


| Basic Information | |
|---|---|
| Family ID | F032747 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 40 residues |
| Representative Sequence | RIERKQVDASANQQPKRFVQNTLASRTLTALPGEVFV |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.12 % |
| % of genes near scaffold ends (potentially truncated) | 98.32 % |
| % of genes from short scaffolds (< 2000 bps) | 88.83 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.095 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (8.939 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.553 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.397 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF00076 | RRM_1 | 14.53 |
| PF01165 | Ribosomal_S21 | 3.91 |
| PF00312 | Ribosomal_S15 | 2.79 |
| PF01757 | Acyl_transf_3 | 2.23 |
| PF02687 | FtsX | 2.23 |
| PF00282 | Pyridoxal_deC | 1.12 |
| PF00665 | rve | 1.12 |
| PF13517 | FG-GAP_3 | 1.12 |
| PF00313 | CSD | 1.12 |
| PF00990 | GGDEF | 1.12 |
| PF03725 | RNase_PH_C | 1.12 |
| PF02739 | 5_3_exonuc_N | 1.12 |
| PF02812 | ELFV_dehydrog_N | 0.56 |
| PF02567 | PhzC-PhzF | 0.56 |
| PF04055 | Radical_SAM | 0.56 |
| PF00578 | AhpC-TSA | 0.56 |
| PF13620 | CarboxypepD_reg | 0.56 |
| PF00270 | DEAD | 0.56 |
| PF00271 | Helicase_C | 0.56 |
| PF12686 | DUF3800 | 0.56 |
| PF14279 | HNH_5 | 0.56 |
| PF01850 | PIN | 0.56 |
| PF00150 | Cellulase | 0.56 |
| PF03965 | Penicillinase_R | 0.56 |
| PF00324 | AA_permease | 0.56 |
| PF00166 | Cpn10 | 0.56 |
| PF00691 | OmpA | 0.56 |
| PF07819 | PGAP1 | 0.56 |
| PF14534 | DUF4440 | 0.56 |
| PF13520 | AA_permease_2 | 0.56 |
| PF00999 | Na_H_Exchanger | 0.56 |
| PF10017 | Methyltransf_33 | 0.56 |
| PF12704 | MacB_PCD | 0.56 |
| PF01834 | XRCC1_N | 0.56 |
| PF00724 | Oxidored_FMN | 0.56 |
| PF01098 | FTSW_RODA_SPOVE | 0.56 |
| PF04545 | Sigma70_r4 | 0.56 |
| PF04892 | VanZ | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0828 | Ribosomal protein S21 | Translation, ribosomal structure and biogenesis [J] | 3.91 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 2.79 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 1.12 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 1.12 |
| COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 1.12 |
| COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 1.12 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.12 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.12 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.12 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.12 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.56 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 0.56 |
| COG0384 | Predicted epimerase YddE/YHI9, PhzF superfamily | General function prediction only [R] | 0.56 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.56 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.56 |
| COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.56 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.56 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.56 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.56 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.56 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.56 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.56 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.56 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.56 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.56 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.56 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.09 % |
| Unclassified | root | N/A | 22.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0701075 | All Organisms → cellular organisms → Bacteria | 3990 | Open in IMG/M |
| 3300000546|LJNas_1000078 | All Organisms → cellular organisms → Bacteria | 13873 | Open in IMG/M |
| 3300003324|soilH2_10134036 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300003370|JGI26337J50220_1033280 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300004081|Ga0063454_101006108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 671 | Open in IMG/M |
| 3300004104|Ga0058891_1547944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1807 | Open in IMG/M |
| 3300004139|Ga0058897_10812001 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300004157|Ga0062590_100454762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300004598|Ga0068975_1229962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 600 | Open in IMG/M |
| 3300005177|Ga0066690_10430376 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300005332|Ga0066388_105139749 | Not Available | 664 | Open in IMG/M |
| 3300005340|Ga0070689_100912404 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300005366|Ga0070659_100053389 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3181 | Open in IMG/M |
| 3300005435|Ga0070714_100557357 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300005437|Ga0070710_11029431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300005454|Ga0066687_10133991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1293 | Open in IMG/M |
| 3300005518|Ga0070699_101369676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300005533|Ga0070734_10245355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1027 | Open in IMG/M |
| 3300005538|Ga0070731_11114207 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005575|Ga0066702_10666083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 621 | Open in IMG/M |
| 3300005610|Ga0070763_10463343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 721 | Open in IMG/M |
| 3300005610|Ga0070763_10569755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 654 | Open in IMG/M |
| 3300005712|Ga0070764_10585302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
| 3300005841|Ga0068863_101548072 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005841|Ga0068863_101987276 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005921|Ga0070766_10042684 | All Organisms → cellular organisms → Bacteria | 2520 | Open in IMG/M |
| 3300005921|Ga0070766_10042711 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300006028|Ga0070717_12061611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 513 | Open in IMG/M |
| 3300006032|Ga0066696_10551622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 753 | Open in IMG/M |
| 3300006041|Ga0075023_100100340 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300006086|Ga0075019_10444414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 798 | Open in IMG/M |
| 3300006102|Ga0075015_100296088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300006162|Ga0075030_100849285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006175|Ga0070712_100494645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1024 | Open in IMG/M |
| 3300006755|Ga0079222_12037402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300006796|Ga0066665_10847018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300006864|Ga0066797_1185678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 726 | Open in IMG/M |
| 3300006893|Ga0073928_10220284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1471 | Open in IMG/M |
| 3300006914|Ga0075436_100407948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 985 | Open in IMG/M |
| 3300007076|Ga0075435_101202239 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300007258|Ga0099793_10526445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 589 | Open in IMG/M |
| 3300009038|Ga0099829_10859243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300009093|Ga0105240_11205493 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300009143|Ga0099792_11123199 | Not Available | 530 | Open in IMG/M |
| 3300009148|Ga0105243_12968458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300009177|Ga0105248_10649069 | Not Available | 1191 | Open in IMG/M |
| 3300009500|Ga0116229_10368605 | Not Available | 1203 | Open in IMG/M |
| 3300009519|Ga0116108_1078778 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1013 | Open in IMG/M |
| 3300009520|Ga0116214_1130986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 929 | Open in IMG/M |
| 3300009524|Ga0116225_1220584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 854 | Open in IMG/M |
| 3300009553|Ga0105249_12469213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300009616|Ga0116111_1116356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 660 | Open in IMG/M |
| 3300009623|Ga0116133_1138326 | Not Available | 634 | Open in IMG/M |
| 3300009623|Ga0116133_1176406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 568 | Open in IMG/M |
| 3300009624|Ga0116105_1075343 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300009630|Ga0116114_1154227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 585 | Open in IMG/M |
| 3300009634|Ga0116124_1157483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 634 | Open in IMG/M |
| 3300009646|Ga0116132_1057209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300009646|Ga0116132_1117784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 813 | Open in IMG/M |
| 3300009698|Ga0116216_10252157 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300010343|Ga0074044_10955610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 561 | Open in IMG/M |
| 3300010360|Ga0126372_12519720 | Not Available | 565 | Open in IMG/M |
| 3300010366|Ga0126379_11807879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 715 | Open in IMG/M |
| 3300010371|Ga0134125_10015491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8522 | Open in IMG/M |
| 3300010371|Ga0134125_10218780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2117 | Open in IMG/M |
| 3300010376|Ga0126381_102046614 | Not Available | 825 | Open in IMG/M |
| 3300010379|Ga0136449_100431192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2323 | Open in IMG/M |
| 3300010396|Ga0134126_12594272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300010399|Ga0134127_10333296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1475 | Open in IMG/M |
| 3300011120|Ga0150983_12686959 | Not Available | 563 | Open in IMG/M |
| 3300011271|Ga0137393_11595829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300012010|Ga0120118_1065694 | Not Available | 899 | Open in IMG/M |
| 3300012208|Ga0137376_10523660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1028 | Open in IMG/M |
| 3300012357|Ga0137384_10617791 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300012357|Ga0137384_10798042 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012918|Ga0137396_10565605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 842 | Open in IMG/M |
| 3300012930|Ga0137407_11814715 | Not Available | 581 | Open in IMG/M |
| 3300012957|Ga0164303_11479904 | Not Available | 512 | Open in IMG/M |
| 3300013296|Ga0157374_10491707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1231 | Open in IMG/M |
| 3300014159|Ga0181530_10169009 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300014501|Ga0182024_11407877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 802 | Open in IMG/M |
| 3300014501|Ga0182024_12609026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 542 | Open in IMG/M |
| 3300014654|Ga0181525_10060721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2133 | Open in IMG/M |
| 3300014969|Ga0157376_10299619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300015371|Ga0132258_11750660 | Not Available | 1567 | Open in IMG/M |
| 3300016422|Ga0182039_11740745 | Not Available | 571 | Open in IMG/M |
| 3300016702|Ga0181511_1286273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 661 | Open in IMG/M |
| 3300017935|Ga0187848_10234342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 779 | Open in IMG/M |
| 3300017941|Ga0187850_10171898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1006 | Open in IMG/M |
| 3300017946|Ga0187879_10594732 | Not Available | 615 | Open in IMG/M |
| 3300017961|Ga0187778_10253186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1131 | Open in IMG/M |
| 3300017995|Ga0187816_10527029 | Not Available | 533 | Open in IMG/M |
| 3300017999|Ga0187767_10146223 | Not Available | 703 | Open in IMG/M |
| 3300018037|Ga0187883_10062353 | Not Available | 1964 | Open in IMG/M |
| 3300018037|Ga0187883_10215516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 984 | Open in IMG/M |
| 3300018038|Ga0187855_10364774 | Not Available | 843 | Open in IMG/M |
| 3300018043|Ga0187887_10810814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 554 | Open in IMG/M |
| 3300018044|Ga0187890_10542051 | Not Available | 655 | Open in IMG/M |
| 3300018062|Ga0187784_10396815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
| 3300018086|Ga0187769_10007880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 6668 | Open in IMG/M |
| 3300018433|Ga0066667_10699199 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 851 | Open in IMG/M |
| 3300019278|Ga0187800_1544838 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 584 | Open in IMG/M |
| 3300019786|Ga0182025_1094824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300019787|Ga0182031_1221658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1770 | Open in IMG/M |
| 3300019787|Ga0182031_1402371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1226 | Open in IMG/M |
| 3300021168|Ga0210406_11373045 | Not Available | 506 | Open in IMG/M |
| 3300021171|Ga0210405_11294084 | Not Available | 536 | Open in IMG/M |
| 3300021180|Ga0210396_10915137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300021362|Ga0213882_10538840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300021401|Ga0210393_10584827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
| 3300021401|Ga0210393_11073420 | Not Available | 650 | Open in IMG/M |
| 3300021401|Ga0210393_11534818 | Not Available | 529 | Open in IMG/M |
| 3300021406|Ga0210386_10133989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
| 3300021407|Ga0210383_10383344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1212 | Open in IMG/M |
| 3300021407|Ga0210383_10706827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 866 | Open in IMG/M |
| 3300021432|Ga0210384_11667094 | Not Available | 543 | Open in IMG/M |
| 3300021478|Ga0210402_10082732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2858 | Open in IMG/M |
| 3300021559|Ga0210409_10299002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300021559|Ga0210409_11544136 | Not Available | 540 | Open in IMG/M |
| 3300022557|Ga0212123_10297174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1131 | Open in IMG/M |
| 3300022721|Ga0242666_1034316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300022731|Ga0224563_1024114 | Not Available | 548 | Open in IMG/M |
| 3300025477|Ga0208192_1077603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 617 | Open in IMG/M |
| 3300025500|Ga0208686_1046991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1018 | Open in IMG/M |
| 3300025501|Ga0208563_1088580 | Not Available | 607 | Open in IMG/M |
| 3300025913|Ga0207695_11666542 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300025928|Ga0207700_10358327 | Not Available | 1271 | Open in IMG/M |
| 3300025934|Ga0207686_10125226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1755 | Open in IMG/M |
| 3300025935|Ga0207709_11765705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300026088|Ga0207641_11915492 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026281|Ga0209863_10069013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300026322|Ga0209687_1053586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
| 3300026329|Ga0209375_1131516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300026547|Ga0209156_10065175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1883 | Open in IMG/M |
| 3300026550|Ga0209474_10545875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300026998|Ga0208369_1030770 | Not Available | 531 | Open in IMG/M |
| 3300027432|Ga0209421_1020496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300027575|Ga0209525_1129060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 587 | Open in IMG/M |
| 3300027590|Ga0209116_1139682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 528 | Open in IMG/M |
| 3300027633|Ga0208988_1029014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300027643|Ga0209076_1163607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 619 | Open in IMG/M |
| 3300027745|Ga0209908_10049635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300027768|Ga0209772_10039125 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300027824|Ga0209040_10309577 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300027825|Ga0209039_10138566 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1020 | Open in IMG/M |
| 3300027826|Ga0209060_10252841 | Not Available | 807 | Open in IMG/M |
| 3300027826|Ga0209060_10268531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 781 | Open in IMG/M |
| 3300027879|Ga0209169_10562385 | Not Available | 597 | Open in IMG/M |
| 3300027911|Ga0209698_10358305 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300027911|Ga0209698_10889273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300028536|Ga0137415_10647554 | Not Available | 868 | Open in IMG/M |
| 3300028759|Ga0302224_10322465 | Not Available | 622 | Open in IMG/M |
| 3300028779|Ga0302266_10162740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 867 | Open in IMG/M |
| 3300028906|Ga0308309_10665587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 904 | Open in IMG/M |
| 3300029903|Ga0247271_106188 | Not Available | 2053 | Open in IMG/M |
| 3300029999|Ga0311339_11607472 | Not Available | 573 | Open in IMG/M |
| 3300030000|Ga0311337_10599195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300030020|Ga0311344_11365281 | Not Available | 522 | Open in IMG/M |
| 3300030520|Ga0311372_11544168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
| 3300031057|Ga0170834_102370049 | Not Available | 938 | Open in IMG/M |
| 3300031258|Ga0302318_10455340 | Not Available | 648 | Open in IMG/M |
| 3300031421|Ga0308194_10198497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300031521|Ga0311364_10979698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031708|Ga0310686_105631439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4048 | Open in IMG/M |
| 3300031708|Ga0310686_111378277 | Not Available | 3163 | Open in IMG/M |
| 3300031708|Ga0310686_113227347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6040 | Open in IMG/M |
| 3300031719|Ga0306917_10733413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 776 | Open in IMG/M |
| 3300031720|Ga0307469_10224698 | Not Available | 1488 | Open in IMG/M |
| 3300031747|Ga0318502_10062428 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300031754|Ga0307475_10254218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
| 3300031770|Ga0318521_10036969 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300032160|Ga0311301_10963449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1136 | Open in IMG/M |
| 3300032174|Ga0307470_10281274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300032261|Ga0306920_102091683 | Not Available | 790 | Open in IMG/M |
| 3300032515|Ga0348332_14052277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1989 | Open in IMG/M |
| 3300032895|Ga0335074_10027182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8045 | Open in IMG/M |
| 3300033405|Ga0326727_10990782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 614 | Open in IMG/M |
| 3300033412|Ga0310810_10109588 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3280 | Open in IMG/M |
| 3300033433|Ga0326726_10168896 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.15% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.91% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.35% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.23% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.23% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.23% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.12% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.12% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.12% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.12% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.56% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.56% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.56% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.56% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.56% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004598 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009500 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_07010755 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | LKMERLQTDAVMTRAPRQTIHNTLISRTLTALPGEVFV* |
| LJNas_100007816 | 3300000546 | Quercus Rhizosphere | RIERKQVDWANAEKSAHVVQNTLASRTLTRLPGEVFA* |
| soilH2_101340362 | 3300003324 | Sugarcane Root And Bulk Soil | KLRIERRQMDASGVEQPKRLVQNTLASRTLTALPGEVFV* |
| JGI26337J50220_10332801 | 3300003370 | Bog Forest Soil | LKLRIERKQVDWSNAERRESAVQNTLASRTLTKLPGEVFA* |
| Ga0063454_1010061082 | 3300004081 | Soil | KLRMDRKQLDASGAEQPKRVVQNTLATRTLTALPGEIFV* |
| Ga0058891_15479441 | 3300004104 | Forest Soil | ERALKLRIERKQIDPGTEPPRRFVENTLASRTLTALPGEVFV* |
| Ga0058897_108120015 | 3300004139 | Forest Soil | LKLRIERVQITASAVDVSRRIIQNTLASRTLTALPGEVFG* |
| Ga0062590_1004547621 | 3300004157 | Soil | ELRTIERALQLRIERVQMESSAYDGPKRIVQNTLASRTLTALPGEVFV* |
| Ga0068975_12299621 | 3300004598 | Peatlands Soil | LKLRIERKQVDASASEQRPKRFVENTLASRTLTALPGEVFV* |
| Ga0066690_104303763 | 3300005177 | Soil | RLRIERTELNPSAAQRPKRFIENTLATRTLTALPGEVFV* |
| Ga0066388_1051397491 | 3300005332 | Tropical Forest Soil | ERALKLRIERVETDPTTAGRPRQTLQNTLASRTLTALPGEVFV* |
| Ga0070689_1009124041 | 3300005340 | Switchgrass Rhizosphere | LELRNIERALQLKIERGQMRSDGVPRRLIQNTLASRTLTALPGEVFV* |
| Ga0070659_1000533896 | 3300005366 | Corn Rhizosphere | LTLQMERGQPDVSNTTSAERFVQNTLASRTLTALPGEVFV* |
| Ga0070714_1005573571 | 3300005435 | Agricultural Soil | ERTLQMRMERKQLDNSADPSRVRVVQNTLASRTLTALPGEVFI* |
| Ga0070710_110294311 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QLRIERMQLDGSGSSRPKPVVQNTLASRTLTALPGEVFV* |
| Ga0066687_101339911 | 3300005454 | Soil | ERKLQLRIERLQLDGSVSVRPKPVIQNTLASRTLTALPGEVFV* |
| Ga0070699_1013696761 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLRMERKQIDADNMAQPRRFVQNTLASRTLTALPGEVFV* |
| Ga0070734_102453551 | 3300005533 | Surface Soil | LKIERLQADTAMAGPPRRMIQNTLASRTLTALPGEVFV* |
| Ga0070731_111142073 | 3300005538 | Surface Soil | LKLKIERRQIDTEGLEQPRRAIQNTLASRTLTALPGEVFV* |
| Ga0066702_106660831 | 3300005575 | Soil | LRAIERALKLRMERKQMDASAAEQPKRIIQNTLATRTLTALPGEVFV* |
| Ga0070763_104633433 | 3300005610 | Soil | IERALKLKIERKQVDWANAGKSEHVVQNTLASRTLTRLPGEVFA* |
| Ga0070763_105697551 | 3300005610 | Soil | ERMQMDPSGATQPRRSVQNTLASRTLTALPGEVFV* |
| Ga0070764_105853022 | 3300005712 | Soil | RALKLRIERKQVDWSGIQRPAHVVQNTLASRTLTKLPGEIFA* |
| Ga0068863_1015480721 | 3300005841 | Switchgrass Rhizosphere | ERRQFDPASSLPRRTVQNTLASRTLTALPGEVFV* |
| Ga0068863_1019872761 | 3300005841 | Switchgrass Rhizosphere | IERGQMRSDGVPRRLIQNTLASRTLTALPGEVFV* |
| Ga0070766_100426841 | 3300005921 | Soil | QLKIERKQTQVATDAPSRRMIQNTLASRTLTALPGEVFV* |
| Ga0070766_100427111 | 3300005921 | Soil | IERKQIGTATDAPPKRTIQNTLASRTLTAMPGEVFV* |
| Ga0070717_120616111 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | RIERMQIDASGATQPKRNVQNTLASRTLTALPGEVFV* |
| Ga0066696_105516222 | 3300006032 | Soil | RKQLDLSVVEQSRIRVVQNTLASRTLTALPGEVFI* |
| Ga0075023_1001003403 | 3300006041 | Watersheds | IERKQVDASNGDQPKRFIQNTLASRTLTALPGEVFV* |
| Ga0075019_104444142 | 3300006086 | Watersheds | ERTLQLRIERNQLDPSAEERPRRLIQNTLASRTLTALPGEVFV* |
| Ga0075015_1002960883 | 3300006102 | Watersheds | LRIERKQVSASTDDRPKRFVENTLASRTLTRLPGEVFV* |
| Ga0075030_1008492852 | 3300006162 | Watersheds | KIERKQFDSSAPGRPMRVVQNTLASRTLTALPGEVFA* |
| Ga0070712_1004946452 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TLKLRIERLQMDPSGAGQARRSVQNTLASRTLTALPGEVFV* |
| Ga0079222_120374021 | 3300006755 | Agricultural Soil | IERKQFDSSAPGRPMRVVQNTLASRTLTALPGEVFA* |
| Ga0066665_108470181 | 3300006796 | Soil | NIERTLKLRIERMQAAAPSRPAKPVKNTLASRTLNALPGEVFV* |
| Ga0066797_11856781 | 3300006864 | Soil | ERKQLDASASEQRPKRFIENTLASRTLTALPGEVFV* |
| Ga0073928_102202842 | 3300006893 | Iron-Sulfur Acid Spring | IERMQLDKSGPKRERRVIENTLASRTLTALPGEVFV* |
| Ga0075436_1004079481 | 3300006914 | Populus Rhizosphere | RGQPDVSNTTSAERFVQNTLASRTLTALPGEVFV* |
| Ga0075435_1012022391 | 3300007076 | Populus Rhizosphere | RVQLESSAYDGPKRIVQNTLASRTLTALPGEVFV* |
| Ga0099793_105264453 | 3300007258 | Vadose Zone Soil | RIERKQVNAAASDRPKRFVENTLASRTLTALPGEVFV* |
| Ga0099829_108592431 | 3300009038 | Vadose Zone Soil | TLQLRIERKQVDPSGGGLPKRIVQNTLPTRTLSALPGEVFV* |
| Ga0105240_112054931 | 3300009093 | Corn Rhizosphere | RNIERALQLKIERGQMRSDGVPRRLIQNTLASRTLTALPGEVFV* |
| Ga0099792_111231992 | 3300009143 | Vadose Zone Soil | QLRIERKQVDESANDRPKRIVENTLPTRTLSALPGEVFV* |
| Ga0105243_129684581 | 3300009148 | Miscanthus Rhizosphere | AIERTLQLRIERKQFDPTSSELPRRTIQNTLASRTLTALPGEIFV* |
| Ga0105248_106490691 | 3300009177 | Switchgrass Rhizosphere | MRIQRKQVSACGIEEPKRAVQNTLSTRTLTALPGEVFV* |
| Ga0116229_103686051 | 3300009500 | Host-Associated | LKLRIERVQADPSAPQHPKRAIQNTLASRTLNALPGEVFV* |
| Ga0116108_10787783 | 3300009519 | Peatland | LKLRIERKQVDASALASSNDRPRRVVANTLASRTLIRLPGEVFV* |
| Ga0116214_11309861 | 3300009520 | Peatlands Soil | RTLNLRIERKQVDASASDRPKRFVENTLASRTLTALPGEVFV* |
| Ga0116225_12205841 | 3300009524 | Peatlands Soil | ALKLRIERKQVDWSNAERRESTVQNTLASRTLTKMPGEVFA* |
| Ga0105249_124692131 | 3300009553 | Switchgrass Rhizosphere | TIERALQLRIERVQMESSAYDGPKRIIQNTLASRTLTALPGEVFV* |
| Ga0116111_11163562 | 3300009616 | Peatland | RIERKQVDASANQQPKRFVQNTLASRTLTALPGEVFV* |
| Ga0116133_11383262 | 3300009623 | Peatland | RIERKQVDGSVSEQPKRFVQNTLASRTLVRLPGEVFV* |
| Ga0116133_11764061 | 3300009623 | Peatland | RKQIKASANDQPKRIVQNTLASRTLMALPGEVFV* |
| Ga0116105_10753433 | 3300009624 | Peatland | ERKQVDGSVSEQPKRFVQNTLASRTLVRLPGEVFV* |
| Ga0116114_11542271 | 3300009630 | Peatland | ERTLKLRIERKQVDASASSNDQPKRFVQNTLASRTLTALPGEVFV* |
| Ga0116124_11574832 | 3300009634 | Peatland | IERKQVDASASDRPKRFVENTLASRTLTALPGEVFV* |
| Ga0116132_10572093 | 3300009646 | Peatland | LKLRIERKQVDWSNVDRRESAVQNTLASRTLTKMPGEVFA* |
| Ga0116132_11177841 | 3300009646 | Peatland | KQVDASALANDRPKRFVENTLASRTLTALPGEVFV* |
| Ga0116216_102521571 | 3300009698 | Peatlands Soil | RKQVDASASSNDQPKRFVQNTLASRTLTALPGEVFV* |
| Ga0074044_109556101 | 3300010343 | Bog Forest Soil | RNIERTLKLRIERKQVDSESGERQPKRFVENTLASRTLTRLPGEVFV* |
| Ga0126372_125197202 | 3300010360 | Tropical Forest Soil | KMERLRAVSEITAPPRRMIQNTLASRTLTALPGEVFV* |
| Ga0126379_118078791 | 3300010366 | Tropical Forest Soil | ERTLKLKMERLQAVSETPAAQRRMIQNTLPSRTLAALPGEVFV* |
| Ga0134125_1001549113 | 3300010371 | Terrestrial Soil | RALQLRIERVQMESSAYDGPKRIIQNTLASRTLTALPGEVFV* |
| Ga0134125_102187806 | 3300010371 | Terrestrial Soil | LKIERKQVDASTEQPRRFIENTLASRTLTALPGEVFV* |
| Ga0126381_1020466141 | 3300010376 | Tropical Forest Soil | RMQTDTETVAPPQRMIQNTLASRTLTALPGEVFV* |
| Ga0136449_1004311921 | 3300010379 | Peatlands Soil | ALKLKIERKQVDWANAERSEHVVQNTLASRTLTRLPGEVFA* |
| Ga0134126_125942721 | 3300010396 | Terrestrial Soil | IERTLQLRIERKQFDPTSSELPRRTIQNTLASRTLTALPGEIFV* |
| Ga0134127_103332961 | 3300010399 | Terrestrial Soil | TLTLQMERGQPDVSNTTSAERFVQNTLASRTLTALPGEVFV* |
| Ga0150983_126869593 | 3300011120 | Forest Soil | LKMERMKLSPSTSDAPKRVVQNTLVSRTLTALPGEVFV* |
| Ga0137393_115958292 | 3300011271 | Vadose Zone Soil | KLRIERKQMDASTLEQPSRFVENTLATRTLTALPGEVFV* |
| Ga0120118_10656941 | 3300012010 | Permafrost | LQLRIERMQLDKSGPQRAKRVVENTLASRTLTALPGEVFV* |
| Ga0137376_105236603 | 3300012208 | Vadose Zone Soil | IGRVQLDGSVSARPKPVIQNTLASRTLTMLPGEVFV* |
| Ga0137384_106177912 | 3300012357 | Vadose Zone Soil | KLRIERMQMDPSGAAQPRRFVQNTLASRTLTALPGEVFV* |
| Ga0137384_107980421 | 3300012357 | Vadose Zone Soil | RNIERALQLQIERRQMHSEGIPKRLIQNTLASRTLIALPGEVFV* |
| Ga0137396_105656051 | 3300012918 | Vadose Zone Soil | RKQVNASASERPKRFVENTLASRTLTALPGEVFV* |
| Ga0137407_118147152 | 3300012930 | Vadose Zone Soil | RIERLQLDANGASQPRRSVQNTLASRTLTRLPGEVFV* |
| Ga0164303_114799041 | 3300012957 | Soil | RNIERTLKLRITRKQLDAASDRPRAAIQNTLASRTLTALPGEVFV* |
| Ga0157374_104917074 | 3300013296 | Miscanthus Rhizosphere | ALKLRIERMQFDASSPEPPLRIIKNTLPSRTLTRLPGEVFV* |
| Ga0181530_101690093 | 3300014159 | Bog | ERTLKLRIERKQVGASSSFNDRPKRFIENTLASRTLTALPGEVFV* |
| Ga0182024_114078772 | 3300014501 | Permafrost | RDIERTLKLRIERKQVNATSSENTQPKRFVQNTLASRTLTALPGEVFV* |
| Ga0182024_126090261 | 3300014501 | Permafrost | RSLQLRIERKQVDASASERPRRVVANTLASRTLTRLPGEVFV* |
| Ga0181525_100607211 | 3300014654 | Bog | ERMQLDPSSPDRPKPVIQNTLASRTLTALPGEVFV* |
| Ga0157376_102996193 | 3300014969 | Miscanthus Rhizosphere | RTLKLKIERKQFDSSSVSDQPKRVVQNTLNSRTLTRLPGEVFV* |
| Ga0132258_117506601 | 3300015371 | Arabidopsis Rhizosphere | LKLKMERKQDEIATNLPTRRLIQNTLASRTLTALPGEVFV* |
| Ga0182039_117407451 | 3300016422 | Soil | LALRQIERQLKLRIERRQLDAAGMTARRAVENTLASRSLTRLPGEVFV |
| Ga0181511_12862732 | 3300016702 | Peatland | RIERKQVDASASSNDQPKRFVQNTLASRTLTALPGEVFV |
| Ga0187848_102343422 | 3300017935 | Peatland | IERTLKLRIERKQVDASAANDRPRRVVANTLASRTLIRLPGEVFV |
| Ga0187850_101718981 | 3300017941 | Peatland | IERKQVDASALANDRPKRFVENTLASRTLTALPGEVFV |
| Ga0187879_105947321 | 3300017946 | Peatland | LKLRIERKQVDWSNAQRPMQVVQNTLASRTLTKLPGEVFA |
| Ga0187778_102531861 | 3300017961 | Tropical Peatland | QIERTLKLKMERLQSDTATAGPSQRMIQNTLVSRTLTALPGEVFV |
| Ga0187816_105270292 | 3300017995 | Freshwater Sediment | IERALKLRIERKQVDWANAERSEHVVQNTLASRTLTRLPGEVFA |
| Ga0187767_101462232 | 3300017999 | Tropical Peatland | ERTLKLKMERLQTDAVMAGPSRRMIQNTLPSRTLTAMPGEVFV |
| Ga0187883_100623531 | 3300018037 | Peatland | ERTLKLRIERKQVDASASSNDQPKRFVQNTLASRTLTALPGEVFV |
| Ga0187883_102155163 | 3300018037 | Peatland | LKLRIERKQVDWSNAERRESAVQNTLASRTLIRMPGEVFA |
| Ga0187855_103647742 | 3300018038 | Peatland | LKLRIERKQVNASTSSNSQPKRFVQNTLASRTLTALPGEVFV |
| Ga0187887_108108142 | 3300018043 | Peatland | LKLRIERMQMDPGGATQPRRSVQNTLASRTLTALPGEVFV |
| Ga0187890_105420511 | 3300018044 | Peatland | ERKQVDWSSTERRENAVQNTLASRTLTKMPGEVFA |
| Ga0187784_103968151 | 3300018062 | Tropical Peatland | LKIERLQTDTVLAGLPKRMIHNTLASRSLTALPGEVFV |
| Ga0187769_100078801 | 3300018086 | Tropical Peatland | ERKQVDWANAVRSEHVVQNTLASRTLTRLPGEIFA |
| Ga0066667_106991991 | 3300018433 | Grasslands Soil | RTLKLKIERKQTEMATDSSPRRMIQNTLASRTLTALPGEVFV |
| Ga0187800_15448381 | 3300019278 | Peatland | LRNIERTLKLRIERKQLDGLAAQPRRFVQNTLASRTLTALPGEVFV |
| Ga0182025_10948241 | 3300019786 | Permafrost | ERVLKLRIERKQVDWANAERSQHVVQNTLASRTLTRLPGEVFA |
| Ga0182031_12216583 | 3300019787 | Bog | LKLRIERKQMNAAANDQPRRIIANTLASRTLTKLPVRFLFRVY |
| Ga0182031_14023712 | 3300019787 | Bog | LKLRIERKQMNAAANDQPRRIIANTLASRTLTKLPGEVFV |
| Ga0210406_113730452 | 3300021168 | Soil | LRIERMQMDRSGAPQPKRFVQNTLASRTLTALPGEVFV |
| Ga0210405_112940842 | 3300021171 | Soil | LKLRIERKQVDWANAERSEHVVQNTLASRTLTKLPGEVFA |
| Ga0210396_109151373 | 3300021180 | Soil | RHIERALKLRIERKQVDWNNAERSEHVVQNTLASRTLTRLPGEIFA |
| Ga0213882_105388402 | 3300021362 | Exposed Rock | ALKLRIERLQMGAEMAGPPRRLIQNTLASRTLTALPGEVFV |
| Ga0210393_105848272 | 3300021401 | Soil | KIERKQFDGAASVVSTRVVQNTLASRTLTALPGEVFA |
| Ga0210393_110734201 | 3300021401 | Soil | IERKQVDWANAGKSEHVVQNTLASRTLTRLPGEVFA |
| Ga0210393_115348182 | 3300021401 | Soil | IERKQVDWSNAGKPTHVVQNTLASRTLTKMPGEVFA |
| Ga0210386_101339891 | 3300021406 | Soil | LKLRIERKQVDWANAGRSQHVVQNTLASRTLTRLPGEVFA |
| Ga0210383_103833442 | 3300021407 | Soil | RIERMHMDPSGATQPRRSVQNTLASRTLTALPGEVFV |
| Ga0210383_107068272 | 3300021407 | Soil | KLRIERMQMDPSGALQPRRHIQNTLASRTLTKLPGEVFV |
| Ga0210384_116670941 | 3300021432 | Soil | RIERLQMDASGATQPRRSVQNTLASRTLTALPGEVFV |
| Ga0210402_100827321 | 3300021478 | Soil | RIERLEVDNSEYDRPRRIVQNTLASRTLIKLPGEVFV |
| Ga0210409_102990021 | 3300021559 | Soil | IERMQLDKSGPKRERRVVENTLASRTLTALPGEVFV |
| Ga0210409_115441361 | 3300021559 | Soil | LKLRIERMQMDPSGAAQPKRFVQNTLASRTLTALPGEVFV |
| Ga0212123_102971742 | 3300022557 | Iron-Sulfur Acid Spring | LQLRIERMQLDKSGPKRERRVIENTLASRTLTALPGEVFV |
| Ga0242666_10343161 | 3300022721 | Soil | LKLKIERLQANADSAAPPRRAIQNTLASRTLTALPGEVFV |
| Ga0224563_10241141 | 3300022731 | Soil | IERVLKLRIERKQVDWANAGRSEHVVQNTLASRTLTKMPGEVFA |
| Ga0208192_10776031 | 3300025477 | Peatland | IERKQMNAAANDQPRRIIANTLASRTLTKLPGEVFV |
| Ga0208686_10469913 | 3300025500 | Peatland | IERKQVDASASSNDQPKRFVQNTLASRTLTALPGEVFV |
| Ga0208563_10885802 | 3300025501 | Peatland | LKLRIERKQVDWSNVDRRESAVQNTLASRTLTKMPGEVFA |
| Ga0207695_116665422 | 3300025913 | Corn Rhizosphere | ELRNIERALQLKIERGQMRSDGVPRRLIQNTLASRTLTALPGEVFV |
| Ga0207700_103583272 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLRIERMQLDGSGSSRPKPVVQNTLASRTLTALPGEVFV |
| Ga0207686_101252261 | 3300025934 | Miscanthus Rhizosphere | PLKIERGQMRSDGVPRRLIQNTLGSRTLTALPGEVFV |
| Ga0207709_117657051 | 3300025935 | Miscanthus Rhizosphere | AIERTLQLRIERKQFDPTSSELPRRTIQNTLASRTLTALPGEIFV |
| Ga0207641_119154921 | 3300026088 | Switchgrass Rhizosphere | KIERGQMRSDGVPRRLIQNTLASRTLTALPGEVFV |
| Ga0209863_100690132 | 3300026281 | Prmafrost Soil | IERMTLDKSGPKREKRVVENTLSSRTLTKLPGEVFV |
| Ga0209687_10535863 | 3300026322 | Soil | KTIERKLQLRIERLQLDGSVSVRPKPVIQNTLASRTLTALPGEVFV |
| Ga0209375_11315162 | 3300026329 | Soil | ELKTIERKLQLRIERTQLDASIPDRPKPVIQNTLASRTLTALPGEVFV |
| Ga0209156_100651751 | 3300026547 | Soil | LELKSIERKLQLRIERTQLDASIPGRPKPVIQNTLASRTLTALPGEVFV |
| Ga0209474_105458752 | 3300026550 | Soil | KLQLRIERTQLDASIPGRPKPVIQNTLASRTLTALPGEVFV |
| Ga0208369_10307702 | 3300026998 | Forest Soil | ALKLRIERVQITASAVDVSRRIIQNTLASRTLTALPGEVFG |
| Ga0209421_10204964 | 3300027432 | Forest Soil | LQLRIERLEIDSAEYQRPRRIVQNTLASRTLIKLPGEVFV |
| Ga0209525_11290602 | 3300027575 | Forest Soil | KLRIERMQMDPSGFEQPKRFVQNTLASRTLTALPGEVFV |
| Ga0209116_11396822 | 3300027590 | Forest Soil | KLRIERKKVNAAASENAQPKRFVQNTLASRTLTALPGEVFV |
| Ga0208988_10290141 | 3300027633 | Forest Soil | ERKQLDASASDRPKRIVQNTLPSRTLSALPGEVFV |
| Ga0209076_11636073 | 3300027643 | Vadose Zone Soil | RIERKQVNAAASDRPKRFVENTLASRTLTALPGEVFV |
| Ga0209908_100496351 | 3300027745 | Thawing Permafrost | ERKQVNWAIADRRQNAVQNTLASRTLTKLPGEVFA |
| Ga0209772_100391251 | 3300027768 | Bog Forest Soil | KLRIERKQVDWSNAERRESAVQNTLASRTLTRMPGEVFA |
| Ga0209040_103095772 | 3300027824 | Bog Forest Soil | LRLKIERMQVDPATQQTRTVQNTLASRTLTALPGEVFV |
| Ga0209039_101385661 | 3300027825 | Bog Forest Soil | TLRLRIERKQVNAPADEQPRRIVANTLASRTLTRLPGEVFV |
| Ga0209060_102528412 | 3300027826 | Surface Soil | RTLKLKIERLQADTAMAGPPRRMIQNTLASRTLTALPGEVFV |
| Ga0209060_102685313 | 3300027826 | Surface Soil | LRIERHQLENAASQRPSRIVQNTLASRTLTALPGEVFV |
| Ga0209169_105623851 | 3300027879 | Soil | LKIERRQVNWANAERSERVVQNTLASRTLTRLPGEIFA |
| Ga0209698_103583053 | 3300027911 | Watersheds | RRIERSLQLRIERKQIDTERAGAPRRIIQNTLASRTLTALPGEVFV |
| Ga0209698_108892732 | 3300027911 | Watersheds | KIERKQFDSSAPGRPMRVVQNTLASRTLTALPGEVFA |
| Ga0137415_106475542 | 3300028536 | Vadose Zone Soil | QLRIERKQVDGSYAPLPKRFVKNTLATRTLTALEGEVFA |
| Ga0302224_103224652 | 3300028759 | Palsa | RIERMQLDPSSQDRPKPVIQNTLASRTLTALPGEVFV |
| Ga0302266_101627402 | 3300028779 | Bog | ARKQINAADSERQPKRFIENTLASRTLTRLPGEIFV |
| Ga0308309_106655871 | 3300028906 | Soil | NVTLRDIERALKLRIERKQLDASGAANDRPKRFVENTLASRTLTRLPGEVFV |
| Ga0247271_1061881 | 3300029903 | Soil | RNIERTLKLRIERKQVASANISAHPKRLVQNTLASRTLVRLPGEVFV |
| Ga0311339_116074721 | 3300029999 | Palsa | DIERTLKLRIERKQVDASASSNEQPKRFVQNTLASRTLTALPGEVFV |
| Ga0311337_105991951 | 3300030000 | Fen | ERKQMDDAGNDRPKRVVQNTLPSRTLSALPGEVFV |
| Ga0311344_113652811 | 3300030020 | Bog | LKLKIERKQIDWTNAERSEHVVQNTLASRTLTKLPGEIFA |
| Ga0311372_115441681 | 3300030520 | Palsa | NIERALKLRIERKQVDWANAGRSEHVVQNTLASRTLTKMPGDVFE |
| Ga0170834_1023700491 | 3300031057 | Forest Soil | ERKQVNAASDDRPKRFVENTLASRTLTKLPGEVFV |
| Ga0302318_104553401 | 3300031258 | Bog | RIERVQADPSAPQHPKRAIQNTLASRTLNALPGEVFV |
| Ga0308194_101984973 | 3300031421 | Soil | DIERALQLRIKRMQVEPAAQDAPKRIILNTLASRTLTALPGEVFV |
| Ga0311364_109796981 | 3300031521 | Fen | IERKQLDDAGNDRPKRVVQNTLPSRTLSALPGEVFV |
| Ga0310686_1056314391 | 3300031708 | Soil | IERKQVDWANAGRSEHVVENTLASRTLTRLPGEVFA |
| Ga0310686_1113782776 | 3300031708 | Soil | HIERVLKLRIERKQVDWANAGRSEHVVQNTLASRTLTKMPGEVFA |
| Ga0310686_1132273471 | 3300031708 | Soil | DRKQVDWANAERSEHVVQNTLASRTLTRLPGEVFA |
| Ga0306917_107334131 | 3300031719 | Soil | RTLKLRMERMQTDRAIAGPPRRMMQNTLASRTLTALPGEVFV |
| Ga0307469_102246984 | 3300031720 | Hardwood Forest Soil | LRIERKQINAATNDRPKRFVENTLASRTLTALPGEVFV |
| Ga0318502_100624281 | 3300031747 | Soil | LRLKMERLQTDTATARPPRQVIQNTLASRTLTALPGEVFV |
| Ga0307475_102542181 | 3300031754 | Hardwood Forest Soil | KIERKQVDWANAGRSEHIVQNTLASRTLTRLPGEIFA |
| Ga0318521_100369693 | 3300031770 | Soil | ERTLRLKMERLQTDTATARPPRQVIQNTLASRTLTALPGEVFV |
| Ga0311301_109634491 | 3300032160 | Peatlands Soil | KLQIERMQMDPSGATQPRRSVQNTLASRTLTALPGEVFV |
| Ga0307470_102812744 | 3300032174 | Hardwood Forest Soil | RIERVQITASAVDVSRRIIQNTLASRTLTALPGEVFG |
| Ga0306920_1020916832 | 3300032261 | Soil | LRQIERQLKLRIERRQLDAAGMTARRAVENTLASRSLTRLPGEVFV |
| Ga0348332_140522775 | 3300032515 | Plant Litter | ERALKLRIERKQVDWANAERSEHVVQNTLVSRTLTRLPGEVFA |
| Ga0335074_100271821 | 3300032895 | Soil | KLKIERTQPEMPTDAPPRQMIQNTLASRTLTALPGEVFV |
| Ga0326727_109907822 | 3300033405 | Peat Soil | KLRIERKQVDASASFNDQPKRFVQNTLASRTLTALPGEVFV |
| Ga0310810_101095881 | 3300033412 | Soil | ERVQLDGSVSVRPKLVIQNTLASRTLTMLPGEVFV |
| Ga0326726_101688961 | 3300033433 | Peat Soil | LCIERNQLDPSADERPKRLVQNTLAGRTLTALPGEVFV |
| ⦗Top⦘ |