


| Basic Information | |
|---|---|
| Family ID | F032725 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSE |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.53 % |
| % of genes near scaffold ends (potentially truncated) | 99.44 % |
| % of genes from short scaffolds (< 2000 bps) | 94.41 % |
| Associated GOLD sequencing projects | 132 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.866 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.732 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.402 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.810 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.96% β-sheet: 0.00% Coil/Unstructured: 61.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF13683 | rve_3 | 3.35 |
| PF00069 | Pkinase | 2.23 |
| PF04909 | Amidohydro_2 | 1.68 |
| PF00756 | Esterase | 1.12 |
| PF01436 | NHL | 1.12 |
| PF00034 | Cytochrom_C | 1.12 |
| PF13620 | CarboxypepD_reg | 1.12 |
| PF08309 | LVIVD | 1.12 |
| PF13460 | NAD_binding_10 | 1.12 |
| PF12681 | Glyoxalase_2 | 1.12 |
| PF07638 | Sigma70_ECF | 1.12 |
| PF13622 | 4HBT_3 | 1.12 |
| PF00857 | Isochorismatase | 1.12 |
| PF00141 | peroxidase | 1.12 |
| PF00106 | adh_short | 0.56 |
| PF13432 | TPR_16 | 0.56 |
| PF01979 | Amidohydro_1 | 0.56 |
| PF12680 | SnoaL_2 | 0.56 |
| PF17170 | DUF5128 | 0.56 |
| PF04542 | Sigma70_r2 | 0.56 |
| PF07609 | DUF1572 | 0.56 |
| PF01451 | LMWPc | 0.56 |
| PF12796 | Ank_2 | 0.56 |
| PF13565 | HTH_32 | 0.56 |
| PF08450 | SGL | 0.56 |
| PF12146 | Hydrolase_4 | 0.56 |
| PF10994 | DUF2817 | 0.56 |
| PF01850 | PIN | 0.56 |
| PF00144 | Beta-lactamase | 0.56 |
| PF01011 | PQQ | 0.56 |
| PF07676 | PD40 | 0.56 |
| PF08592 | Anthrone_oxy | 0.56 |
| PF07719 | TPR_2 | 0.56 |
| PF07606 | DUF1569 | 0.56 |
| PF00753 | Lactamase_B | 0.56 |
| PF02518 | HATPase_c | 0.56 |
| PF08241 | Methyltransf_11 | 0.56 |
| PF07883 | Cupin_2 | 0.56 |
| PF05711 | TylF | 0.56 |
| PF12697 | Abhydrolase_6 | 0.56 |
| PF10056 | DUF2293 | 0.56 |
| PF12867 | DinB_2 | 0.56 |
| PF02653 | BPD_transp_2 | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 8.94 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.68 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 1.12 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 1.12 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.12 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.12 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.56 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.56 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.56 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.56 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.56 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.56 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.87 % |
| Unclassified | root | N/A | 44.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_103587 | Not Available | 1014 | Open in IMG/M |
| 3300000178|FW301_c1030217 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300000891|JGI10214J12806_12347364 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300001842|RCM30_1093756 | Not Available | 585 | Open in IMG/M |
| 3300004092|Ga0062389_104646572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 517 | Open in IMG/M |
| 3300004153|Ga0063455_101671656 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300004479|Ga0062595_100522853 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300004633|Ga0066395_10538382 | Not Available | 678 | Open in IMG/M |
| 3300005331|Ga0070670_100421038 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300005335|Ga0070666_10453963 | Not Available | 926 | Open in IMG/M |
| 3300005336|Ga0070680_100386066 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300005356|Ga0070674_101170393 | Not Available | 681 | Open in IMG/M |
| 3300005364|Ga0070673_101125635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 734 | Open in IMG/M |
| 3300005364|Ga0070673_101491457 | Not Available | 638 | Open in IMG/M |
| 3300005365|Ga0070688_101225477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 604 | Open in IMG/M |
| 3300005445|Ga0070708_101870923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300005457|Ga0070662_101603242 | Not Available | 562 | Open in IMG/M |
| 3300005458|Ga0070681_10457237 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300005518|Ga0070699_101524801 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005536|Ga0070697_100681160 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300005536|Ga0070697_102036724 | Not Available | 514 | Open in IMG/M |
| 3300005538|Ga0070731_10199237 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005543|Ga0070672_101964469 | Not Available | 527 | Open in IMG/M |
| 3300005559|Ga0066700_11144601 | Not Available | 508 | Open in IMG/M |
| 3300005566|Ga0066693_10200401 | Not Available | 774 | Open in IMG/M |
| 3300005618|Ga0068864_100390819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 1320 | Open in IMG/M |
| 3300005718|Ga0068866_10522818 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005718|Ga0068866_10813464 | Not Available | 650 | Open in IMG/M |
| 3300005764|Ga0066903_107288096 | Not Available | 572 | Open in IMG/M |
| 3300005841|Ga0068863_100714278 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005841|Ga0068863_102139476 | Not Available | 569 | Open in IMG/M |
| 3300005842|Ga0068858_100178666 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300005842|Ga0068858_100252748 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300005842|Ga0068858_101587680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
| 3300005842|Ga0068858_102042880 | Not Available | 567 | Open in IMG/M |
| 3300005843|Ga0068860_100614121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300005921|Ga0070766_10407261 | Not Available | 892 | Open in IMG/M |
| 3300005921|Ga0070766_11034260 | Not Available | 566 | Open in IMG/M |
| 3300006028|Ga0070717_11205092 | Not Available | 689 | Open in IMG/M |
| 3300006046|Ga0066652_101845024 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006050|Ga0075028_100117124 | Not Available | 1377 | Open in IMG/M |
| 3300006052|Ga0075029_100135210 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300006059|Ga0075017_101391144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 552 | Open in IMG/M |
| 3300006176|Ga0070765_101905333 | Not Available | 557 | Open in IMG/M |
| 3300006237|Ga0097621_100131181 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300006237|Ga0097621_100359551 | Not Available | 1296 | Open in IMG/M |
| 3300006237|Ga0097621_100925596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_65_8 | 813 | Open in IMG/M |
| 3300006354|Ga0075021_10556859 | Not Available | 729 | Open in IMG/M |
| 3300006358|Ga0068871_100193225 | Not Available | 1754 | Open in IMG/M |
| 3300006358|Ga0068871_101294246 | Not Available | 685 | Open in IMG/M |
| 3300006638|Ga0075522_10161788 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300006804|Ga0079221_10484066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300006854|Ga0075425_100170896 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300006871|Ga0075434_102257497 | Not Available | 547 | Open in IMG/M |
| 3300006881|Ga0068865_101925244 | Not Available | 536 | Open in IMG/M |
| 3300006903|Ga0075426_10442568 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300006904|Ga0075424_102677749 | Not Available | 521 | Open in IMG/M |
| 3300007076|Ga0075435_100416381 | Not Available | 1157 | Open in IMG/M |
| 3300007076|Ga0075435_100493147 | Not Available | 1059 | Open in IMG/M |
| 3300009162|Ga0075423_10459644 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300009176|Ga0105242_10530303 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300009177|Ga0105248_12678331 | Not Available | 569 | Open in IMG/M |
| 3300009645|Ga0116106_1227547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 593 | Open in IMG/M |
| 3300010048|Ga0126373_11652877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300010362|Ga0126377_10188776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1966 | Open in IMG/M |
| 3300010376|Ga0126381_104245926 | Not Available | 555 | Open in IMG/M |
| 3300010399|Ga0134127_11909946 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010400|Ga0134122_12551917 | Not Available | 561 | Open in IMG/M |
| 3300011270|Ga0137391_10588614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300012487|Ga0157321_1005900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300012918|Ga0137396_10774660 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300012948|Ga0126375_10359543 | Not Available | 1036 | Open in IMG/M |
| 3300012955|Ga0164298_10875308 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300012971|Ga0126369_12160344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 644 | Open in IMG/M |
| 3300013296|Ga0157374_12811381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300013297|Ga0157378_13131194 | Not Available | 514 | Open in IMG/M |
| 3300013308|Ga0157375_10218349 | Not Available | 2065 | Open in IMG/M |
| 3300013308|Ga0157375_10984955 | Not Available | 983 | Open in IMG/M |
| 3300014153|Ga0181527_1031479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3147 | Open in IMG/M |
| 3300014325|Ga0163163_10759011 | Not Available | 1033 | Open in IMG/M |
| 3300014969|Ga0157376_10197916 | Not Available | 1847 | Open in IMG/M |
| 3300014969|Ga0157376_11235050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300014969|Ga0157376_11252269 | Not Available | 771 | Open in IMG/M |
| 3300014969|Ga0157376_12143394 | Not Available | 597 | Open in IMG/M |
| 3300015371|Ga0132258_12173376 | Not Available | 1394 | Open in IMG/M |
| 3300015371|Ga0132258_12750181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1227 | Open in IMG/M |
| 3300015371|Ga0132258_12835528 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300015372|Ga0132256_102700924 | Not Available | 596 | Open in IMG/M |
| 3300015373|Ga0132257_101296394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300015373|Ga0132257_102517451 | Not Available | 669 | Open in IMG/M |
| 3300015373|Ga0132257_104106604 | Not Available | 530 | Open in IMG/M |
| 3300015374|Ga0132255_100585193 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300015374|Ga0132255_102128191 | Not Available | 855 | Open in IMG/M |
| 3300015374|Ga0132255_106185468 | Not Available | 507 | Open in IMG/M |
| 3300016371|Ga0182034_10418941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1102 | Open in IMG/M |
| 3300016371|Ga0182034_11807495 | Not Available | 539 | Open in IMG/M |
| 3300017822|Ga0187802_10146745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 900 | Open in IMG/M |
| 3300017934|Ga0187803_10241412 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300017942|Ga0187808_10037650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2017 | Open in IMG/M |
| 3300017955|Ga0187817_10276517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300017955|Ga0187817_10964836 | Not Available | 546 | Open in IMG/M |
| 3300017975|Ga0187782_11651472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 507 | Open in IMG/M |
| 3300017994|Ga0187822_10234914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300017997|Ga0184610_1289387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300018090|Ga0187770_10494469 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300020582|Ga0210395_10561715 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300020582|Ga0210395_11448750 | Not Available | 500 | Open in IMG/M |
| 3300020583|Ga0210401_10873913 | Not Available | 758 | Open in IMG/M |
| 3300021082|Ga0210380_10176599 | Not Available | 962 | Open in IMG/M |
| 3300021088|Ga0210404_10103944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1437 | Open in IMG/M |
| 3300021122|Ga0214195_1011260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 993 | Open in IMG/M |
| 3300021168|Ga0210406_10149928 | Not Available | 1958 | Open in IMG/M |
| 3300021168|Ga0210406_10275500 | Not Available | 1374 | Open in IMG/M |
| 3300021171|Ga0210405_10171140 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300021171|Ga0210405_11268758 | Not Available | 542 | Open in IMG/M |
| 3300021180|Ga0210396_11680983 | Not Available | 516 | Open in IMG/M |
| 3300021181|Ga0210388_11551334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 552 | Open in IMG/M |
| 3300021404|Ga0210389_10428001 | Not Available | 1041 | Open in IMG/M |
| 3300021406|Ga0210386_11219926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300021406|Ga0210386_11451206 | Not Available | 573 | Open in IMG/M |
| 3300021406|Ga0210386_11510649 | Not Available | 560 | Open in IMG/M |
| 3300021432|Ga0210384_10259537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1564 | Open in IMG/M |
| 3300021433|Ga0210391_11384035 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300021559|Ga0210409_10427953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1182 | Open in IMG/M |
| 3300021559|Ga0210409_10966489 | Not Available | 726 | Open in IMG/M |
| 3300021560|Ga0126371_10935528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300021560|Ga0126371_13768288 | Not Available | 511 | Open in IMG/M |
| 3300025893|Ga0207682_10126109 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300025903|Ga0207680_10094924 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300025912|Ga0207707_10366725 | Not Available | 1239 | Open in IMG/M |
| 3300025925|Ga0207650_10414819 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300025926|Ga0207659_10247407 | Not Available | 1445 | Open in IMG/M |
| 3300025927|Ga0207687_11099326 | Not Available | 683 | Open in IMG/M |
| 3300025930|Ga0207701_10455552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1098 | Open in IMG/M |
| 3300025933|Ga0207706_10598374 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300025937|Ga0207669_10777905 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300025938|Ga0207704_10586406 | Not Available | 911 | Open in IMG/M |
| 3300025940|Ga0207691_10058999 | All Organisms → cellular organisms → Bacteria | 3490 | Open in IMG/M |
| 3300025940|Ga0207691_10923926 | Not Available | 730 | Open in IMG/M |
| 3300025960|Ga0207651_11648581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300026035|Ga0207703_12303374 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300026075|Ga0207708_10366880 | Not Available | 1184 | Open in IMG/M |
| 3300026089|Ga0207648_10270070 | Not Available | 1519 | Open in IMG/M |
| 3300026095|Ga0207676_10259101 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300026116|Ga0207674_10614198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia kujensis | 1050 | Open in IMG/M |
| 3300027011|Ga0207740_1046132 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027682|Ga0209971_1060273 | Not Available | 919 | Open in IMG/M |
| 3300027869|Ga0209579_10207450 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300027882|Ga0209590_10813026 | Not Available | 593 | Open in IMG/M |
| 3300027905|Ga0209415_10231649 | All Organisms → cellular organisms → Bacteria | 1692 | Open in IMG/M |
| 3300027910|Ga0209583_10280242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 748 | Open in IMG/M |
| 3300028047|Ga0209526_10258718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
| 3300029636|Ga0222749_10195743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300029951|Ga0311371_11683163 | Not Available | 693 | Open in IMG/M |
| 3300030618|Ga0311354_10057880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4474 | Open in IMG/M |
| 3300031128|Ga0170823_16707580 | Not Available | 1305 | Open in IMG/M |
| 3300031184|Ga0307499_10066206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 922 | Open in IMG/M |
| 3300031708|Ga0310686_114767925 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300031715|Ga0307476_10636612 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300031716|Ga0310813_10551266 | Not Available | 1014 | Open in IMG/M |
| 3300031847|Ga0310907_10412429 | Not Available | 706 | Open in IMG/M |
| 3300031910|Ga0306923_11782552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 633 | Open in IMG/M |
| 3300031912|Ga0306921_12750377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 504 | Open in IMG/M |
| 3300031941|Ga0310912_11356460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 538 | Open in IMG/M |
| 3300031944|Ga0310884_10837282 | Not Available | 564 | Open in IMG/M |
| 3300031962|Ga0307479_10388464 | Not Available | 1380 | Open in IMG/M |
| 3300031962|Ga0307479_10791682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis jejuensis | 924 | Open in IMG/M |
| 3300031962|Ga0307479_11092297 | Not Available | 764 | Open in IMG/M |
| 3300032010|Ga0318569_10481954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 578 | Open in IMG/M |
| 3300032012|Ga0310902_10027520 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
| 3300032075|Ga0310890_10760481 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300032157|Ga0315912_10766780 | Not Available | 768 | Open in IMG/M |
| 3300032160|Ga0311301_10231145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 3092 | Open in IMG/M |
| 3300032163|Ga0315281_12326927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 504 | Open in IMG/M |
| 3300032261|Ga0306920_100873745 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300032892|Ga0335081_11722539 | Not Available | 682 | Open in IMG/M |
| 3300032954|Ga0335083_10965933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300033412|Ga0310810_11044822 | Not Available | 690 | Open in IMG/M |
| 3300033433|Ga0326726_10702937 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.91% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.35% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.23% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.12% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.12% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.12% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.12% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.12% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.56% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.56% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.56% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000178 | Pristine groundwater from Oak Ridge Integrated Field Research Center, Tennessee (resequenced) | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021122 | Freshwater microbial communities from Trout Bog Lake, WI - 19AUG2008 epilimnion | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01599800 | 2199352025 | Soil | MTKIESSALMLFGTVVLACSLLFAQVQRPGEYPRGVKPSPM |
| FW301_10302171 | 3300000178 | Groundwater | MPRIRTSALALCGIVSLASCLLLAQTQRPGEYPRGEKPSPMMSFFVTSVPVGDGGNLGGL |
| JGI10214J12806_123473641 | 3300000891 | Soil | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSP |
| RCM30_10937562 | 3300001842 | Marine Plankton | MTKTKTSALLLSCTFSLTSCLLQAQVLQRPGEYPRGEKPSAKMNFFVTSEP |
| Ga0062389_1046465721 | 3300004092 | Bog Forest Soil | MFKMKTSGTKIKTSALLLSCTVLLASGLLQAQVQRPGEYPRGEKPSPMM |
| Ga0063455_1016716562 | 3300004153 | Soil | MPKIKTTALAFLGIVSLASCLLLAQTQRPGEYPRGENPSPMMNFFVTSVPVGDGGNL |
| Ga0062595_1005228531 | 3300004479 | Soil | MTKTESSALMLSGMVVFACSLLFAQVQRPGEYPRGVKPSPM |
| Ga0066395_105383822 | 3300004633 | Tropical Forest Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDG |
| Ga0070670_1004210381 | 3300005331 | Switchgrass Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNLGGL |
| Ga0070666_104539632 | 3300005335 | Switchgrass Rhizosphere | MPEIKTAALALSGIVSVASCLLLAQTQRPGEYPRGEKPSPMMNFFVT |
| Ga0070680_1003860661 | 3300005336 | Corn Rhizosphere | MTKITSSAVILSGMVVLACSLVFAQVQRPGEYPRGVKPSPMM |
| Ga0070674_1011703932 | 3300005356 | Miscanthus Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDG |
| Ga0070673_1011256352 | 3300005364 | Switchgrass Rhizosphere | MPKIKTSALALFGIVSLASGLLLAQTQRPGEYPRGEKPSPMMNFFVTSVP |
| Ga0070673_1014914572 | 3300005364 | Switchgrass Rhizosphere | MTKIQSSALMLSGVFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNL |
| Ga0070688_1012254772 | 3300005365 | Switchgrass Rhizosphere | MTKIQSSALMFSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0070708_1018709231 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKTESSALMLSGMVVFACSLLFGQVQRPGEYPRGVKPSPMMNFFVTSEP |
| Ga0070662_1016032421 | 3300005457 | Corn Rhizosphere | MTKMKLSALMLSATVVLACGLLFAQVQRPGEYPRGVKPSP |
| Ga0070681_104572371 | 3300005458 | Corn Rhizosphere | MTKITSSAVILSGMVVLACSLVFAQVQRPGEYPRGVKPSPM |
| Ga0070699_1015248012 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKIRTSALALCGIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFFV |
| Ga0070697_1006811603 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKIRSSALMLSGTIVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEP |
| Ga0070697_1020367241 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKIKTSALLLSCTVSLASCLLQAQVQRPGEYPRGEKPSPMMNFF |
| Ga0070731_101992374 | 3300005538 | Surface Soil | MPKINTSALALFGIVSLASCLLLAQTQRPGEYPPGEK |
| Ga0070672_1019644691 | 3300005543 | Miscanthus Rhizosphere | MTKMTSSALMAGMVVLACSLLFAQVQRPGEYPRGVKPSPMMS |
| Ga0066700_111446012 | 3300005559 | Soil | MPKITTSALALFGIVSLASCLLLAQTQRPGEYPRGEKPSPTMNFFVTS |
| Ga0066693_102004011 | 3300005566 | Soil | MTKIKSSALMLSGTVVLACSLLFAQVQRPGEYPRGVTPSPMMNFFVTSEPIGDGGNLGG |
| Ga0068864_1003908191 | 3300005618 | Switchgrass Rhizosphere | MTMKSSALMLSGMVVLGCSLLFAQVQRPGEYPRGVKPSPMMNF |
| Ga0068866_105228182 | 3300005718 | Miscanthus Rhizosphere | MIKVKTSALLLSCTVSLAPCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPVGDGGNLGGL |
| Ga0068866_108134642 | 3300005718 | Miscanthus Rhizosphere | MPRIETTALASFGIVSLASCLLLAQTQRPGEYPRGETPSPMMNFFVTSVPV |
| Ga0066903_1072880962 | 3300005764 | Tropical Forest Soil | MPDINTSAPALFGIASLAFSLLLAQTQRPGEYPPGEK |
| Ga0068863_1007142782 | 3300005841 | Switchgrass Rhizosphere | MEIWIYMTKITSSALLVSGAVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFV |
| Ga0068863_1021394762 | 3300005841 | Switchgrass Rhizosphere | MTKIQSSALMLSGVFLLACSLLFAQVQRPGEYPRGVKPS |
| Ga0068858_1001786661 | 3300005842 | Switchgrass Rhizosphere | MPKINTSALALFGIVSLASCLLLAQTQRPGEYPRGEKPSP |
| Ga0068858_1002527481 | 3300005842 | Switchgrass Rhizosphere | MPKIKTSALALFGIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFFVTSVPVGDGGNLGGL |
| Ga0068858_1015876801 | 3300005842 | Switchgrass Rhizosphere | MTKITSSALMVSGTVMLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSE |
| Ga0068858_1020428802 | 3300005842 | Switchgrass Rhizosphere | MPKIKTTALALLGIVSLASCLLLAQTQRPGEYPRGEKP |
| Ga0068860_1006141212 | 3300005843 | Switchgrass Rhizosphere | MLKIETTALAFGIVSLASFLLLAQTQRPGEYPRGETASPMMNFFVTSVPVGDGGNLGG |
| Ga0070766_104072612 | 3300005921 | Soil | MTKTKTSALLLSCTVSLAPCLLLGQVQRPGEYPRGEKPSPMMNFFVTSEPIGD |
| Ga0070766_110342601 | 3300005921 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFV |
| Ga0070717_112050921 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKIKSSALILSCTLLLASCLLLAQVPKPGEYPRGAKPSPMMNFFVTSETIGDGGNLGGL |
| Ga0066652_1018450242 | 3300006046 | Soil | MTKIRASALMLSGTVVLACSLLFAQVQRPGEYPRGV |
| Ga0075028_1001171241 | 3300006050 | Watersheds | MAKTKSSALMLSLASCLLLAQVPKPGEYPLGAKPSSMMNFFVTSEP |
| Ga0075029_1001352102 | 3300006052 | Watersheds | MTKIKSSALMLFCMLLLASCLLLAQSPKPGEYPRGAKPSPMMNFFVTSETMGDGGNLGGL |
| Ga0075017_1013911442 | 3300006059 | Watersheds | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMM |
| Ga0070765_1019053331 | 3300006176 | Soil | MPKIKSSAVVLFCIVSLSSCLLLAQVQRPGEYPRGE |
| Ga0097621_1001311815 | 3300006237 | Miscanthus Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVT |
| Ga0097621_1003595514 | 3300006237 | Miscanthus Rhizosphere | MTKMKLSALMLSATVVLACGLLFAQVQRPGEYPRGVKPSPMM |
| Ga0097621_1009255961 | 3300006237 | Miscanthus Rhizosphere | MTMKSSALMLSGMVVLGCSLLFAQVQRPGEYPRGVKPS |
| Ga0075021_105568591 | 3300006354 | Watersheds | MPKIKFSALALFCIVSLAPCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPI |
| Ga0068871_1001932251 | 3300006358 | Miscanthus Rhizosphere | MTKIKTSALLLSCTVSMAPCLLLAQVQRPGEYPRGEKSSPMMNFFVTSEPIGDGGN |
| Ga0068871_1012942462 | 3300006358 | Miscanthus Rhizosphere | MTKIQSSALMLSGVFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGG |
| Ga0075522_101617883 | 3300006638 | Arctic Peat Soil | MTKIKSSALMLSGTVLLAYSLLFAQVQRPGEYPRGVKPSPMMNFFVTSE |
| Ga0079221_104840662 | 3300006804 | Agricultural Soil | MTKIQASVLTLSAIVVLACSFLFAQVQRPGEYPRGVKPSPMMNFFVTS |
| Ga0075425_1001708961 | 3300006854 | Populus Rhizosphere | MTKITSSALLVAGTVVFACSLLFAQVQRPGEYPRGVKPSPMMN |
| Ga0075434_1022574972 | 3300006871 | Populus Rhizosphere | MTKIQSSALMLSGAFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNL |
| Ga0068865_1019252442 | 3300006881 | Miscanthus Rhizosphere | MTTIKSSALMLSGMVALACSVLFAQVQRPGEYPRGVKPSPMM |
| Ga0075426_104425681 | 3300006903 | Populus Rhizosphere | MTKITSSALMVSGTVMLACSLLFAQVQRPGEYPRGVKPSPMMN |
| Ga0075424_1026777491 | 3300006904 | Populus Rhizosphere | MTKITSSALILSGMVVLAYSLLFAQVQRPGEYPRGVK |
| Ga0075435_1004163811 | 3300007076 | Populus Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMM |
| Ga0075435_1004931472 | 3300007076 | Populus Rhizosphere | MTKSTSSALLLAGGAVLACSVLFAQVQRPGEYPRGVKPSPMMNFF |
| Ga0075423_104596441 | 3300009162 | Populus Rhizosphere | MTKITSSALMVSGTVMLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDG |
| Ga0105242_105303031 | 3300009176 | Miscanthus Rhizosphere | MTTIKSSALMLSGMVALACSVLFAQVQRPGEYPRGVKPSPMMN |
| Ga0105248_126783311 | 3300009177 | Switchgrass Rhizosphere | MPKINTSALALVAIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFFVTSVPVGDGGNLGGL |
| Ga0116106_12275471 | 3300009645 | Peatland | MTKIKTSALLLSCTVFLASCLLLAQVQRPGEYPRGEKP |
| Ga0126373_116528772 | 3300010048 | Tropical Forest Soil | MTKIKTSALLLCCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTS |
| Ga0126377_101887761 | 3300010362 | Tropical Forest Soil | MTKIKSSALMLSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGD |
| Ga0126381_1042459261 | 3300010376 | Tropical Forest Soil | MTKIKSSVLILSGTVVLACGFLFAQVQRPGEYPRGVKPSPMMSFFV |
| Ga0134127_119099461 | 3300010399 | Terrestrial Soil | MTKIKTSVLLLSCTVSLASSLLLAQVQRPGEYPRGEKP |
| Ga0134122_125519171 | 3300010400 | Terrestrial Soil | MPKIKTSALALFGIVSLASCLLLAQTQRPGEYPRGETPSSMMNFFVTSVPVGDGGNLGGL |
| Ga0137391_105886141 | 3300011270 | Vadose Zone Soil | MTKIKTSALLLSCTVSLASGLLLAQVQRPGEYPRGEKPSPMMN |
| Ga0157321_10059002 | 3300012487 | Arabidopsis Rhizosphere | MTKIQSSALMLSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0137396_107746602 | 3300012918 | Vadose Zone Soil | VIYEKTSSALILSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPVGDGGNLGG |
| Ga0126375_103595431 | 3300012948 | Tropical Forest Soil | MTKVKSSALMFSGMVVLACSLLFAQVQRPGEYPRGV |
| Ga0164298_108753081 | 3300012955 | Soil | MTKITSSALLVAGTVVLACTLLFAQVQRPGEYPRGVKPSPTMNF |
| Ga0126369_121603441 | 3300012971 | Tropical Forest Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPVGDGGNLG |
| Ga0157374_128113811 | 3300013296 | Miscanthus Rhizosphere | MPQIKTIALALFGIVSVASCLLLAQTQRPGEYPRG |
| Ga0157378_131311941 | 3300013297 | Miscanthus Rhizosphere | MPRIKTSALALFGIVSLASCLLLAQTQRPGEYPRGETPSP |
| Ga0157375_102183491 | 3300013308 | Miscanthus Rhizosphere | MTKIKTSALLLSCTVSMAPCLLLAQVQRPGEYPRGEKSSPMMNFFVTSEPI |
| Ga0157375_109849552 | 3300013308 | Miscanthus Rhizosphere | MPEIKTAALALSGIVSVASCLLLAQTQRPGEYPRGEKPSPMMNFFVTS |
| Ga0181527_10314791 | 3300014153 | Bog | MTKIKTSALLLSCTVLLASCLLQAQVQRPGEYPRGENPSPTMNFFVTSVPIGDGGNLG |
| Ga0163163_107590112 | 3300014325 | Switchgrass Rhizosphere | MLKIETTALAFGIVSLASCLLLAQTQRPGEYPRGETASSMMNFFVTSVPVGDG |
| Ga0157376_101979161 | 3300014969 | Miscanthus Rhizosphere | MLSATVVLACGLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0157376_112350503 | 3300014969 | Miscanthus Rhizosphere | MIKVKTSALLLSCTVSLAPCLLLAQVQRPGEYPRGEK |
| Ga0157376_112522691 | 3300014969 | Miscanthus Rhizosphere | MTKIQSSALMLSGVFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0157376_121433942 | 3300014969 | Miscanthus Rhizosphere | MTKIQSSALMFSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDG |
| Ga0132258_121733762 | 3300015371 | Arabidopsis Rhizosphere | MTKIQSSALMLSGAFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGG |
| Ga0132258_127501811 | 3300015371 | Arabidopsis Rhizosphere | MPKINTSALALSGIVSLASCLLLAQTQKPGEYPRGETPSPMMN |
| Ga0132258_128355281 | 3300015371 | Arabidopsis Rhizosphere | METMPKIKTAALVSFGIVSLASCLLLAQTQRPREHPRGETPSSMINFFVTSVPVGD |
| Ga0132256_1027009242 | 3300015372 | Arabidopsis Rhizosphere | MTKIKSSALMFSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLG |
| Ga0132257_1012963942 | 3300015373 | Arabidopsis Rhizosphere | MTKIKSSVLIVSGTVVLACSLLFAQVQRPGEYPRG |
| Ga0132257_1025174511 | 3300015373 | Arabidopsis Rhizosphere | MTKIQSSALMFSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLG |
| Ga0132257_1041066042 | 3300015373 | Arabidopsis Rhizosphere | METMPKIKTAALVSFGIVSLASCLLLAQTQRPREHPRGETPSSMINFFVTSVPVG |
| Ga0132255_1005851933 | 3300015374 | Arabidopsis Rhizosphere | MRLDTVKIWIYMTKITSSALLVAGTVVLACTLLFAQVQRPGEYPRGVKPSPMMNFFVTS |
| Ga0132255_1021281911 | 3300015374 | Arabidopsis Rhizosphere | METMPKIKTTALALFGIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFF |
| Ga0132255_1061854682 | 3300015374 | Arabidopsis Rhizosphere | MTKMTSSALMVSGVVLACSLLFAQVQRPGEYPRGVK |
| Ga0182034_104189412 | 3300016371 | Soil | MTKIKTSPLLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0182034_118074951 | 3300016371 | Soil | MTKMQSSALMFSGAVVLACSLAFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0187802_101467453 | 3300017822 | Freshwater Sediment | MTKIITSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDGGNLGG |
| Ga0187803_102414122 | 3300017934 | Freshwater Sediment | MTKITSSALMLSCTVLLSSCLLLAQVQRPGEYPRGEK |
| Ga0187808_100376503 | 3300017942 | Freshwater Sediment | MTKIITSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDGGNLGGL |
| Ga0187817_102765172 | 3300017955 | Freshwater Sediment | MTKIITSALLLSCTVSLASCLLLAQVQRPGEYPRGEK |
| Ga0187817_109648361 | 3300017955 | Freshwater Sediment | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEP |
| Ga0187782_116514721 | 3300017975 | Tropical Peatland | MRKIEITALMLSGIVGLACSLLFAQIPKPGEYPRGLKPSPMMNFFVTSEPIGDGGN |
| Ga0187822_102349141 | 3300017994 | Freshwater Sediment | MTKLRPSALMLFCTVVLASSLLFDQVQKPGEYPRGEKPSPMMNFFV |
| Ga0184610_12893872 | 3300017997 | Groundwater Sediment | MPKIRTSALALFGIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFFV |
| Ga0187770_104944691 | 3300018090 | Tropical Peatland | MTNIRTSAALLSCTVSLASCLLLAQVQRPGEYPRGEKPSGM |
| Ga0210395_105617151 | 3300020582 | Soil | MTKIKTSALLLSSTVSLASCLLLAQVQRPGEYPRGQKPSPMMNFFVTSEPIGDG |
| Ga0210395_114487501 | 3300020582 | Soil | MTKIKSSALMLFGAVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSE |
| Ga0210401_108739132 | 3300020583 | Soil | MTKINSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEP |
| Ga0210380_101765991 | 3300021082 | Groundwater Sediment | MPRIKTTALALSGIVSLASCLLLAQTQRPGEYPRGETPSPMMNFFVTSVPVGDGGNL |
| Ga0210404_101039442 | 3300021088 | Soil | MTKIKTSALLLSCAVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDGGN |
| Ga0214195_10112601 | 3300021122 | Freshwater | MSKVKTLASKMRTSAMLLGFGVSLACGLSQAQVQRPGEYPRGEKPSPKMSFFV |
| Ga0210406_101499281 | 3300021168 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMM |
| Ga0210406_102755002 | 3300021168 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKP |
| Ga0210405_101711403 | 3300021171 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSDPIGDGGN |
| Ga0210405_112687581 | 3300021171 | Soil | MTKIKSSSLVVSTAAVLACGLLLAQVQRPGEYPRGEKPSPMMNFFVTSE |
| Ga0210396_116809832 | 3300021180 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPI |
| Ga0210388_115513342 | 3300021181 | Soil | MTKIKTSALLLSCTVSLAPYLLLAQVQRPGEYPRGEKPSPLMNFFVTS |
| Ga0210389_104280013 | 3300021404 | Soil | MTKIKTSALLLSCAVSLAPGLLLAQVQRPGEYPPGENP |
| Ga0210386_112199262 | 3300021406 | Soil | MTKIKTSALLLACTVSLVSGLLMAQVQRPGEFPRGETP |
| Ga0210386_114512061 | 3300021406 | Soil | MMKIKSSAPMLFGTVVQACSLLFAQVQRPGEYPRGVK |
| Ga0210386_115106491 | 3300021406 | Soil | MTKIKTSALLLSCTVSLASGLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIG |
| Ga0210384_102595372 | 3300021432 | Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPS |
| Ga0210391_113840352 | 3300021433 | Soil | MTKIKTSALLLACTVSLVSGLLMAQVQRPGEFPRGETPSPMMNFFVTSESIGDGGNLGGLAG |
| Ga0210409_104279533 | 3300021559 | Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSE |
| Ga0210409_109664892 | 3300021559 | Soil | MTKIKSSSLVVSTTAVLAWGLLLAQVQRPGEYPRGQKPSPMMNFFVTSEPVG |
| Ga0126371_109355281 | 3300021560 | Tropical Forest Soil | MAKIKSSALMLFGTVVLAGSLLFAQVQRPGEYPRGVKPSPMMNF |
| Ga0126371_137682881 | 3300021560 | Tropical Forest Soil | MTKIKSSALMLFGTIVLACSLLFAQVQRPGEYPRGV |
| Ga0207682_101261091 | 3300025893 | Miscanthus Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSE |
| Ga0207680_100949241 | 3300025903 | Switchgrass Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNLG |
| Ga0207707_103667251 | 3300025912 | Corn Rhizosphere | MTKIKSSALMLSGMVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPVGDGGN |
| Ga0207650_104148194 | 3300025925 | Switchgrass Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPM |
| Ga0207659_102474071 | 3300025926 | Miscanthus Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGV |
| Ga0207687_110993261 | 3300025927 | Miscanthus Rhizosphere | MPKIKTSALALFGIVSLASCLLLAQTQRPGEYPRGEQPSPMMNFFVTSVPVGDGGNLGGL |
| Ga0207701_104555523 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTKITSSALMVSGTVVLGCSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNL |
| Ga0207706_105983741 | 3300025933 | Corn Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNL |
| Ga0207669_107779051 | 3300025937 | Miscanthus Rhizosphere | MTKITSSALMVSGTVVLGCSLLFAQVQRPGEYPRGV |
| Ga0207704_105864061 | 3300025938 | Miscanthus Rhizosphere | MTKIQSSALMLSGVFLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGGN |
| Ga0207691_100589996 | 3300025940 | Miscanthus Rhizosphere | MVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNL |
| Ga0207691_109239261 | 3300025940 | Miscanthus Rhizosphere | MRNIQSSAPVLAGAVVLAGGLVFAQVQRPGEYPRGVKPSPMMSFFVTSEPVGDGGNL |
| Ga0207651_116485812 | 3300025960 | Switchgrass Rhizosphere | MRKTKIKTSALALCGIASLASGLLLAQTQRPGEYPRGETSSPMMTFFVTSVPVGDGGNL |
| Ga0207703_123033742 | 3300026035 | Switchgrass Rhizosphere | MTKITSSALMVSGTVMLACSLLFAQVQRPGEYPRGVKPSP |
| Ga0207708_103668802 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRINTSALALFGIVSLASCLLLAQTQRPGEYPRGEQPSPMMNFFV |
| Ga0207648_102700701 | 3300026089 | Miscanthus Rhizosphere | MPKIKTSALALFGIVSLASCLLLAQTQRPGEYPRGEKPSPMMNFFVTS |
| Ga0207676_102591011 | 3300026095 | Switchgrass Rhizosphere | MTMKSSALMLSGMVVLGCSLLFAQVQRPGEYPRGVKPSPMMNFFV |
| Ga0207674_106141983 | 3300026116 | Corn Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPI |
| Ga0207740_10461321 | 3300027011 | Tropical Forest Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMSFFVTSEPVGDGGNLG |
| Ga0209971_10602733 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGMKPSPMMSFFVTSEPIGD |
| Ga0209579_102074501 | 3300027869 | Surface Soil | MPKINTSALALFGIVSLASCLLLAQTQRPGEYPPGEKPSPMMNFFVT |
| Ga0209590_108130262 | 3300027882 | Vadose Zone Soil | MPKIRTSALALCAIVSLASCLLLAQTQRPGEYPRGE |
| Ga0209415_102316492 | 3300027905 | Peatlands Soil | MTKIKSSALVLFCTVSLASCLLLGQVQRPGEYPRGVKPSPMMNFFVTSEPVGDGGNL |
| Ga0209583_102802422 | 3300027910 | Watersheds | MTKIKSSALMLFCMLLLASCLLLAQRPKPGQYPPGAKPSPMMNFFVTSET |
| Ga0209526_102587181 | 3300028047 | Forest Soil | MIKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMSFFVTS |
| Ga0222749_101957433 | 3300029636 | Soil | MTKIKSSALMLSCTVLLASCLLLAQVPKPGEYPLGAKPSPMMNFFVTSEP |
| Ga0311371_116831631 | 3300029951 | Palsa | MTKIKTSALLLSCAVSLAPYLLLAQVQRPGEYPRGEKPSPMMNFFVTSESIGDGGNLGGLAG |
| Ga0311354_100578805 | 3300030618 | Palsa | MTKTKTSALLLSCTVSLAPCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPI |
| Ga0170823_167075801 | 3300031128 | Forest Soil | MTKIKTSALLLSCTVSLASSLLLAQVQRPGEYPRGEKP |
| Ga0307499_100662061 | 3300031184 | Soil | MPEIKTSALALLGIVSLASCLLLAQTQRPGEYPRGET |
| Ga0310686_1147679253 | 3300031708 | Soil | MTKIKSSALVLFCTVSLASCLLLGQVQRPGEYPRGQKPSPMMNFFVT |
| Ga0307476_106366121 | 3300031715 | Hardwood Forest Soil | MTKIKSSALVLFCTVSLASSLVLAQVQRPGEYPRGEKPSAKMNFFV |
| Ga0310813_105512663 | 3300031716 | Soil | MTKIISSALMVCGTVLLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSE |
| Ga0310907_104124293 | 3300031847 | Soil | MTKMKLSALMLSATVVLACGLLFAQVQRPGEYPRGVKPSPMMKFFVTSEPIGDGGNLGG |
| Ga0306923_117825522 | 3300031910 | Soil | MTKSKTSALLLSCTVSLVSCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGD |
| Ga0306921_127503771 | 3300031912 | Soil | MTKSKTSALLLSCTVSLVSCLLLAQVQRPGEYPRGEKPSPMMNFFVT |
| Ga0310912_113564601 | 3300031941 | Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDGGNL |
| Ga0310884_108372821 | 3300031944 | Soil | MTKITSSALMVSGTVVLGCSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGGNLGG |
| Ga0307479_103884642 | 3300031962 | Hardwood Forest Soil | MTKIKSSALVLFCTVSLASCLLLAQVQRPGEYPRGEKA |
| Ga0307479_107916821 | 3300031962 | Hardwood Forest Soil | MTKINTSSLLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPIGDG |
| Ga0307479_110922972 | 3300031962 | Hardwood Forest Soil | MTKIKSSVLVLFCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFF |
| Ga0318569_104819541 | 3300032010 | Soil | MTKIKTSPLLLSCTVSLASCLLLAQVQRPGEYPRGEKPS |
| Ga0310902_100275205 | 3300032012 | Soil | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSF |
| Ga0310890_107604811 | 3300032075 | Soil | MTKITSSALMVSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMSFFVTSEPIGDGG |
| Ga0315912_107667801 | 3300032157 | Soil | MTKVTSSALMVSGMVVLACSLLFAQVHRPGEYPRGVKPS |
| Ga0311301_102311455 | 3300032160 | Peatlands Soil | MTKTKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSP |
| Ga0315281_123269271 | 3300032163 | Sediment | VPTIKTSALALSGIVSLASCLLLAQTQRPGEYPRGEQ |
| Ga0306920_1008737453 | 3300032261 | Soil | MTKIKTSALLLSCTVSLASCLLLAQVQRPGEYPRGEKPSPMMNFFVTSEPI |
| Ga0335081_117225391 | 3300032892 | Soil | MTKITSSALVLLGGVSLASCLLLAQVQRPGEYPRGAKPSAMMNFFVTSVPI |
| Ga0335083_109659333 | 3300032954 | Soil | MTKIKSSALMLSCTVVLACSMLFAQGIPKPGEYPPGA |
| Ga0310810_110448222 | 3300033412 | Soil | MTKIESSALMLSGAVVLACSLVFAQVQRPGEYPRGVKPSPMMNFFVTSEPIGDGEIAPGMLT |
| Ga0326726_107029371 | 3300033433 | Peat Soil | MTKIKSSALMLSGTVVLACSLLFAQVQRPGEYPRGVKPSPMMNFFVTSEPI |
| ⦗Top⦘ |