


| Basic Information | |
|---|---|
| Family ID | F032636 |
| Family Type | Metagenome |
| Number of Sequences | 179 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI |
| Number of Associated Samples | 127 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 3.37 % |
| % of genes near scaffold ends (potentially truncated) | 24.58 % |
| % of genes from short scaffolds (< 2000 bps) | 86.03 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (81.564 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (29.050 % of family members) |
| Environment Ontology (ENVO) | Unclassified (66.480 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (45.251 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.22% β-sheet: 0.00% Coil/Unstructured: 77.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF09250 | Prim-Pol | 20.11 |
| PF12850 | Metallophos_2 | 1.68 |
| PF09723 | Zn-ribbon_8 | 1.68 |
| PF05869 | Dam | 1.12 |
| PF03354 | TerL_ATPase | 0.56 |
| PF00149 | Metallophos | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.47 % |
| Unclassified | root | N/A | 14.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002294|B570J29584_1005515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300002408|B570J29032_109108629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300005527|Ga0068876_10005764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8517 | Open in IMG/M |
| 3300005527|Ga0068876_10112719 | All Organisms → cellular organisms → Bacteria | 1617 | Open in IMG/M |
| 3300005581|Ga0049081_10190726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300005582|Ga0049080_10168761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 729 | Open in IMG/M |
| 3300005662|Ga0078894_10164181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2001 | Open in IMG/M |
| 3300005662|Ga0078894_11204459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
| 3300005805|Ga0079957_1134544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1283 | Open in IMG/M |
| 3300006639|Ga0079301_1185659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300006802|Ga0070749_10324879 | Not Available | 859 | Open in IMG/M |
| 3300006802|Ga0070749_10354472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
| 3300006802|Ga0070749_10664376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
| 3300006805|Ga0075464_10077945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1877 | Open in IMG/M |
| 3300006805|Ga0075464_10208639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1161 | Open in IMG/M |
| 3300006805|Ga0075464_10625743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300006805|Ga0075464_10951949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300006805|Ga0075464_10985304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300006805|Ga0075464_11024308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300006920|Ga0070748_1145349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 884 | Open in IMG/M |
| 3300007540|Ga0099847_1128827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300007559|Ga0102828_1012237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1776 | Open in IMG/M |
| 3300007973|Ga0105746_1343246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300008114|Ga0114347_1261559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300008119|Ga0114354_1276706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300008266|Ga0114363_1040444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1908 | Open in IMG/M |
| 3300008266|Ga0114363_1162697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300008266|Ga0114363_1240270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300008450|Ga0114880_1083856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300008450|Ga0114880_1245503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300009026|Ga0102829_1144087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300009051|Ga0102864_1133588 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
| 3300009111|Ga0115026_11658257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300009146|Ga0105091_10200173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
| 3300009152|Ga0114980_10087277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1869 | Open in IMG/M |
| 3300009164|Ga0114975_10507200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300009169|Ga0105097_10317833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
| 3300009169|Ga0105097_10642599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300010354|Ga0129333_11186914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300010885|Ga0133913_13504233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
| 3300012663|Ga0157203_1049368 | Not Available | 571 | Open in IMG/M |
| 3300013004|Ga0164293_10812063 | Not Available | 592 | Open in IMG/M |
| 3300013006|Ga0164294_10266451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
| 3300013014|Ga0164295_11307575 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300013295|Ga0170791_13422290 | Not Available | 879 | Open in IMG/M |
| 3300013372|Ga0177922_10339644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300013372|Ga0177922_10882443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 873 | Open in IMG/M |
| 3300013372|Ga0177922_11345082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
| 3300017701|Ga0181364_1069450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300017707|Ga0181363_1012710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1713 | Open in IMG/M |
| 3300017716|Ga0181350_1136043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300017722|Ga0181347_1079817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
| 3300017747|Ga0181352_1027387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1734 | Open in IMG/M |
| 3300017747|Ga0181352_1066543 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300017774|Ga0181358_1059439 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
| 3300017777|Ga0181357_1221045 | Not Available | 668 | Open in IMG/M |
| 3300017780|Ga0181346_1206154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300017784|Ga0181348_1114653 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1040 | Open in IMG/M |
| 3300017785|Ga0181355_1097111 | Not Available | 1220 | Open in IMG/M |
| 3300017785|Ga0181355_1309682 | Not Available | 590 | Open in IMG/M |
| 3300018790|Ga0187842_1134158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
| 3300018815|Ga0187845_1110237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300019093|Ga0187843_10298230 | Not Available | 661 | Open in IMG/M |
| 3300019784|Ga0181359_1005983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4019 | Open in IMG/M |
| 3300020151|Ga0211736_10556244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
| 3300020159|Ga0211734_10677808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300020161|Ga0211726_10818615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
| 3300020172|Ga0211729_10471904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3164 | Open in IMG/M |
| 3300020501|Ga0208590_1017935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 833 | Open in IMG/M |
| 3300020527|Ga0208232_1000772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6149 | Open in IMG/M |
| 3300020529|Ga0208233_1011402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1269 | Open in IMG/M |
| 3300020536|Ga0207939_1036768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 626 | Open in IMG/M |
| 3300020571|Ga0208723_1001843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4644 | Open in IMG/M |
| 3300020571|Ga0208723_1005811 | All Organisms → Viruses → Predicted Viral | 2280 | Open in IMG/M |
| 3300020571|Ga0208723_1020073 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300021092|Ga0194122_10660983 | Not Available | 511 | Open in IMG/M |
| 3300021956|Ga0213922_1041557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1055 | Open in IMG/M |
| 3300021962|Ga0222713_10160488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1541 | Open in IMG/M |
| 3300021963|Ga0222712_10012060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7708 | Open in IMG/M |
| 3300022190|Ga0181354_1098251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 955 | Open in IMG/M |
| 3300022190|Ga0181354_1198338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
| 3300022407|Ga0181351_1034799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2137 | Open in IMG/M |
| 3300025896|Ga0208916_10147744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
| 3300027144|Ga0255102_1013991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1487 | Open in IMG/M |
| 3300027156|Ga0255078_1057757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300027193|Ga0208800_1009888 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
| 3300027563|Ga0209552_1058575 | Not Available | 1080 | Open in IMG/M |
| 3300027631|Ga0208133_1132783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300027659|Ga0208975_1175500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027697|Ga0209033_1033264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1967 | Open in IMG/M |
| 3300027721|Ga0209492_1201705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 683 | Open in IMG/M |
| 3300027734|Ga0209087_1017553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3553 | Open in IMG/M |
| 3300027756|Ga0209444_10084120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1339 | Open in IMG/M |
| 3300027759|Ga0209296_1257340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027763|Ga0209088_10222766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 796 | Open in IMG/M |
| 3300027764|Ga0209134_10264150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300027764|Ga0209134_10288853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300027769|Ga0209770_10060583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300027782|Ga0209500_10165708 | Not Available | 1026 | Open in IMG/M |
| 3300027785|Ga0209246_10162443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 877 | Open in IMG/M |
| 3300027798|Ga0209353_10098686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1319 | Open in IMG/M |
| 3300027808|Ga0209354_10170551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300027808|Ga0209354_10244819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
| 3300027816|Ga0209990_10009709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6042 | Open in IMG/M |
| 3300027816|Ga0209990_10043945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2312 | Open in IMG/M |
| 3300027956|Ga0209820_1119300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300027969|Ga0209191_1076370 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1471 | Open in IMG/M |
| 3300027974|Ga0209299_1320659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
| 3300028025|Ga0247723_1011092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3474 | Open in IMG/M |
| 3300028025|Ga0247723_1021737 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
| 3300028025|Ga0247723_1048747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300028027|Ga0247722_10326190 | Not Available | 521 | Open in IMG/M |
| 3300031566|Ga0307378_10281488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1583 | Open in IMG/M |
| 3300031758|Ga0315907_10077730 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2865 | Open in IMG/M |
| 3300031758|Ga0315907_10446453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1034 | Open in IMG/M |
| 3300031772|Ga0315288_10547651 | Not Available | 1129 | Open in IMG/M |
| 3300031857|Ga0315909_10012511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8884 | Open in IMG/M |
| 3300031857|Ga0315909_10280065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1260 | Open in IMG/M |
| 3300031873|Ga0315297_10826875 | Not Available | 772 | Open in IMG/M |
| 3300031952|Ga0315294_10359000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1379 | Open in IMG/M |
| 3300031997|Ga0315278_10723612 | Not Available | 1011 | Open in IMG/M |
| 3300031999|Ga0315274_10355895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1718 | Open in IMG/M |
| 3300032053|Ga0315284_11218915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
| 3300032116|Ga0315903_10360340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1201 | Open in IMG/M |
| 3300032116|Ga0315903_10375720 | Not Available | 1167 | Open in IMG/M |
| 3300032116|Ga0315903_11221744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
| 3300032177|Ga0315276_11134365 | Not Available | 827 | Open in IMG/M |
| 3300032401|Ga0315275_12176534 | Not Available | 581 | Open in IMG/M |
| 3300033816|Ga0334980_0313821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
| 3300033980|Ga0334981_0104648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1399 | Open in IMG/M |
| 3300033981|Ga0334982_0195830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300033992|Ga0334992_0492631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300033993|Ga0334994_0079971 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1961 | Open in IMG/M |
| 3300033993|Ga0334994_0194806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1101 | Open in IMG/M |
| 3300033996|Ga0334979_0009056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6904 | Open in IMG/M |
| 3300034019|Ga0334998_0156335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1456 | Open in IMG/M |
| 3300034019|Ga0334998_0364663 | Not Available | 839 | Open in IMG/M |
| 3300034061|Ga0334987_0043859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3774 | Open in IMG/M |
| 3300034061|Ga0334987_0067917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2864 | Open in IMG/M |
| 3300034061|Ga0334987_0464067 | Not Available | 782 | Open in IMG/M |
| 3300034061|Ga0334987_0762408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300034061|Ga0334987_0792664 | Not Available | 529 | Open in IMG/M |
| 3300034062|Ga0334995_0158852 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1621 | Open in IMG/M |
| 3300034062|Ga0334995_0436760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300034062|Ga0334995_0592857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300034071|Ga0335028_0001732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15704 | Open in IMG/M |
| 3300034073|Ga0310130_0002611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8292 | Open in IMG/M |
| 3300034082|Ga0335020_0012111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5144 | Open in IMG/M |
| 3300034092|Ga0335010_0191856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1255 | Open in IMG/M |
| 3300034092|Ga0335010_0217283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
| 3300034092|Ga0335010_0236587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300034092|Ga0335010_0251947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
| 3300034092|Ga0335010_0613839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300034092|Ga0335010_0685673 | Not Available | 506 | Open in IMG/M |
| 3300034093|Ga0335012_0402199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
| 3300034101|Ga0335027_0127362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1901 | Open in IMG/M |
| 3300034101|Ga0335027_0452034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 818 | Open in IMG/M |
| 3300034101|Ga0335027_0622801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
| 3300034101|Ga0335027_0701629 | Not Available | 600 | Open in IMG/M |
| 3300034101|Ga0335027_0842939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300034102|Ga0335029_0629406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300034103|Ga0335030_0352106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 970 | Open in IMG/M |
| 3300034104|Ga0335031_0647989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 615 | Open in IMG/M |
| 3300034104|Ga0335031_0719360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
| 3300034106|Ga0335036_0084312 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2361 | Open in IMG/M |
| 3300034106|Ga0335036_0313984 | Not Available | 1037 | Open in IMG/M |
| 3300034106|Ga0335036_0330191 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300034111|Ga0335063_0457315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300034112|Ga0335066_0152610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1408 | Open in IMG/M |
| 3300034112|Ga0335066_0230341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300034117|Ga0335033_0413347 | Not Available | 663 | Open in IMG/M |
| 3300034118|Ga0335053_0446038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300034272|Ga0335049_0084198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2329 | Open in IMG/M |
| 3300034283|Ga0335007_0698670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300034284|Ga0335013_0611155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300034355|Ga0335039_0403810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300034355|Ga0335039_0456195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
| 3300034355|Ga0335039_0474538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 29.05% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 17.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.15% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.03% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.91% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.35% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.23% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.23% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.12% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.12% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.68% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.68% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.56% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.56% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.56% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.56% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.56% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.56% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027193 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29584_10055151 | 3300002294 | Freshwater | FQLTKMAVLQLLESLMGRETDYIDRTIDDHIDDIEDIGVI* |
| B570J29032_1091086293 | 3300002408 | Freshwater | SAMTALSDTIKGIMGRETDYQPRTIDDHIDDFEDISVI* |
| Ga0068876_100057648 | 3300005527 | Freshwater Lake | MAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI* |
| Ga0068876_101127194 | 3300005527 | Freshwater Lake | MAVSQLLESLMGRETDYHERTIDDHIDDFEDISVI* |
| Ga0049081_101907262 | 3300005581 | Freshwater Lentic | MAHSQLLESRMGLETDYRDRTIDDHIDQFEALGVI* |
| Ga0049080_101687612 | 3300005582 | Freshwater Lentic | MAVSQLLESRMGLETDYKHRTIDDHIDDLEDIGVI* |
| Ga0078894_101641811 | 3300005662 | Freshwater Lake | MAHSQLLESRMGLETDYRDRTIDDHIDEFEDLGVI* |
| Ga0078894_112044592 | 3300005662 | Freshwater Lake | MAHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI* |
| Ga0079957_11345443 | 3300005805 | Lake | MTDHSPIIDGLMGLETDYHERTIDDHIDDFEDISVI* |
| Ga0079301_11856592 | 3300006639 | Deep Subsurface | MAVSQLLESLMGLETDYHERTIDDHIDDFEDISVI* |
| Ga0070749_103248793 | 3300006802 | Aqueous | MMGHLPTIEGLMGRETDYRDRTIDDHIDDFEDISVI* |
| Ga0070749_103544721 | 3300006802 | Aqueous | RSFRLIMTGHLPIIEGRMGLETDYRDRTIDDHIDEFEEIGVI* |
| Ga0070749_106643761 | 3300006802 | Aqueous | MAALHITGNPMGRETDYHERTIDDHIDDFEDLSVI* |
| Ga0075464_100779456 | 3300006805 | Aqueous | MTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGVI* |
| Ga0075464_102086395 | 3300006805 | Aqueous | LRLFQSTKMDHLQLLESRMECETDYQPRTIDDHIDAVEALGFI* |
| Ga0075464_106257431 | 3300006805 | Aqueous | MAVSQLLESLMGRETDYIERTIDTHIDEFEDLGVI* |
| Ga0075464_109519491 | 3300006805 | Aqueous | AHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI* |
| Ga0075464_109853041 | 3300006805 | Aqueous | MAHLPRLEGRMGLETDYRDRTIDDHIDEFEDLGVI* |
| Ga0075464_110243081 | 3300006805 | Aqueous | TKMEVLQLLESLMECETDYIPRTIDDHIDTVEGFGFI* |
| Ga0070748_11453493 | 3300006920 | Aqueous | MAHLQLLESLMGRETDYQPRTIDDHIDDFEDISVI* |
| Ga0099847_11288273 | 3300007540 | Aqueous | MTDHLPTIEGLMGLETDYRDRTIDDHIDDLEDLGVI* |
| Ga0102828_10122371 | 3300007559 | Estuarine | MGHLPTTEGLMGLETDYKHRTIDDHIDDLEDISVI* |
| Ga0105746_13432461 | 3300007973 | Estuary Water | MTDHSDIIKGTMGRETDYNDRTIDDHIDELEDLGVI* |
| Ga0114347_12615592 | 3300008114 | Freshwater, Plankton | MAALLIIGNLMGHETDYHTRTIDDHIDDLEDLGVI* |
| Ga0114354_12767062 | 3300008119 | Freshwater, Plankton | MTDHLPIIDGLMGLETDYRDRTIDDHIDDLEDLGVI* |
| Ga0114363_10404441 | 3300008266 | Freshwater, Plankton | MAALLIIGSLMGRETDYHERTIDDHIDNFEDLGVI* |
| Ga0114363_11626971 | 3300008266 | Freshwater, Plankton | DHSPIIDGLMGLETDYHERTIDDHIDDFEDISVI* |
| Ga0114363_12402703 | 3300008266 | Freshwater, Plankton | MAALPITGNPMGRETDYHERTIDDHIDDLEDLSVI* |
| Ga0114880_10838565 | 3300008450 | Freshwater Lake | VHSDTIKGLMGRETDYQPRTIDDHIDDFEDLFVI* |
| Ga0114880_12455033 | 3300008450 | Freshwater Lake | AVSQLLESLMGRETDYHDRTIDDHIDELEDIGVI* |
| Ga0102829_11440872 | 3300009026 | Estuarine | MAVSQLLESRMGLETDYRDRTIDDHIDDFEDISVI* |
| Ga0102864_11335882 | 3300009051 | Estuarine | MDHLPTIEGLMGLETDYKHRTIDDHIDDLEDIGVI* |
| Ga0115026_116582571 | 3300009111 | Wetland | MTDLSDTIKGIMGRETDYQPRTIDTHIDEFEDLGVI* |
| Ga0105091_102001734 | 3300009146 | Freshwater Sediment | MMAHLHIIEGLMGRETDYRDRTIDEHIDDFEDISVISSL* |
| Ga0114980_100872771 | 3300009152 | Freshwater Lake | RLFQSTKMDHLQLLESPMECETDYQPRTIDDHIDAFEALSVI* |
| Ga0114975_105072001 | 3300009164 | Freshwater Lake | MAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI* |
| Ga0105104_103262941 | 3300009168 | Freshwater Sediment | SQLTKMAALPIIGSPMGRETDYHERTIDDHIDDFEDLFVI* |
| Ga0105097_103178331 | 3300009169 | Freshwater Sediment | IKMAHLQLLESLMGRETDFRDRTIDDHIDDFEDISVI* |
| Ga0105097_106425991 | 3300009169 | Freshwater Sediment | MTDHSDLIKGIMGRETDYIDRTIDDHIDELEDLGVI* |
| Ga0129333_111869141 | 3300010354 | Freshwater To Marine Saline Gradient | QLTKMGHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI* |
| Ga0133913_135042334 | 3300010885 | Freshwater Lake | TDHSDTIKGIMGRETDYIERTIDTHIDEFEDLSVI* |
| Ga0157203_10493682 | 3300012663 | Freshwater | MDHLLTTEGLMGLETDYKHRTIDDHIDDVEDIGVI* |
| Ga0164293_108120632 | 3300013004 | Freshwater | MMAVSHTTEGLMGLETDYRDRSIDDHIDEFEDIGVI* |
| Ga0164294_102664514 | 3300013006 | Freshwater | MDHLLTTEGLMGLETDYKHRTIDEHIDDLEDIGVI* |
| Ga0164295_113075753 | 3300013014 | Freshwater | MGHLLTTERLMGLETDYKHRTIDEHIDDLEDIGVI* |
| Ga0170791_134222901 | 3300013295 | Freshwater | MGHLHTTEGLMGLETDYKHRTIDDHIDDFEDISVI* |
| Ga0177922_103396441 | 3300013372 | Freshwater | FQSIKMAVSQLLESRMGLETDYKHRTIDDHIDEFEDIGVI* |
| Ga0177922_108824433 | 3300013372 | Freshwater | AHSATISVLMGLETDYRDRSIDDHIDEFEDINVI* |
| Ga0177922_113450821 | 3300013372 | Freshwater | KMAVSQLLESRMGLETDYKHRTIDDHIDDLEDIGVI* |
| Ga0181364_10694502 | 3300017701 | Freshwater Lake | MMGHSATISVLMGRETDYIERTIDTHIDEFEDLGVI |
| Ga0181363_10127106 | 3300017707 | Freshwater Lake | MGHSQHLEGRMGLETDYRDRTIDDHIDELEEIGVI |
| Ga0181350_11360431 | 3300017716 | Freshwater Lake | MGHLHTTEGLMGLETDYKHRTIDDHIDDFEDISVI |
| Ga0181347_10798171 | 3300017722 | Freshwater Lake | MTDHLDTIKGLMGRETDYIDRTIDDHIDDVEDLGVI |
| Ga0181352_10273872 | 3300017747 | Freshwater Lake | MGHSQHLEGRMGLETDYRDRTIDDHIDEFEEIGVI |
| Ga0181352_10665433 | 3300017747 | Freshwater Lake | MTDHLPIIDGLMGRETDYIDRTIDEHIDDIEDLGVI |
| Ga0181358_10594393 | 3300017774 | Freshwater Lake | MVHLPITEGLMGFETDYKHRTIDDHIDDFEDIGVI |
| Ga0181357_12210452 | 3300017777 | Freshwater Lake | MAVLHTTEGLMGLETDYRDRSIDDHIDKFEDIGVI |
| Ga0181346_12061543 | 3300017780 | Freshwater Lake | MVHLQLLESLMGRETDYIDRTIDDHIDDLEDIGVI |
| Ga0181348_11146531 | 3300017784 | Freshwater Lake | IMTDHSDTTKGIMGRETDYHERTIDDHIDDLEDIGVI |
| Ga0181355_10971113 | 3300017785 | Freshwater Lake | MMVHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0181355_13096822 | 3300017785 | Freshwater Lake | LFRLTKMAVSQLLESRMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0187842_11341583 | 3300018790 | Freshwater | LFQSIKMEVLQLLESHMECETDYQPRTIDDHIDTVEALGFI |
| Ga0187845_11102372 | 3300018815 | Freshwater | MEVLQLLESHMECETDYQPRTIDDHIDAVEALGFI |
| Ga0187843_102982301 | 3300019093 | Freshwater | IKMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0181359_10059833 | 3300019784 | Freshwater Lake | MAVLQLSESLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0211736_105562442 | 3300020151 | Freshwater | MAHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0211734_106778083 | 3300020159 | Freshwater | MMVHSATISVLMGRETDYIERTIDTHIDEFEDLGVI |
| Ga0211726_108186154 | 3300020161 | Freshwater | MMGLSDTTKGIMGLETDYRDRTIDDHIDQFEALGVI |
| Ga0211729_104719041 | 3300020172 | Freshwater | QSIMTDHSDTIKGIMGRETDYIERTIDTHIDEFEDIGIL |
| Ga0208590_10179352 | 3300020501 | Freshwater | MTDHLPIIDGLMGLETDYHERTIDDHIDDFEDISVI |
| Ga0208232_10007722 | 3300020527 | Freshwater | MAVLQLLESLMGRETDYIDRTIDDHIDDIEDIGVI |
| Ga0208233_10114024 | 3300020529 | Freshwater | MTDHLHIIDGLMGLETDYHERTIDDHIDDFEDISVI |
| Ga0207939_10367682 | 3300020536 | Freshwater | MAVSQLLESLMGRETDYHDRTIDDHIDELEDLGVI |
| Ga0208723_10018438 | 3300020571 | Freshwater | MTAALDTTSGLMGLNTDYKDRTIDDHIDDFDAIGVL |
| Ga0208723_10058114 | 3300020571 | Freshwater | MAASLIIGSLMGRETDYHERTIDDHIDDFEDLFVI |
| Ga0208723_10200734 | 3300020571 | Freshwater | TDHSDLIKGTMGRETDYNDRTIDDHIDELEDLGVI |
| Ga0194122_106609831 | 3300021092 | Freshwater Lake | FQSIKMAVLLHVERVMGLETDYIDRTIDDHIDDLEDIGVI |
| Ga0213922_10415574 | 3300021956 | Freshwater | MMDRLPITEGHMGLETDYRDRTIDDHIDQFEDIGVI |
| Ga0222713_101604885 | 3300021962 | Estuarine Water | IQLNLYQSAMMALFDTIKGIMGRETDYQPRTIDDHIDDFEDISVI |
| Ga0222712_100120609 | 3300021963 | Estuarine Water | MAALLMAENPMGRETDYQPRTIDDHIDQVEDIGVI |
| Ga0181354_10982512 | 3300022190 | Freshwater Lake | MMAVLHIIEGLMGFETDYRDRSIDDHIDDFEDIGVI |
| Ga0181354_11983381 | 3300022190 | Freshwater Lake | MTDLFDLIKGIMGRETDYIERTIDTHIDEFEDLSVI |
| Ga0181351_10347996 | 3300022407 | Freshwater Lake | MAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0208916_101477444 | 3300025896 | Aqueous | QSTKMAHLQLLESRMECETDYQPRTIDDHIDAVEALGFI |
| Ga0255102_10139912 | 3300027144 | Freshwater | MAVSQLLESRMGLETDYKDRTIDDHIDELEDIGVI |
| Ga0255078_10577573 | 3300027156 | Freshwater | MAHLLTIDGLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0208800_10098884 | 3300027193 | Estuarine | MTDHLDTIKGIMGRETDYIDRTIDDHIDDLEDISVI |
| Ga0209552_10585751 | 3300027563 | Freshwater Lake | MGHLPITEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0208133_11327833 | 3300027631 | Estuarine | MGHLQLLESRMECETDYQPRTIDDHIDAVEALGFI |
| Ga0208975_11755001 | 3300027659 | Freshwater Lentic | MAVSQLLESLMGRETDYIDRTIDDHIDDIEDIGVI |
| Ga0209033_10332642 | 3300027697 | Freshwater Lake | MAVLQLLESLMGRETDYIERTIDTHIDEFEDLGVI |
| Ga0209492_12017052 | 3300027721 | Freshwater Sediment | MAHLQLSESLMGRETDYRDRTIDDHIDDFEDISVI |
| Ga0209087_10175534 | 3300027734 | Freshwater Lake | MAVSQLLESRMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0209444_100841204 | 3300027756 | Freshwater Lake | MGHLPTTEGLMGLETDYKHRTIDDHIDDFEDISVI |
| Ga0209296_12573403 | 3300027759 | Freshwater Lake | KTAVSQLLESLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0209088_102227662 | 3300027763 | Freshwater Lake | MAVLQLLESRMECETDYQPRTIDDHIDAVEALGFI |
| Ga0209134_102641501 | 3300027764 | Freshwater Lake | PLLFQSIKMAVLQLLESLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0209134_102888533 | 3300027764 | Freshwater Lake | LITMAHSATISVLMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0209770_100605834 | 3300027769 | Freshwater Lake | MAHSQLLESRMGLETDYRDRTIDDHIDEFEDLGVI |
| Ga0209500_101657081 | 3300027782 | Freshwater Lake | MMDHSATISVLMGRKTDYIERTIDTHIDEFEDLGVI |
| Ga0209246_101624431 | 3300027785 | Freshwater Lake | MDHLLTTEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0209353_100986863 | 3300027798 | Freshwater Lake | MMVHSATISVPMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0209354_101705511 | 3300027808 | Freshwater Lake | LSIKMAVSQLLESRMGLETDYKHRTIDDHIDDFEDISVI |
| Ga0209354_102448192 | 3300027808 | Freshwater Lake | MMAVLHTTEGLMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0209990_1000970911 | 3300027816 | Freshwater Lake | MAHLQLLESLMGRETDYRDRTIDDHIDDFEDISVI |
| Ga0209990_100439454 | 3300027816 | Freshwater Lake | MAVSQLLESLMGRETDYHERTIDDHIDDFEDISVI |
| Ga0209820_11193003 | 3300027956 | Freshwater Sediment | MAHLQLLERVMGRETDYRDRTIDDHIDDFEDISVI |
| Ga0209191_10763705 | 3300027969 | Freshwater Lake | IKMEVLQLLESLMECETDYQPRTIDDHIDAVEALGFI |
| Ga0209299_13206593 | 3300027974 | Freshwater Lake | MEVSQLLESLMGRETDYIDRTIDDHIDDVEDLGVI |
| Ga0247723_10110925 | 3300028025 | Deep Subsurface Sediment | MTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0247723_10217373 | 3300028025 | Deep Subsurface Sediment | MMGHSAIISVLMGRETDYIERTIDTHIDEFEDLGVI |
| Ga0247723_10487472 | 3300028025 | Deep Subsurface Sediment | MVHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0247722_103261903 | 3300028027 | Deep Subsurface Sediment | MAVLQLSESRMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0307378_102814884 | 3300031566 | Soil | MAALLIIGSLMGRETDYHERTIDDHIDDLEDLGVI |
| Ga0315907_100777308 | 3300031758 | Freshwater | MAALPIIGSLMGLETDYKDRSIDDHIDDLEDLGVI |
| Ga0315907_104464534 | 3300031758 | Freshwater | IVKFRLFLSRLTQMAALYLRVRSMGRETDYHERTIDDHIDDFEDISVI |
| Ga0315288_105476512 | 3300031772 | Sediment | MDHLPTTEGLMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0315909_1001251111 | 3300031857 | Freshwater | MAALLIIGSLMGRETDYHERTIDDHIDDLEDIGVI |
| Ga0315909_102800655 | 3300031857 | Freshwater | MMVHSDTTKGLMGRETDYQPRTIDDHIDDFEDLFVI |
| Ga0315297_108268753 | 3300031873 | Sediment | MDHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0315294_103590005 | 3300031952 | Sediment | QLIKMGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0315278_107236123 | 3300031997 | Sediment | MGHLPTTEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0315274_103558951 | 3300031999 | Sediment | MGHLPIIEGLMGLETDYKHRTIDDHIDDFEDISVI |
| Ga0315284_112189151 | 3300032053 | Sediment | MGHLLTTEGLMGLETDYKHRTIDDHIDDFEDIGVI |
| Ga0315903_103603402 | 3300032116 | Freshwater | MAHSQLLESLMGRETDYIDRTIDDHIDDVEDIGVI |
| Ga0315903_103757201 | 3300032116 | Freshwater | MMGHSATISVLMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0315903_112217442 | 3300032116 | Freshwater | MTDHSDTIKGIMGRETDYNDRTIDDHIDELEDLGVI |
| Ga0315276_111343653 | 3300032177 | Sediment | MGHLPTIEGLMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0315275_121765341 | 3300032401 | Sediment | MVHLPTTEGLMGLETDYKHRTIDDHIDDFEDIGVI |
| Ga0334980_0313821_474_581 | 3300033816 | Freshwater | MAVSQLLESLMGLETDYHERTIDDHIDDFEDISVI |
| Ga0334981_0104648_1240_1347 | 3300033980 | Freshwater | MAASPIIGSLMGRETDYHERTIDDHIDDFEDLFVI |
| Ga0334982_0195830_890_997 | 3300033981 | Freshwater | MAVLQLLESRMGFETDYRDRSIDDHIDEFEDIGVI |
| Ga0334992_0492631_70_177 | 3300033992 | Freshwater | MAVSQLLESRMGFETDYRDRSIDDHIDEFEDIGVI |
| Ga0334994_0079971_441_548 | 3300033993 | Freshwater | MAHLQLLERVMGLETDYRVRTIDDHIDDFEDISVI |
| Ga0334994_0194806_308_415 | 3300033993 | Freshwater | MAVSQLLESRMGFETDYKHRTIDDHIDDLEDIGVI |
| Ga0334979_0009056_2858_2968 | 3300033996 | Freshwater | MTDRSDTIKGIMGRETDYKDRTIDDHIDELEDLGVI |
| Ga0334998_0156335_290_397 | 3300034019 | Freshwater | MAVLQLLESLMGRETDYIDRTIDDHIDDVEDLGVI |
| Ga0334998_0364663_713_820 | 3300034019 | Freshwater | MAVSQLLESRMGLETDYKHRTIDDHIDDFENISVI |
| Ga0334987_0043859_2609_2719 | 3300034061 | Freshwater | MTDHLPIIDELMGLETDYLERTIDDHIDDIEDIGVI |
| Ga0334987_0067917_1795_1902 | 3300034061 | Freshwater | MAVSQLLESRMGLETDYKHRTIDDHIDEFEDIGVI |
| Ga0334987_0464067_202_312 | 3300034061 | Freshwater | MMDHLPTIEGLMGLETDYRIRTIDDHIDDFEDIGVI |
| Ga0334987_0762408_385_495 | 3300034061 | Freshwater | MTDHSDTIKGIMGRETDYIERTIDTHIDEFDDLSVI |
| Ga0334987_0792664_140_250 | 3300034061 | Freshwater | MTDPSDTIKGIMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0334995_0158852_968_1078 | 3300034062 | Freshwater | MTDHSDSIKGIMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0334995_0436760_688_795 | 3300034062 | Freshwater | MAVLQLLESLMGRETDYIDRTIDDHIDDLEDISVI |
| Ga0334995_0592857_305_415 | 3300034062 | Freshwater | MTDHLPTIEGLMGLETDYRDRTIDDHIDDFEDLGVI |
| Ga0335028_0001732_15439_15546 | 3300034071 | Freshwater | MAVLQHLESRMGLETDYKHRTIDDHIDDFEDIGVI |
| Ga0310130_0002611_298_408 | 3300034073 | Fracking Water | MMAHLHTIEGLMGRETDYRDRTIDDHIDDFEDISVI |
| Ga0335020_0012111_2750_2860 | 3300034082 | Freshwater | MMAVLHTIEGLMGLETDYRDRSIDDHIDEFENIGVI |
| Ga0335010_0191856_249_356 | 3300034092 | Freshwater | MAHSQLLESRMGLETDYQPRTIDDHIDQFEALGVI |
| Ga0335010_0217283_438_548 | 3300034092 | Freshwater | MTDHLPTIEGLMGRETDYRDRTIDDHIDDFEDIGVI |
| Ga0335010_0236587_630_737 | 3300034092 | Freshwater | MAHSQLLESRMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0335010_0251947_225_335 | 3300034092 | Freshwater | MMAVLHTTEGLMGLETDYRDRSIDDHIDKFEDIGVI |
| Ga0335010_0613839_169_276 | 3300034092 | Freshwater | MDHLQLLESRMGLETDYRDRTIDDHIDDLEDLGVI |
| Ga0335010_0685673_310_420 | 3300034092 | Freshwater | MTDHSDTIKGIMGRETDYNDRTIDDHIDELEDLGVV |
| Ga0335012_0402199_62_169 | 3300034093 | Freshwater | MAVSQLLESRMGLETDYKHRTIDDHIDDFEDIGVI |
| Ga0335027_0127362_1578_1685 | 3300034101 | Freshwater | MAVSQLLESLMECETEYQPRTIDDHIDAIEALGFI |
| Ga0335027_0452034_431_538 | 3300034101 | Freshwater | MAHLQLSESLMGRETDFKDRTIDDHIDDFEDIGVI |
| Ga0335027_0622801_150_260 | 3300034101 | Freshwater | MTDHLLIIDGLMGLETDYRDRTIDDHIDDLEDLGVI |
| Ga0335027_0701629_212_322 | 3300034101 | Freshwater | MMDHLPTIEGLMGLETDYRVRTIDDHIDDFEDISVI |
| Ga0335027_0842939_374_484 | 3300034101 | Freshwater | MTDHSDTIKGIMGRETDYNDRTIDDHIDKLEDLGVI |
| Ga0335029_0629406_478_594 | 3300034102 | Freshwater | SIQTAQSPLLESRMGLETDYRDRTIDDHIDELEEIGVI |
| Ga0335030_0352106_511_621 | 3300034103 | Freshwater | MTVHSPTIDGLMGLETDYHERTIDDHIDDFEDISVI |
| Ga0335031_0647989_506_613 | 3300034104 | Freshwater | MAVLQLLESLMGRETDYHERTIDDHIDDFEDISVI |
| Ga0335031_0719360_246_356 | 3300034104 | Freshwater | MTDHSGTIKGIMGRETDYIERTIDTHIDEFEDLSVI |
| Ga0335036_0084312_1385_1492 | 3300034106 | Freshwater | MAVLQLLESRMGLETDYKHRTIDDHIDDLEDIGVI |
| Ga0335036_0313984_836_946 | 3300034106 | Freshwater | MTDRSDTIKGIMGRETDYNDRTIDDHIDELEDLGVI |
| Ga0335036_0330191_897_1001 | 3300034106 | Freshwater | MTDHLPIIDGLMGRETDYIDRTIDDHIDDVEDIGV |
| Ga0335063_0457315_393_500 | 3300034111 | Freshwater | MAALPIIGSPMGRETDYHERTIDDHIDDFEDLFVI |
| Ga0335066_0152610_506_613 | 3300034112 | Freshwater | MVVSQLLESLMGRETDYHDRTIDDHIDEFEDISVI |
| Ga0335066_0230341_112_222 | 3300034112 | Freshwater | MMAVLHTTEGLMGLETDYRDRSIDDHIDEFEDISVI |
| Ga0335033_0413347_83_190 | 3300034117 | Freshwater | MAVLQLLESRMGLETDYKHRTIDDHIDDFEDIGVI |
| Ga0335053_0446038_669_773 | 3300034118 | Freshwater | MTDHSPIIDGLMGLETDYHERTIDDHIDDFEDISV |
| Ga0335049_0084198_1946_2056 | 3300034272 | Freshwater | MTDHSDIIKGIMGRETDYNDRTIDDHIDELEDLGVI |
| Ga0335007_0698670_424_531 | 3300034283 | Freshwater | MAVLQLLESRMGLETDYRDRSIDDHIDEFEDIGVI |
| Ga0335013_0611155_77_184 | 3300034284 | Freshwater | MAHLQLLESLMGRETDYIDRTIDDHIDELEDLGVI |
| Ga0335039_0403810_136_243 | 3300034355 | Freshwater | MAASLIIGSLMGLETDYRDRTIDDHIDDLEDLGVI |
| Ga0335039_0456195_91_198 | 3300034355 | Freshwater | MVHSQLLEGRMGLETDYRDRTIDDHIDEFEAIGVI |
| Ga0335039_0474538_10_120 | 3300034355 | Freshwater | MTDHLPIIDGLMGLETDYRDRTIDDHIDDFEDISVI |
| ⦗Top⦘ |