300016371 | Soil | VIRAGRIMTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRA |
| Ga0182039_106963771 | 3300016422 | Soil | MTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRA |
| Ga0066655_103428342 | 3300018431 | Grasslands Soil | MTTDRVDFFALAIGFAISGCWSLVSGAVVVMGLEAFGLVVG |
| Ga0066655_113886561 | 3300018431 | Grasslands Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLR |
| Ga0066667_100976794 | 3300018433 | Grasslands Soil | MTTDRVDFFALAIGFAISGCWSLVSGAVVVMGLGAFGLVVG |
| Ga0066667_103014383 | 3300018433 | Grasslands Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0066667_114982072 | 3300018433 | Grasslands Soil | MTTDRVDFFALAVGFAISGCWSLVSGAVVVMGLGAFGLVVG |
| Ga0066667_116319472 | 3300018433 | Grasslands Soil | MGMGRMVAERVDFFALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG |
| Ga0066662_122834451 | 3300018468 | Grasslands Soil | MTAERVEHVFALAIGFAIASCWSLIGGAIVVMGLRAFGISAG |
| Ga0066669_105461742 | 3300018482 | Grasslands Soil | MTAERVDFFALAIGCAIAGCWSMVSGAVVVMALRAFGLVAG |
| Ga0210403_107609812 | 3300020580 | Soil | MTAERVDFFALAIGCAIAGCWSMVSGTVVVMALRAFGLVAG |
| Ga0213877_101230971 | 3300021372 | Bulk Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFG |
| Ga0210410_115819152 | 3300021479 | Soil | MTAEQVEHVFALAVGLALAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0126371_104600091 | 3300021560 | Tropical Forest Soil | MTTDRVDFFALAIGFAISSCWSLVSGAVVVIGLRAFGLVVG |
| Ga0126371_106516832 | 3300021560 | Tropical Forest Soil | MTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0126371_110088901 | 3300021560 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSVTGGAIVVMGLRAFGVPVG |
| Ga0126371_112407882 | 3300021560 | Tropical Forest Soil | MTAERVDHVFALAIGFAIAGCWSLIGGAIVVMGLRAFGISAG |
| Ga0207653_100057044 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MTAEQVEHVFSLAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0207646_112156301 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0209240_10668023 | 3300026304 | Grasslands Soil | MTTDRVDYFALAIGFAISSCWSLVSGAVVVMGLRTFGLGVG |
| Ga0209761_11742792 | 3300026313 | Grasslands Soil | LIQHNVAWRVDFFALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG |
| Ga0209647_10152407 | 3300026319 | Grasslands Soil | MTEERVDIFALAIGFAIAGCWSLVSGAVVVMGLRAFGITAG |
| Ga0209647_10921233 | 3300026319 | Grasslands Soil | MTTGRVDFFALAIGFAISSCWSLVSGAVVVMGLRAFGLVVG |
| Ga0209801_13517221 | 3300026326 | Soil | VMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0257172_10909752 | 3300026482 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVS |
| Ga0209465_103605781 | 3300027874 | Tropical Forest Soil | MTAERVEHVFALAIGFAIAGCWSLIGAAIVVMGLRAFGISAG |
| Ga0209590_102466353 | 3300027882 | Vadose Zone Soil | MTAERVDIFALAIGFAIAGCWSLVSGAVVVMGLRAFGITAG |
| Ga0209488_105705732 | 3300027903 | Vadose Zone Soil | MTWEHGVGVMTAERVDFFALAIGCAIAGCWSMVSGTVVVMALRAFGLVAG |
| Ga0209382_106534282 | 3300027909 | Populus Rhizosphere | MGRMVAERVDLLALAIGFAIAGCWSLVSGTVVVLALRAFGIIAG |
| Ga0307282_104849052 | 3300028784 | Soil | MLAERVDFCALAVGFAIAGCWSMVSGAVVVLALRAFSLGVG |
| Ga0318534_104539661 | 3300031544 | Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVLGLRAFGIIAG |
| Ga0318541_101033751 | 3300031545 | Soil | EQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318541_104049232 | 3300031545 | Soil | MTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318538_101766443 | 3300031546 | Soil | VEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0310915_102492081 | 3300031573 | Soil | GRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318555_101426721 | 3300031640 | Soil | GRIMTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318555_102079343 | 3300031640 | Soil | IMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318542_100459371 | 3300031668 | Soil | ERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318542_101124073 | 3300031668 | Soil | TAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318542_103346361 | 3300031668 | Soil | MTAEQVEHVFALAIGFAIAGCWSVVSGAIVVMGLRAFGVPVG |
| Ga0318542_105547011 | 3300031668 | Soil | VEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318561_100527683 | 3300031679 | Soil | IMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318572_109532922 | 3300031681 | Soil | AGRIMTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318560_101414343 | 3300031682 | Soil | IRAGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318560_104026792 | 3300031682 | Soil | IRAGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318560_107341572 | 3300031682 | Soil | AEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0306917_100051031 | 3300031719 | Soil | RVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318493_100304014 | 3300031723 | Soil | LIRAGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318493_100754923 | 3300031723 | Soil | AERVERVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318502_101886031 | 3300031747 | Soil | IMTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318537_103792531 | 3300031763 | Soil | TAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318554_101088291 | 3300031765 | Soil | RAGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318546_102589753 | 3300031771 | Soil | GRVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318529_101136433 | 3300031792 | Soil | IMTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318548_100908593 | 3300031793 | Soil | HVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318523_100282564 | 3300031798 | Soil | RAGRIMTAERVERVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318565_100694983 | 3300031799 | Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318497_102864382 | 3300031805 | Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVP |
| Ga0318567_100342501 | 3300031821 | Soil | MTAERVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFG |
| Ga0318499_103430901 | 3300031832 | Soil | RAGRVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318511_100939703 | 3300031845 | Soil | AEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318512_100471161 | 3300031846 | Soil | RIMTAERVERVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0306919_100536394 | 3300031879 | Soil | AERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0306919_101651401 | 3300031879 | Soil | EQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVSVG |
| Ga0318551_100323481 | 3300031896 | Soil | MTAERVERVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318551_101486631 | 3300031896 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGV |
| Ga0306923_112813822 | 3300031910 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRA |
| Ga0310912_102388181 | 3300031941 | Soil | MTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFG |
| Ga0310912_107260001 | 3300031941 | Soil | MTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAF |
| Ga0310916_104510852 | 3300031942 | Soil | VIRAGRIMTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFG |
| Ga0310910_102196481 | 3300031946 | Soil | SKGGVMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318549_101090443 | 3300032041 | Soil | VIQAGRVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318558_101123051 | 3300032044 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVP |
| Ga0318532_100595242 | 3300032051 | Soil | MTAERVEDVFVLAIGFANVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318532_102933312 | 3300032051 | Soil | AGRIMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318575_101476351 | 3300032055 | Soil | MTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318575_101976061 | 3300032055 | Soil | VIRAGRVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAFGVPVG |
| Ga0318533_100398463 | 3300032059 | Soil | MTAEQGEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318533_106666451 | 3300032059 | Soil | MTTEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLR |
| Ga0318505_100750801 | 3300032060 | Soil | NGVIRRGGVMTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0318514_102690742 | 3300032066 | Soil | MTAEQVEHVFALAIGFAIAGCWSVMSGAIVVMGLSAFGV |
| Ga0318525_102979401 | 3300032089 | Soil | MTAERVERVFALAIGFAIAGCWSVMSGAIVVMGLRA |
| Ga0318577_102699191 | 3300032091 | Soil | VIRAGRIMTTEQVEHVFALAIGFAIAGCWSVMSGAIVV |
| Ga0318540_100044534 | 3300032094 | Soil | MTAERVEQVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| Ga0306920_1000580471 | 3300032261 | Soil | VIQAGRVMTAERVEDVFVLAIGFAIVGCWSVMSGVIVVMGLRAF |
| Ga0318519_105439881 | 3300033290 | Soil | MTAQRVDVFALAIAFAIAGCWSLVSGAVVVLGAFGIIAG |
| Ga0318519_109283262 | 3300033290 | Soil | VIRAGLIMTAERVERVFALAIGFAIAGCWSVMSGAIVVMGLRAFGVPVG |
| ⦗Top⦘ |