


| Basic Information | |
|---|---|
| Family ID | F032607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 179 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VPFAAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Number of Associated Samples | 155 |
| Number of Associated Scaffolds | 179 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.23 % |
| % of genes near scaffold ends (potentially truncated) | 93.30 % |
| % of genes from short scaffolds (< 2000 bps) | 89.39 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.765 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.112 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.430 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.603 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 179 Family Scaffolds |
|---|---|---|
| PF02634 | FdhD-NarQ | 24.58 |
| PF00190 | Cupin_1 | 7.26 |
| PF09107 | SelB-wing_3 | 7.26 |
| PF02322 | Cyt_bd_oxida_II | 3.35 |
| PF12804 | NTP_transf_3 | 2.79 |
| PF00106 | adh_short | 2.23 |
| PF13561 | adh_short_C2 | 2.23 |
| PF00140 | Sigma70_r1_2 | 2.23 |
| PF03916 | NrfD | 1.68 |
| PF04542 | Sigma70_r2 | 1.12 |
| PF00174 | Oxidored_molyb | 1.12 |
| PF01226 | Form_Nir_trans | 1.12 |
| PF03404 | Mo-co_dimer | 1.12 |
| PF00248 | Aldo_ket_red | 1.12 |
| PF08240 | ADH_N | 1.12 |
| PF01797 | Y1_Tnp | 1.12 |
| PF04120 | Iron_permease | 0.56 |
| PF02775 | TPP_enzyme_C | 0.56 |
| PF05201 | GlutR_N | 0.56 |
| PF16576 | HlyD_D23 | 0.56 |
| PF04134 | DCC1-like | 0.56 |
| PF07992 | Pyr_redox_2 | 0.56 |
| PF00392 | GntR | 0.56 |
| PF04224 | DUF417 | 0.56 |
| PF16930 | Porin_5 | 0.56 |
| PF11199 | DUF2891 | 0.56 |
| PF07396 | Porin_O_P | 0.56 |
| PF03625 | DUF302 | 0.56 |
| PF00300 | His_Phos_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
|---|---|---|---|
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 24.58 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.35 |
| COG1294 | Cytochrome bd-type quinol oxidase, subunit 2 | Energy production and conversion [C] | 3.35 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 1.12 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.12 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.12 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.12 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.12 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 1.12 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 1.12 |
| COG3746 | Phosphate-selective porin | Inorganic ion transport and metabolism [P] | 0.56 |
| COG0373 | Glutamyl-tRNA reductase | Coenzyme transport and metabolism [H] | 0.56 |
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 0.56 |
| COG3059 | Reactive chlorine resistance protein RclC/YkgB, DUF417 family | Defense mechanisms [V] | 0.56 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.77 % |
| Unclassified | root | N/A | 2.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig27264 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300000550|F24TB_12605257 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1017664 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300000955|JGI1027J12803_104427403 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300000955|JGI1027J12803_106936463 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300000955|JGI1027J12803_108835734 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300000956|JGI10216J12902_113323873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1067 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100448951 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300004156|Ga0062589_100002875 | All Organisms → cellular organisms → Bacteria | 5562 | Open in IMG/M |
| 3300004463|Ga0063356_105568668 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005171|Ga0066677_10732584 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005176|Ga0066679_10561877 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005178|Ga0066688_10446275 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300005186|Ga0066676_10762399 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005329|Ga0070683_101335446 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300005331|Ga0070670_100212973 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1680 | Open in IMG/M |
| 3300005553|Ga0066695_10229780 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005558|Ga0066698_10264948 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300005559|Ga0066700_11108349 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300005560|Ga0066670_10063209 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300005560|Ga0066670_10441399 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 802 | Open in IMG/M |
| 3300005561|Ga0066699_10500027 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300005566|Ga0066693_10488199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 508 | Open in IMG/M |
| 3300005576|Ga0066708_10043652 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300005598|Ga0066706_10277061 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300005719|Ga0068861_101031516 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 787 | Open in IMG/M |
| 3300005764|Ga0066903_102192472 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005843|Ga0068860_102181264 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005844|Ga0068862_102606826 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006028|Ga0070717_10514544 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1082 | Open in IMG/M |
| 3300006032|Ga0066696_10054762 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2254 | Open in IMG/M |
| 3300006059|Ga0075017_100954223 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006791|Ga0066653_10413479 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300006794|Ga0066658_10167702 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300006794|Ga0066658_10884639 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006796|Ga0066665_11355638 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300006797|Ga0066659_11380250 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300006893|Ga0073928_10465036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. | 913 | Open in IMG/M |
| 3300007255|Ga0099791_10296346 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300007265|Ga0099794_10584305 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300007788|Ga0099795_10036481 | All Organisms → cellular organisms → Bacteria | 1725 | Open in IMG/M |
| 3300007788|Ga0099795_10654489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300009088|Ga0099830_11504896 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300009098|Ga0105245_10674557 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300009137|Ga0066709_100165796 | All Organisms → cellular organisms → Bacteria | 2851 | Open in IMG/M |
| 3300009148|Ga0105243_12337181 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300009162|Ga0075423_10221364 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
| 3300009553|Ga0105249_11276667 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 806 | Open in IMG/M |
| 3300010154|Ga0127503_10939289 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300010304|Ga0134088_10235564 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300010326|Ga0134065_10027794 | All Organisms → cellular organisms → Bacteria | 1640 | Open in IMG/M |
| 3300010329|Ga0134111_10086660 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300010333|Ga0134080_10277244 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300010335|Ga0134063_10750980 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300010337|Ga0134062_10068926 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300010360|Ga0126372_10974611 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 857 | Open in IMG/M |
| 3300010373|Ga0134128_12478932 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300010396|Ga0134126_11239222 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 828 | Open in IMG/M |
| 3300010401|Ga0134121_10616038 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300011269|Ga0137392_10637684 | Not Available | 883 | Open in IMG/M |
| 3300011998|Ga0120114_1062302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300012198|Ga0137364_11326348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 535 | Open in IMG/M |
| 3300012200|Ga0137382_10178857 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
| 3300012200|Ga0137382_10884187 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012201|Ga0137365_10582423 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300012203|Ga0137399_10673646 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300012205|Ga0137362_10298282 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300012205|Ga0137362_11180413 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012206|Ga0137380_10846692 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 788 | Open in IMG/M |
| 3300012209|Ga0137379_10119783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2531 | Open in IMG/M |
| 3300012209|Ga0137379_10890945 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012210|Ga0137378_10000791 | All Organisms → cellular organisms → Bacteria | 25555 | Open in IMG/M |
| 3300012285|Ga0137370_10734905 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300012349|Ga0137387_10454423 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300012350|Ga0137372_10082414 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
| 3300012350|Ga0137372_10129186 | All Organisms → cellular organisms → Bacteria | 2085 | Open in IMG/M |
| 3300012357|Ga0137384_11180956 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 609 | Open in IMG/M |
| 3300012361|Ga0137360_11811009 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300012362|Ga0137361_10142737 | All Organisms → cellular organisms → Bacteria | 2133 | Open in IMG/M |
| 3300012362|Ga0137361_11892874 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 513 | Open in IMG/M |
| 3300012363|Ga0137390_10692376 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012582|Ga0137358_10200226 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300012582|Ga0137358_10308348 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1074 | Open in IMG/M |
| 3300012582|Ga0137358_10528771 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300012685|Ga0137397_10095014 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2180 | Open in IMG/M |
| 3300012685|Ga0137397_11230562 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012927|Ga0137416_11334744 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012930|Ga0137407_10185770 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1857 | Open in IMG/M |
| 3300012930|Ga0137407_10705167 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012951|Ga0164300_10505162 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300012951|Ga0164300_10955878 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → unclassified Candidatus Udaeobacter → Candidatus Udaeobacter sp. | 547 | Open in IMG/M |
| 3300012960|Ga0164301_11380183 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 575 | Open in IMG/M |
| 3300012961|Ga0164302_10374975 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300012971|Ga0126369_10292604 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1625 | Open in IMG/M |
| 3300012972|Ga0134077_10576086 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 507 | Open in IMG/M |
| 3300012975|Ga0134110_10541268 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012988|Ga0164306_10353321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1090 | Open in IMG/M |
| 3300012988|Ga0164306_10624542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 847 | Open in IMG/M |
| 3300013296|Ga0157374_10100009 | All Organisms → cellular organisms → Bacteria | 2779 | Open in IMG/M |
| 3300013306|Ga0163162_10414280 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300013307|Ga0157372_10709537 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300013308|Ga0157375_13536278 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300014969|Ga0157376_12326336 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300015193|Ga0167668_1023792 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1366 | Open in IMG/M |
| 3300015264|Ga0137403_10794819 | Not Available | 802 | Open in IMG/M |
| 3300015356|Ga0134073_10425726 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300015371|Ga0132258_13206560 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300015372|Ga0132256_103082257 | Not Available | 560 | Open in IMG/M |
| 3300015373|Ga0132257_103797381 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300015374|Ga0132255_104037915 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300016270|Ga0182036_11914363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300016387|Ga0182040_11748611 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300016445|Ga0182038_11147789 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300018000|Ga0184604_10093248 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300018051|Ga0184620_10248717 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300018061|Ga0184619_10026080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2434 | Open in IMG/M |
| 3300018066|Ga0184617_1189270 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300018071|Ga0184618_10294846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 690 | Open in IMG/M |
| 3300018431|Ga0066655_10343209 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300018431|Ga0066655_11342249 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 516 | Open in IMG/M |
| 3300018433|Ga0066667_10045470 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2607 | Open in IMG/M |
| 3300018433|Ga0066667_10387479 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300018468|Ga0066662_10475466 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300019879|Ga0193723_1087030 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300019885|Ga0193747_1131284 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300019890|Ga0193728_1048570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2067 | Open in IMG/M |
| 3300020002|Ga0193730_1162541 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
| 3300020015|Ga0193734_1066379 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300020018|Ga0193721_1018331 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1841 | Open in IMG/M |
| 3300020060|Ga0193717_1199928 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 539 | Open in IMG/M |
| 3300020583|Ga0210401_10090542 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2876 | Open in IMG/M |
| 3300021080|Ga0210382_10351031 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 651 | Open in IMG/M |
| 3300021168|Ga0210406_11027713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300021171|Ga0210405_10342470 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1180 | Open in IMG/M |
| 3300021344|Ga0193719_10064005 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300021415|Ga0193694_1001563 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3273 | Open in IMG/M |
| 3300021478|Ga0210402_11917025 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300021560|Ga0126371_11828758 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300022534|Ga0224452_1092347 | Not Available | 922 | Open in IMG/M |
| 3300022534|Ga0224452_1241145 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300022756|Ga0222622_11035499 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300025899|Ga0207642_10653532 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 659 | Open in IMG/M |
| 3300025916|Ga0207663_10252920 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300025928|Ga0207700_10939081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 774 | Open in IMG/M |
| 3300025930|Ga0207701_10026931 | All Organisms → cellular organisms → Bacteria | 5458 | Open in IMG/M |
| 3300025939|Ga0207665_10166039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
| 3300025972|Ga0207668_11553816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → unclassified Chthoniobacterales → Chthoniobacterales bacterium | 597 | Open in IMG/M |
| 3300026023|Ga0207677_10717738 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300026314|Ga0209268_1031792 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300026318|Ga0209471_1131178 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300026322|Ga0209687_1253749 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 546 | Open in IMG/M |
| 3300026324|Ga0209470_1162089 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300026325|Ga0209152_10099591 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300026330|Ga0209473_1234979 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300026514|Ga0257168_1102490 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026528|Ga0209378_1032344 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Rubritaleaceae → Rubritalea → Rubritalea squalenifaciens | 2738 | Open in IMG/M |
| 3300026547|Ga0209156_10154199 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1112 | Open in IMG/M |
| 3300026552|Ga0209577_10394661 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300026557|Ga0179587_10332628 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300026828|Ga0207502_104897 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300027635|Ga0209625_1158348 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300027667|Ga0209009_1157599 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300028047|Ga0209526_10261185 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300028047|Ga0209526_10566736 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300028047|Ga0209526_10597867 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300028814|Ga0307302_10077011 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1576 | Open in IMG/M |
| 3300028814|Ga0307302_10488873 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300028878|Ga0307278_10007618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5127 | Open in IMG/M |
| 3300028878|Ga0307278_10246372 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 793 | Open in IMG/M |
| 3300031446|Ga0170820_12776242 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300031446|Ga0170820_14868796 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031716|Ga0310813_10142260 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300031740|Ga0307468_100094478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1755 | Open in IMG/M |
| 3300031820|Ga0307473_10920537 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031823|Ga0307478_10392251 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031912|Ga0306921_12289563 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300032076|Ga0306924_12623039 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300033412|Ga0310810_10432782 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300033475|Ga0310811_11492144 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.35% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.35% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.79% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.12% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.12% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.56% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.56% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026828 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_00348320 | 2124908044 | Soil | PFAAISFLIGALLSRVGWIAVGKISGRDPESVFASQK |
| F24TB_126052572 | 3300000550 | Soil | LAGALVSRIGWIAVGKVSGVDPESVFAAESYQGKL* |
| KanNP_Total_noBrdU_T14TCDRAFT_10176643 | 3300000596 | Soil | VLRFFGMVPFAAVSFLIGALVSRIGWIAVGKVSGSDPESVFAAER* |
| JGI1027J12803_1044274032 | 3300000955 | Soil | LAGALISRMGWIAVGKVSGVDPESVFAAESYHKRL* |
| JGI1027J12803_1069364632 | 3300000955 | Soil | LRFFGLVPLAAISFLIGALVSRVGWIAVGKVSGADPEAVFAA |
| JGI1027J12803_1088357341 | 3300000955 | Soil | AISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| JGI10216J12902_1133238731 | 3300000956 | Soil | LLRFFGFIPGAGISFLVGALISRFGWIAVGKVSGADPEAVFASQR* |
| JGIcombinedJ26739_1004489511 | 3300002245 | Forest Soil | PFAAVSFLIGSLVSRVAWIAVGKVSGSDPESVFAAERY* |
| Ga0062589_1000028751 | 3300004156 | Soil | MVPFAAVSFLTGALVSRIGWIAVGKVSGSDPEAVFASQR* |
| Ga0063356_1055686682 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RFLGLIPFAAISFLIGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0066677_107325842 | 3300005171 | Soil | LNGPLALVLRFFGLIPWAAISFLCGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0066679_105618771 | 3300005176 | Soil | FAFIPFAAISFLLGALVSRVGWIVVGKVSGADPESVFAAERY* |
| Ga0066688_104462751 | 3300005178 | Soil | ILRLANFVPLAGISFLLGALINRFGWISAGKVCARDPEAVFASQR* |
| Ga0066676_107623991 | 3300005186 | Soil | MLRFFGLGSVRSNFILLGALVSRFGWIAVGKVSGSDPESVLAAER* |
| Ga0070683_1013354461 | 3300005329 | Corn Rhizosphere | LVPLAAISFLLGACLSRFGWISAGRVSGKDPEAVFASQS* |
| Ga0070670_1002129731 | 3300005331 | Switchgrass Rhizosphere | LALILRLTNLIPLAAISFLLGALISRFGWIAAGRLSGRDPEAVFASHR* |
| Ga0066695_102297803 | 3300005553 | Soil | PLALILGVANLVPLAAISFLLGALISRFGWAWAGKVCARDPEAVFASQR* |
| Ga0066698_102649481 | 3300005558 | Soil | LVPFAAISFLLGALISRFAWIWAGKVCAHDPEAVFASQR* |
| Ga0066700_111083491 | 3300005559 | Soil | IPFAAISFLLGALVSRVGWIVVGKVSGADPESVFAAERY* |
| Ga0066670_100632091 | 3300005560 | Soil | VNLVPFAAISFLLGALISRFAWIWAGKVCARDPEAVFASQR* |
| Ga0066670_104413992 | 3300005560 | Soil | GLVPFAAVSFLIGALVSRIGWIAVGKVSGSDPEAVFAAERY* |
| Ga0066699_105000271 | 3300005561 | Soil | FAAISFLLGALVSRVGWIVVGKVSGADPESVFAAERY* |
| Ga0066693_104881992 | 3300005566 | Soil | IPWAAISFLAGTLVSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0066708_100436521 | 3300005576 | Soil | MALILRSVNLVPFAAISFLLGALISRFAWIWAGKVCALDPEAVFASQR* |
| Ga0066706_102770611 | 3300005598 | Soil | AISFLLGALVSRIGWIAVGKVSGADPESVFAAEHY* |
| Ga0068861_1010315162 | 3300005719 | Switchgrass Rhizosphere | LRFLGFIPWAAISFLAGALVSRIGWIVVGKVSGADPESVFAAERY* |
| Ga0066903_1021924722 | 3300005764 | Tropical Forest Soil | FIPWAAISFLAGALASRIGWITVGKVSGSDPESVFAAERH* |
| Ga0068860_1021812641 | 3300005843 | Switchgrass Rhizosphere | WAALSFLLGALSSRFGWIEAGRDSGRDPEAVFAAQRRA* |
| Ga0068862_1026068261 | 3300005844 | Switchgrass Rhizosphere | ISFLIGALISRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0070717_105145441 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LNGPLALILRFFGLVPFAATSFLIGALVSRVGWIVVGKISGRDPESVFASQR* |
| Ga0066696_100547625 | 3300006032 | Soil | VANLVPLAAISFLLGALISRFGWAWAGKVCARDPEAVFASQR* |
| Ga0075017_1009542233 | 3300006059 | Watersheds | GPLALVLRFFSFIPFAAISFLIGALVSRVGWIEVGKVSGSDPESVFAAENY* |
| Ga0066653_104134791 | 3300006791 | Soil | LVLRLFGIIPLAAISFLLGALISRIGWIAVGKVSGRDPEAVFASQR* |
| Ga0066658_101677022 | 3300006794 | Soil | FFGLIPWAAISFLCGALVSRIGWIAVGKVYGSDPESVFAAERY* |
| Ga0066658_108846391 | 3300006794 | Soil | AIFFLLGALISRFGWIAVGRVSGCDPEAVFASQK* |
| Ga0066665_113556381 | 3300006796 | Soil | LVLRFFGLVPFAAVSFLIGALVSRIGWIAVGKVSGSDPEAVFAAERY* |
| Ga0066659_113802501 | 3300006797 | Soil | IPFAAISFLTGALVSRFGWIWVGKISGSDPEAVFASQR* |
| Ga0073928_104650363 | 3300006893 | Iron-Sulfur Acid Spring | PFAAISFLIGALVSRVGWIEVGKVSGSDPESVFAAEKY* |
| Ga0099791_102963462 | 3300007255 | Vadose Zone Soil | LAAIFFLLGALISRFGWIAVGRVSGCDPEAVFASQK* |
| Ga0099794_105843052 | 3300007265 | Vadose Zone Soil | FGIIPLAAISFLLGALISRIGWIAVGKVSGRDPEAVFASQR* |
| Ga0099795_100364814 | 3300007788 | Vadose Zone Soil | AISFLIGALVSRFGWIAVGKVSGSDPESVFAAERYHDVRS* |
| Ga0099795_106544892 | 3300007788 | Vadose Zone Soil | LLLRFFGFIPLAAISFLVGALVSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0099830_115048962 | 3300009088 | Vadose Zone Soil | NGPLALVLRLFSLVPFAALSFLIGALISRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0105245_106745571 | 3300009098 | Miscanthus Rhizosphere | PLALILRFFGLVPFAAISFLVGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0066709_1001657961 | 3300009137 | Grasslands Soil | VLRFFSFVPLAGISFLLGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0105243_123371813 | 3300009148 | Miscanthus Rhizosphere | PVAAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0075423_102213641 | 3300009162 | Populus Rhizosphere | ILRLTNFIPFAAISFLLGALISRFGWIWVGKVCGRDPEAVFASQR* |
| Ga0105249_112766672 | 3300009553 | Switchgrass Rhizosphere | MLNGPVALILRYFGLVPLAAISFLIGALISRIGWLAVGKLSGSDPESVFAAERY* |
| Ga0127503_109392892 | 3300010154 | Soil | AISFLLGALVSRLGWIAVGKVSGSDTEAVFAAERF* |
| Ga0134088_102355643 | 3300010304 | Grasslands Soil | IGAFVSRFGWIAVGKVSGSDPESVFAAERYHPTARL* |
| Ga0134065_100277943 | 3300010326 | Grasslands Soil | RLFGLIPLAAISFLLGALISRFGWIAVGRVSGCDPEAVFASQK* |
| Ga0134111_100866601 | 3300010329 | Grasslands Soil | AAIAFLLGAFISRFGWIEAGKVCGRDPEAVFASQG* |
| Ga0134080_102772441 | 3300010333 | Grasslands Soil | ISFLIGALISRFGWIAVGKVSGADPESVFVAERY* |
| Ga0134063_107509802 | 3300010335 | Grasslands Soil | NLVPFAAISFLLGALISRFAWIWAGKVCAHDPEAVFASQR* |
| Ga0134062_100689263 | 3300010337 | Grasslands Soil | AISFLLGALISRIGWIAVGKVSGRDPEAAFASQR* |
| Ga0126372_109746112 | 3300010360 | Tropical Forest Soil | GPLALVLRFFGFIPLAAISFLSGALVSRIGWIAVGKVSGSDPESVFAAERF* |
| Ga0134128_124789321 | 3300010373 | Terrestrial Soil | LLLRFFGFIPLAAISFLAGALLSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0134126_112392221 | 3300010396 | Terrestrial Soil | LVVRFLGFIRWAAISFLAGALVSRIGWIVVGKVSGADPESVFAAERY* |
| Ga0134121_106160381 | 3300010401 | Terrestrial Soil | RLTNLVPLAAVSFLLGAFLSRFGWIAAGRISGGDPEAVFASQR* |
| Ga0137392_106376841 | 3300011269 | Vadose Zone Soil | LNGPLALVLRFFGLIPFAALSFLIGALASRFGWIAVGKVSGSDPEAVFAAER* |
| Ga0120114_10623022 | 3300011998 | Permafrost | FVPLAAISFLIGALISRFGWIAVGKVSGSDPESVFAAERY* |
| Ga0137364_113263482 | 3300012198 | Vadose Zone Soil | GISFLLGALISRFGWIWAGKVCARDPEAVFASQR* |
| Ga0137382_101788573 | 3300012200 | Vadose Zone Soil | PLALILRFFGLVPFAAISFLIGALVSRIGWIAVGKGAGSDPESVFAAERY* |
| Ga0137382_108841871 | 3300012200 | Vadose Zone Soil | VPLAGISFLLGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0137365_105824233 | 3300012201 | Vadose Zone Soil | LALVLRLFSFVPFAAISFLIGALVGRFGWIAVGKVSGSDPESVFAAERL* |
| Ga0137399_106736461 | 3300012203 | Vadose Zone Soil | ISFLLGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0137362_102982821 | 3300012205 | Vadose Zone Soil | ISFLLGALVSRIGWIAVGKVSGADPESVFAAEHY* |
| Ga0137362_111804132 | 3300012205 | Vadose Zone Soil | AISFLLGALVSRLGWIAVGKVSGSDPEAVFAAERF* |
| Ga0137380_108466922 | 3300012206 | Vadose Zone Soil | AALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0137379_101197835 | 3300012209 | Vadose Zone Soil | AGISFLLGALINRFGWISAGKVCARDPEAVFASQR* |
| Ga0137379_108909452 | 3300012209 | Vadose Zone Soil | PLAAISFLLGALISRFGWIEAGKVCGRDPEAVFASQD* |
| Ga0137378_1000079129 | 3300012210 | Vadose Zone Soil | VPLAGISFLLGALINRFGWISAGKVCARDPEAVFASQR* |
| Ga0137370_107349052 | 3300012285 | Vadose Zone Soil | VLRFFGLIPWGAISFLWGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0137387_104544231 | 3300012349 | Vadose Zone Soil | IPLAAIFFLLGALISRFGLIAVGRVSGCDPEAGFASQK* |
| Ga0137372_100824147 | 3300012350 | Vadose Zone Soil | MLRFFGLVPFAAISFSIVALVSRIGWIAVDKVSGSDPESVFAAERY* |
| Ga0137372_101291864 | 3300012350 | Vadose Zone Soil | FGLVPFAAISFLIGALVSRVGWIAVGKVSGADPESVFAAERY* |
| Ga0137384_111809562 | 3300012357 | Vadose Zone Soil | FAAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0137360_118110091 | 3300012361 | Vadose Zone Soil | QVPLAAISFLVGALVSRMGWIAVGKVSGSDPEAVFASQR* |
| Ga0137361_101427372 | 3300012362 | Vadose Zone Soil | FFGLIPLAAISFLLGSLVSRIGWIAVGKVSGSDPESVFAAERC* |
| Ga0137361_118928741 | 3300012362 | Vadose Zone Soil | FAAISFLLGALVSRLGWIAVGKVSGSDPESVFAAERY* |
| Ga0137390_106923762 | 3300012363 | Vadose Zone Soil | FFSFVPFAALSFLIGSLVSRVGWIAVGKVSGSDPEAVFASQR* |
| Ga0137358_102002263 | 3300012582 | Vadose Zone Soil | ALILRFFGLVPFAAISFLVGALVSRLGWIAVGKVSGSDPESVFAAERY* |
| Ga0137358_103083481 | 3300012582 | Vadose Zone Soil | RFFGFIPLAAISFLVGALVSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0137358_105287713 | 3300012582 | Vadose Zone Soil | LALVLRFFGLIPLAAVSFLLGSLISRIGWIAVGKVSGSDPESVFAAEKY* |
| Ga0137397_100950141 | 3300012685 | Vadose Zone Soil | GPLALLLRFFGFIPLAAISFLAGSLVSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0137397_112305622 | 3300012685 | Vadose Zone Soil | ALLLRFFGFIPLAAISFLVGALVSRIGWIAVGKVSGADPEAVFAAER* |
| Ga0137416_113347442 | 3300012927 | Vadose Zone Soil | ALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0137407_101857701 | 3300012930 | Vadose Zone Soil | ISFLLGALVSRLGWIAVGKVSGSDPESVFAAERY* |
| Ga0137407_107051672 | 3300012930 | Vadose Zone Soil | ILRFLGLVPFAAVSFLIGALVSRIGWIAVGKVSGSDPESVFAAERF* |
| Ga0164300_105051622 | 3300012951 | Soil | AAISFLLGALVSRLGWIAVGKVSGSDPESVFAAERY* |
| Ga0164300_109558782 | 3300012951 | Soil | LALILRFLGLVPFAAVSFLIGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0164301_113801831 | 3300012960 | Soil | VLNGPLALILRFFGLVSFAAISFLLGSLVSRIGWIAVCKVSGSDPESVFAAERY* |
| Ga0164302_103749751 | 3300012961 | Soil | VPFAAISFLVGALVSRIGWIAVGKMSGSDPESVFAAERY* |
| Ga0126369_102926041 | 3300012971 | Tropical Forest Soil | AISFLLGALISRFGWIAVGKISGRDPEAVLASQRL* |
| Ga0134077_105760861 | 3300012972 | Grasslands Soil | LVPFAAISFLTGSLISRVGWIAVGKVSGSDPEAVFASQH* |
| Ga0134110_105412682 | 3300012975 | Grasslands Soil | AISFLLGALVSRFGWIAVGKISGREPESVFVSQKV* |
| Ga0164306_103533211 | 3300012988 | Soil | RFFGLVPFAAISFLVGALVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0164306_106245421 | 3300012988 | Soil | ISFLAGALVSRIGWIVVGKVSGADPESVFAAERY* |
| Ga0157374_101000093 | 3300013296 | Miscanthus Rhizosphere | RLAGQVPLAATTFMLGALLSRFGWIGAGKVSGADPEAVFASQRQQSS* |
| Ga0163162_104142803 | 3300013306 | Switchgrass Rhizosphere | ALILRFFGLVPLAAISFLIGALISRVGWIAVGKVSGSDPESVFAAERY* |
| Ga0157372_107095373 | 3300013307 | Corn Rhizosphere | AISFLVGAVVSRIGWIAVGKVSGSDPESVFAAERY* |
| Ga0157375_135362781 | 3300013308 | Miscanthus Rhizosphere | LTNLIPLAAASFLLGALSSRYGWIEAGRASGRDPEAVFAAQRRA* |
| Ga0157376_123263362 | 3300014969 | Miscanthus Rhizosphere | LAAISFLACALVSRIGWLAVGKVSGADPEAVFASQR* |
| Ga0167668_10237922 | 3300015193 | Glacier Forefield Soil | AFLLRLFGLVPFAAISFLIGALASRVGWIVVGKVSGSDPESVFAAERYWRSS* |
| Ga0137403_107948191 | 3300015264 | Vadose Zone Soil | FAALSFLIGALVSRFGWIWVGKVSGSDPESVFAAERL* |
| Ga0134073_104257261 | 3300015356 | Grasslands Soil | MGPFPLVLRFFGVIPLAAIFFLLGALISRFGWIAVGRVSGCDPEAVFASQK* |
| Ga0132258_132065601 | 3300015371 | Arabidopsis Rhizosphere | PLALVLRFFGVIPLAAISFLLGAFIGRIGWIAVGKISGRDPEAVFAAERL* |
| Ga0132256_1030822571 | 3300015372 | Arabidopsis Rhizosphere | AAISFLLGALASRFGWIAAGRASGRDPEAVFATQTGR* |
| Ga0132257_1037973811 | 3300015373 | Arabidopsis Rhizosphere | AISFLVGALVSRIGWIAVGKVSGSDPECVFAAERY* |
| Ga0132255_1040379151 | 3300015374 | Arabidopsis Rhizosphere | PWAAISFLTGALVSRIGWIAVGKVSGADPEAVFASQR* |
| Ga0182036_119143631 | 3300016270 | Soil | LAFVLRLFGLIPLAAISFLLGALISRFGWIAVGKVSGGDPESVFAAER |
| Ga0182040_117486112 | 3300016387 | Soil | VTNLVPFAAASFLLGALISRFGWISAGRISGADPEAVFASQR |
| Ga0182038_111477892 | 3300016445 | Soil | FGVIPLAAISFLVGALISRFGWIAVGKISGCDPESVFASQKS |
| Ga0184604_100932481 | 3300018000 | Groundwater Sediment | GAVAVYALSLSEVSILIGALVSRFGWIAVGKVSGSDPDSAFAAERY |
| Ga0184620_102487172 | 3300018051 | Groundwater Sediment | FVLRLLGLVPFAAISFLIGALVSRIGWIAVGKVSGSDPESVFAAERS |
| Ga0184619_100260804 | 3300018061 | Groundwater Sediment | AISFLLGALVSRLGWIAVGKVSGSDPESVFAAERY |
| Ga0184617_11892702 | 3300018066 | Groundwater Sediment | AISFLIGALVSRIGWIAIGKVSGSDPESVFAAERY |
| Ga0184618_102948462 | 3300018071 | Groundwater Sediment | FFGAIPLAAISFLVGALVSPFGWIAVGKISGRDPESVFASQR |
| Ga0066655_103432092 | 3300018431 | Grasslands Soil | ANLVPLAAISFLLGALISRFGWAWAGKVCARDPEAVFASQR |
| Ga0066655_113422491 | 3300018431 | Grasslands Soil | LALVLRLFGLVPFAAISFLTGSLISRVGWIAVGKVSGSDPEAVFASQH |
| Ga0066667_100454705 | 3300018433 | Grasslands Soil | VPLAGISFLLGALINRFGWISAGKVCARDPEAVFASQR |
| Ga0066667_103874792 | 3300018433 | Grasslands Soil | LRLFGIIPLAAISFLLGALISRIGWIAVGKVSGRDPEAVFASQR |
| Ga0066662_104754661 | 3300018468 | Grasslands Soil | AISFLIVALVSRLGWIAVGRVSGSDPESVFAAERY |
| Ga0193723_10870302 | 3300019879 | Soil | WLGFVPLAAIAFLIGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0193747_11312842 | 3300019885 | Soil | FGVIPLAAISFLIGALVSRIGWIAVGKVSGRDPEAVFAAQR |
| Ga0193728_10485701 | 3300019890 | Soil | NGPLALILRFLGLVPFAAVSFLIGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0193730_11625411 | 3300020002 | Soil | VPFAAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0193734_10663791 | 3300020015 | Soil | AISFLIGALVSRIGWIAVGKVSGSDPESVFAAERS |
| Ga0193721_10183313 | 3300020018 | Soil | LTGPLALVLRFFGLVPFAAVSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0193717_11999282 | 3300020060 | Soil | AISFLIGSLVSRFGWIVVGKVSGSDPEAVFASQNGRVESAR |
| Ga0210401_100905426 | 3300020583 | Soil | ALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0210382_103510312 | 3300021080 | Groundwater Sediment | GPLALILRFFGLVPFAAISFLIGALVSRLGWIAVGKVSGSDPESVFAAERY |
| Ga0210406_110277132 | 3300021168 | Soil | AFVLRLFGLIPFAAISFLTGSLISRVGWIAVGKVSGADPEAVFASQR |
| Ga0210405_103424701 | 3300021171 | Soil | AIVLRVFGQVPLAALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0193719_100640053 | 3300021344 | Soil | GLVPFAAISFLIGALVSRLGWIAVGKVSGSDPESVFAAEHY |
| Ga0193694_10015631 | 3300021415 | Soil | PLALVLRFFGFIPWAAISFLVGALVSRIGWIVVGKVSGADPESVFAAERY |
| Ga0210402_119170252 | 3300021478 | Soil | VLRLFGQVPLAALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0126371_118287582 | 3300021560 | Tropical Forest Soil | PLAAISFLLGALVSRIGWVAVGKVSGSDPESVFAAERY |
| Ga0224452_10923471 | 3300022534 | Groundwater Sediment | FGLVPFAAISFLLGALISRFGWIAVGKVSGSDPESVFAAERY |
| Ga0224452_12411452 | 3300022534 | Groundwater Sediment | VPFAAISFLVGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0222622_110354991 | 3300022756 | Groundwater Sediment | PLALILRFFGLVPFAAISFLVGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0207642_106535322 | 3300025899 | Miscanthus Rhizosphere | PFAAISFLVGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0207663_102529201 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | FAAISFLLGALVSRLGWIAVGKVSGSDPESVFAAERY |
| Ga0207700_109390812 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AAISFILGSLVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0207701_100269311 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | GFIPWAAISFLAGALVSRIGWIVVGKVSGADPESVFAAERY |
| Ga0207665_101660392 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VGIAQENGLAMIPAILFLIGALVSRFGWIAVGKVSGSDLESVFAAERS |
| Ga0207668_115538161 | 3300025972 | Switchgrass Rhizosphere | SLAAMSFLFGALLSRFGWIAAGRVSGRDPEAVFASQK |
| Ga0207677_107177382 | 3300026023 | Miscanthus Rhizosphere | GPLAFILRFFGLVPFAAISFLVGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0209268_10317924 | 3300026314 | Soil | NLVPLAGISFLLGALINRFGWISAGKVCARDPEAVFASQR |
| Ga0209471_11311782 | 3300026318 | Soil | MGPFPLVLRFFGVIPLAAIFFLLGALISRFGWIAVGRVSGCDPEAVFASQK |
| Ga0209687_12537492 | 3300026322 | Soil | AAISFLTGALVSRFGWIWVGKISGSDPEAVFASQR |
| Ga0209470_11620891 | 3300026324 | Soil | MLRFFGLGSVRSNFILLGALVSRFGWIAVGKVSGSDPESVLAAER |
| Ga0209152_100995911 | 3300026325 | Soil | FFGLIPWAAISFLCGALVSRIGWIAVGKVYGSDPESVFAAERY |
| Ga0209473_12349791 | 3300026330 | Soil | LNGPLALVLRLFGIIPLAAISFLLGALISRIGWIAVGKVSGRDPEAVFASQR |
| Ga0257168_11024901 | 3300026514 | Soil | RLFGQVPLAALSFLIGALVSRVGWIAVGKVSGSDPESVFAAEGY |
| Ga0209378_10323443 | 3300026528 | Soil | LIPFAALSFLIGALVSRFGWIWVGKISGSDPEAVFASQH |
| Ga0209156_101541991 | 3300026547 | Soil | LAAISFLLGALISRFGWAWAGKVCARDPEAVFASQR |
| Ga0209577_103946611 | 3300026552 | Soil | FFGLIPWAAISFLCGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0179587_103326282 | 3300026557 | Vadose Zone Soil | LFGFIPLAAISFLAGAIVSRIGWIAVGKVSGADPEAVFAAER |
| Ga0207502_1048971 | 3300026828 | Soil | ALLLRFFGFIPWAAISFLAGALVSRIGWIAVGKVSGADPEAVLASQR |
| Ga0209625_11583482 | 3300027635 | Forest Soil | IVLRLFGQVPLAALSFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0209009_11575991 | 3300027667 | Forest Soil | FFGFIPFAAISFLIGSLVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0209526_102611851 | 3300028047 | Forest Soil | VLRLFGLIPLAAISFLTGSLVSRIGWIAVGKVSGADPEAVFASQH |
| Ga0209526_105667362 | 3300028047 | Forest Soil | MSEFLAGPVALIFRFFGIVPIAALSFMLGSLVSRVGWIMVGKVSGRDPEAVFASQR |
| Ga0209526_105978673 | 3300028047 | Forest Soil | AISFLIGALVSRFGWIAVGKVSGSDPESVFAAERN |
| Ga0307302_100770111 | 3300028814 | Soil | LALILRLTHLVPLAGILFLLGAFISRFGWIQAGKISGSDPEAVFASQR |
| Ga0307302_104888732 | 3300028814 | Soil | AAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERC |
| Ga0307278_100076184 | 3300028878 | Soil | FAAISFLIGALVSRVGWIAVGKVSGSDPESVFAAERY |
| Ga0307278_102463722 | 3300028878 | Soil | VPLAGISFLLGALISRFGWIWAGKVCARDPEAVFASQR |
| Ga0170820_127762421 | 3300031446 | Forest Soil | AISFLLGALVSRIGWIAVGKVSGSDPESVFAAERY |
| Ga0170820_148687961 | 3300031446 | Forest Soil | AISFLAGALVSRIGWIAVGKVSGADPESVFAAERY |
| Ga0310813_101422603 | 3300031716 | Soil | MFGQTPFAAISFLIGALASRFGWIVVGKVSGADPEAVFAAER |
| Ga0307468_1000944781 | 3300031740 | Hardwood Forest Soil | RFLGFIPWAAISFLAGALVSRIGWIVVGKVSGADPESVFAAERY |
| Ga0307473_109205372 | 3300031820 | Hardwood Forest Soil | VFTGPIPLVLRFFGAIPLAAISLLLGALVGRFGWIAVGKISGRDPESVFAAQKL |
| Ga0307478_103922513 | 3300031823 | Hardwood Forest Soil | SFIPFAAVSFSLGALISRIGWIAVGKVSGSDPESVFASQA |
| Ga0306921_122895632 | 3300031912 | Soil | FGLIPLAAISFLLGALISRFGWIAVGKVSGGDPESVFAAER |
| Ga0306924_126230391 | 3300032076 | Soil | AFGLASFAAIAFLSGALLSRFGWISAGKISGRDPEAVFASQRG |
| Ga0310810_104327823 | 3300033412 | Soil | FAAISFLIGAFASRFGWIAVGKVSGAAPEAVFAAER |
| Ga0310811_114921441 | 3300033475 | Soil | GPLALILRFFGLVPLAAISFLIGALISRVGWIAVGKVSGSDPESVFAAERY |
| ⦗Top⦘ |