


| Basic Information | |
|---|---|
| Family ID | F032482 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 49 residues |
| Representative Sequence | LTDEQFNSETAPGQWTYRVVAKHVLALEQDSLKTIAADQATRTSSG |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.14 % |
| % of genes near scaffold ends (potentially truncated) | 95.56 % |
| % of genes from short scaffolds (< 2000 bps) | 86.11 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.111 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF03466 | LysR_substrate | 11.67 |
| PF01545 | Cation_efflux | 6.11 |
| PF08241 | Methyltransf_11 | 3.89 |
| PF04542 | Sigma70_r2 | 3.33 |
| PF13847 | Methyltransf_31 | 2.22 |
| PF00535 | Glycos_transf_2 | 2.22 |
| PF00005 | ABC_tran | 2.22 |
| PF02635 | DrsE | 1.67 |
| PF00753 | Lactamase_B | 1.67 |
| PF01425 | Amidase | 1.67 |
| PF02585 | PIG-L | 1.11 |
| PF04392 | ABC_sub_bind | 1.11 |
| PF00383 | dCMP_cyt_deam_1 | 1.11 |
| PF00440 | TetR_N | 1.11 |
| PF00578 | AhpC-TSA | 1.11 |
| PF00596 | Aldolase_II | 1.11 |
| PF13279 | 4HBT_2 | 1.11 |
| PF10091 | Glycoamylase | 1.11 |
| PF07690 | MFS_1 | 1.11 |
| PF03061 | 4HBT | 1.11 |
| PF00072 | Response_reg | 0.56 |
| PF00501 | AMP-binding | 0.56 |
| PF07452 | CHRD | 0.56 |
| PF00496 | SBP_bac_5 | 0.56 |
| PF01106 | NifU | 0.56 |
| PF13489 | Methyltransf_23 | 0.56 |
| PF12695 | Abhydrolase_5 | 0.56 |
| PF10055 | DUF2292 | 0.56 |
| PF00892 | EamA | 0.56 |
| PF12705 | PDDEXK_1 | 0.56 |
| PF01451 | LMWPc | 0.56 |
| PF02633 | Creatininase | 0.56 |
| PF09335 | SNARE_assoc | 0.56 |
| PF16983 | MFS_MOT1 | 0.56 |
| PF11239 | DUF3040 | 0.56 |
| PF07969 | Amidohydro_3 | 0.56 |
| PF01594 | AI-2E_transport | 0.56 |
| PF13463 | HTH_27 | 0.56 |
| PF00296 | Bac_luciferase | 0.56 |
| PF07831 | PYNP_C | 0.56 |
| PF04909 | Amidohydro_2 | 0.56 |
| PF13533 | Biotin_lipoyl_2 | 0.56 |
| PF09723 | Zn-ribbon_8 | 0.56 |
| PF13649 | Methyltransf_25 | 0.56 |
| PF11716 | MDMPI_N | 0.56 |
| PF02518 | HATPase_c | 0.56 |
| PF12671 | Amidase_6 | 0.56 |
| PF01972 | SDH_sah | 0.56 |
| PF09997 | DUF2238 | 0.56 |
| PF12697 | Abhydrolase_6 | 0.56 |
| PF07508 | Recombinase | 0.56 |
| PF03928 | HbpS-like | 0.56 |
| PF02596 | DUF169 | 0.56 |
| PF06472 | ABC_membrane_2 | 0.56 |
| PF13365 | Trypsin_2 | 0.56 |
| PF13411 | MerR_1 | 0.56 |
| PF00561 | Abhydrolase_1 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 6.11 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 6.11 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 6.11 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.33 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 3.33 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.33 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 3.33 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.67 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.11 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.11 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.11 |
| COG0213 | Thymidine phosphorylase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.56 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.56 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.56 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 0.56 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.56 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.56 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
| COG2043 | Uncharacterized conserved protein, DUF169 family | Function unknown [S] | 0.56 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.67 % |
| Unclassified | root | N/A | 8.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0823934 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101292054 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101336206 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104922735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 541 | Open in IMG/M |
| 3300000955|JGI1027J12803_107076905 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300000956|JGI10216J12902_107572963 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300001431|F14TB_100100191 | All Organisms → cellular organisms → Bacteria | 2645 | Open in IMG/M |
| 3300001431|F14TB_102749426 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300002562|JGI25382J37095_10033603 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300002908|JGI25382J43887_10495640 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300004156|Ga0062589_100572256 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300004156|Ga0062589_102198515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300004156|Ga0062589_102232972 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300004267|Ga0066396_10121104 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004463|Ga0063356_105495288 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300004643|Ga0062591_100968482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300005167|Ga0066672_10168600 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1382 | Open in IMG/M |
| 3300005174|Ga0066680_10783296 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300005186|Ga0066676_10084072 | All Organisms → cellular organisms → Bacteria | 1896 | Open in IMG/M |
| 3300005290|Ga0065712_10234168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1002 | Open in IMG/M |
| 3300005332|Ga0066388_100322332 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300005332|Ga0066388_105374873 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
| 3300005406|Ga0070703_10530540 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005445|Ga0070708_100515839 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300005445|Ga0070708_100838944 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300005445|Ga0070708_102190303 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005446|Ga0066686_10143608 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300005447|Ga0066689_10530962 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005459|Ga0068867_101419484 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300005467|Ga0070706_100748547 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005471|Ga0070698_101432330 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005554|Ga0066661_10408711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
| 3300005563|Ga0068855_101430891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Pararhodospirillum → Pararhodospirillum photometricum | 712 | Open in IMG/M |
| 3300005568|Ga0066703_10042412 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
| 3300005713|Ga0066905_100999032 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium pilosum | 738 | Open in IMG/M |
| 3300005719|Ga0068861_101486675 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300005764|Ga0066903_107744169 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005843|Ga0068860_100251845 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300005844|Ga0068862_101391211 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005876|Ga0075300_1013364 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300006032|Ga0066696_10670754 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300006794|Ga0066658_10060704 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300006796|Ga0066665_10541748 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300006800|Ga0066660_10859892 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300006844|Ga0075428_100142975 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300006845|Ga0075421_100011815 | All Organisms → cellular organisms → Bacteria | 10825 | Open in IMG/M |
| 3300006845|Ga0075421_100557713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1353 | Open in IMG/M |
| 3300006846|Ga0075430_101123053 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006847|Ga0075431_101091623 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300006854|Ga0075425_100506142 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300006854|Ga0075425_100580744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300006880|Ga0075429_101282151 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006903|Ga0075426_10525063 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 881 | Open in IMG/M |
| 3300006904|Ga0075424_102034747 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006914|Ga0075436_101093785 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
| 3300007255|Ga0099791_10387058 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300009012|Ga0066710_100051135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5112 | Open in IMG/M |
| 3300009038|Ga0099829_10422423 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300009038|Ga0099829_10935778 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009088|Ga0099830_10633143 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 878 | Open in IMG/M |
| 3300009090|Ga0099827_11189277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300009094|Ga0111539_10905599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1026 | Open in IMG/M |
| 3300009100|Ga0075418_10142559 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300009100|Ga0075418_10476235 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300009100|Ga0075418_12789543 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009162|Ga0075423_12264092 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300009168|Ga0105104_10425599 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300009792|Ga0126374_10524897 | Not Available | 859 | Open in IMG/M |
| 3300009813|Ga0105057_1035063 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300009836|Ga0105068_1070593 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010047|Ga0126382_10256612 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300010304|Ga0134088_10471706 | Not Available | 616 | Open in IMG/M |
| 3300010323|Ga0134086_10079172 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300010335|Ga0134063_10174593 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300010337|Ga0134062_10426990 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010358|Ga0126370_10395267 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010358|Ga0126370_10639060 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 925 | Open in IMG/M |
| 3300010359|Ga0126376_11405656 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300010360|Ga0126372_10439548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1205 | Open in IMG/M |
| 3300010360|Ga0126372_12204700 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010360|Ga0126372_12780388 | Not Available | 541 | Open in IMG/M |
| 3300010361|Ga0126378_11566274 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 748 | Open in IMG/M |
| 3300010361|Ga0126378_13247757 | Not Available | 517 | Open in IMG/M |
| 3300010366|Ga0126379_11943197 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300010376|Ga0126381_100024225 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 7160 | Open in IMG/M |
| 3300010376|Ga0126381_102634055 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300010396|Ga0134126_11955751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 641 | Open in IMG/M |
| 3300010398|Ga0126383_10837794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1004 | Open in IMG/M |
| 3300010398|Ga0126383_12152850 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010399|Ga0134127_11344557 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300010399|Ga0134127_13077043 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300011270|Ga0137391_10274916 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300011271|Ga0137393_10048653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3308 | Open in IMG/M |
| 3300012081|Ga0154003_1017109 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1432 | Open in IMG/M |
| 3300012096|Ga0137389_10142833 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
| 3300012096|Ga0137389_11632982 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012096|Ga0137389_11673331 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012205|Ga0137362_11131033 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300012211|Ga0137377_10378929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1352 | Open in IMG/M |
| 3300012355|Ga0137369_10636003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300012356|Ga0137371_10115309 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300012357|Ga0137384_11558439 | Not Available | 510 | Open in IMG/M |
| 3300012359|Ga0137385_11510268 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012360|Ga0137375_10190211 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300012362|Ga0137361_11015955 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300012363|Ga0137390_10899286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Magnetococcales → unclassified Magnetococcales → Magnetococcales bacterium | 840 | Open in IMG/M |
| 3300012918|Ga0137396_10576016 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300012929|Ga0137404_10226627 | All Organisms → cellular organisms → Bacteria | 1595 | Open in IMG/M |
| 3300012944|Ga0137410_12074349 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012948|Ga0126375_12079583 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300012972|Ga0134077_10478030 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300015371|Ga0132258_11564319 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300015374|Ga0132255_101494277 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300016319|Ga0182033_10809765 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300016387|Ga0182040_11596955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 555 | Open in IMG/M |
| 3300018031|Ga0184634_10501475 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300018054|Ga0184621_10194584 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018061|Ga0184619_10036448 | All Organisms → cellular organisms → Bacteria | 2096 | Open in IMG/M |
| 3300018063|Ga0184637_10366460 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300018422|Ga0190265_10044136 | All Organisms → cellular organisms → Bacteria | 3830 | Open in IMG/M |
| 3300018431|Ga0066655_10795635 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300019259|Ga0184646_1427905 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300019458|Ga0187892_10042939 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3287 | Open in IMG/M |
| 3300019879|Ga0193723_1077243 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300019882|Ga0193713_1121235 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300020579|Ga0210407_10209810 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300021090|Ga0210377_10060160 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300021559|Ga0210409_11590353 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300021560|Ga0126371_10729449 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1138 | Open in IMG/M |
| 3300021560|Ga0126371_10747082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1125 | Open in IMG/M |
| 3300021560|Ga0126371_12447429 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300022756|Ga0222622_11076932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300025313|Ga0209431_10467913 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300025560|Ga0210108_1078188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium GWC2_70_16 | 650 | Open in IMG/M |
| 3300025908|Ga0207643_11076712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300025910|Ga0207684_10259866 | All Organisms → cellular organisms → Bacteria | 1498 | Open in IMG/M |
| 3300025910|Ga0207684_10693297 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300025942|Ga0207689_10042238 | All Organisms → cellular organisms → Bacteria | 3773 | Open in IMG/M |
| 3300025949|Ga0207667_11902880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300025961|Ga0207712_10554823 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300026297|Ga0209237_1117674 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300026313|Ga0209761_1160887 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300026318|Ga0209471_1108420 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300026324|Ga0209470_1040346 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300026325|Ga0209152_10040054 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300026332|Ga0209803_1236004 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026548|Ga0209161_10284563 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300027645|Ga0209117_1012996 | All Organisms → cellular organisms → Bacteria | 2777 | Open in IMG/M |
| 3300027646|Ga0209466_1048052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 863 | Open in IMG/M |
| 3300027646|Ga0209466_1111532 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300027875|Ga0209283_10639173 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300027903|Ga0209488_10347687 | Not Available | 1103 | Open in IMG/M |
| 3300027903|Ga0209488_10677045 | Not Available | 741 | Open in IMG/M |
| 3300027909|Ga0209382_10501907 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300027909|Ga0209382_12078234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300027910|Ga0209583_10405432 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300028380|Ga0268265_10515290 | Not Available | 1129 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1115109 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10077751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 879 | Open in IMG/M |
| 3300031226|Ga0307497_10242865 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031455|Ga0307505_10487797 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031720|Ga0307469_11080210 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031740|Ga0307468_100334867 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300031740|Ga0307468_100508526 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300031912|Ga0306921_12534304 | Not Available | 531 | Open in IMG/M |
| 3300031944|Ga0310884_10316417 | Not Available | 875 | Open in IMG/M |
| 3300031949|Ga0214473_10473692 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300032001|Ga0306922_10138488 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300032017|Ga0310899_10304462 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
| 3300032039|Ga0318559_10560766 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032076|Ga0306924_11290564 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300032174|Ga0307470_10530512 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300032180|Ga0307471_100563663 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300033004|Ga0335084_10416226 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300033550|Ga0247829_11533367 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.67% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.44% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.44% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.33% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.33% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.78% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.22% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.22% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.11% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.11% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.11% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.56% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.56% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.56% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_08239344 | 3300000033 | Soil | IGSLVGLTDEQFNTETAPGQWTYRVIAKHVLTLEQDSLKTLAADRAARAMSDGAVPR* |
| INPhiseqgaiiFebDRAFT_1012920541 | 3300000364 | Soil | QFNSETAPGEWTYRVIAKHVLALEHDSLNTIAEDRAARPAGSVGSA* |
| INPhiseqgaiiFebDRAFT_1013362061 | 3300000364 | Soil | GLTDEQFNSETAAGQWTYRVVAKHVLTLEQDSLKTIAADRAARATTT* |
| INPhiseqgaiiFebDRAFT_1049227352 | 3300000364 | Soil | RFISSLIGLTNEQFNTETAPGQWTYRVVGKHVLALEQDTLTTMAADRVKRSGQP* |
| JGI1027J12803_1070769052 | 3300000955 | Soil | IGLTDEQFNSETAPGQWTYRVVAKHVLTLEQDSLKTIRADRAGRASTK* |
| JGI10216J12902_1075729631 | 3300000956 | Soil | TDAQFNSETAPGQWTYRIIAKHVLTLEQDSLKTVAEDRAARAAGR* |
| F14TB_1001001911 | 3300001431 | Soil | DAQFNSETAPGQWSYRVIAKHVLTLEQHSLKTIAEDQAARAASR* |
| F14TB_1027494261 | 3300001431 | Soil | GLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARPNNG* |
| JGI25382J37095_100336033 | 3300002562 | Grasslands Soil | GSLIGLSDEQFNTETGPGQWTYRAVAKHVLTVEQDSLKTMAADQEARGRRSEG* |
| JGI25382J43887_104956402 | 3300002908 | Grasslands Soil | DEQFNSETAPGQWTYRVVAKHVLRLEQDSLKTLAADQAARAGGG* |
| Ga0062589_1005722563 | 3300004156 | Soil | RARFIGSLVGLTDEQFNTETAPGQWTYRVIAKHVLMLEQDSLKTLAADRAARASGDGAPTR* |
| Ga0062589_1021985151 | 3300004156 | Soil | ARLIGSLIGLTDEQFNRETVPGEWTYRVVAKHVLTLEQDSLKTIAVDQATRPSHG* |
| Ga0062589_1022329721 | 3300004156 | Soil | ARLIGSLIGLTDEQFNRETAPGEWTYRVVAKHVLTLEQDSLKTIAADQATRTSRG* |
| Ga0066396_101211041 | 3300004267 | Tropical Forest Soil | LTDEQFNRETAPGQWTYRVVAKHVLTLEQDSLRTIAADQAARTTAPTP* |
| Ga0063356_1054952881 | 3300004463 | Arabidopsis Thaliana Rhizosphere | EQFNRETKPGEWTYRVVAKHVLALEQHILATIADDRAGRVTKQTV* |
| Ga0062591_1009684823 | 3300004643 | Soil | GLTDEQFNRETAPNQWTYRVVAKHVLTLEQDTLKTIAAGRAGGTDRDPNSGVER* |
| Ga0066672_101686004 | 3300005167 | Soil | DAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTITEDQAARAASR* |
| Ga0066680_107832962 | 3300005174 | Soil | LLGLTDEQFNRETAPGQWTYRVIAKHVLMLERDSLKTIADDQAARESTR* |
| Ga0066676_100840721 | 3300005186 | Soil | ERARFIGSLIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQDSLKTLAEDQAARAASR* |
| Ga0065712_102341682 | 3300005290 | Miscanthus Rhizosphere | RGRRLVGSLIGLTDEQFNRERAPGQRPYRVVAKHVLFEQDSLKTIAADQASRMEAP* |
| Ga0066388_1003223321 | 3300005332 | Tropical Forest Soil | LIGLTDEQFNSETAAGEWTYRVVAKHVLTLEQDSLKTMAADRAGRPSTE* |
| Ga0066388_1053748733 | 3300005332 | Tropical Forest Soil | FNAETAPGQWTYRAIAKHVVEVERSSLKALAADRAARAGVTA* |
| Ga0070703_105305402 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLIGSIVGLTDEQFNRETARGQWTYRVIAKHVLTLEQDSLHTLAKDRAARVTVFRETVR |
| Ga0070708_1005158393 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRATRTNSG* |
| Ga0070708_1008389442 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LTDEQFNTETAPGQWTYRVVAKHVLTLEQDSLKTIADDQGTRSSCGVTS* |
| Ga0070708_1021903032 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EQFNSETAPGQWTYRVVAKHVLVLEQDSLKTLAADQAARRSGD* |
| Ga0066686_101436081 | 3300005446 | Soil | GLTDAQFNSETAQGQWTYRIIAKHVLTLEQDSLKTIAADQAARAAGR* |
| Ga0066689_101322961 | 3300005447 | Soil | LEERARLIGSLIGLTDEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAVDQATRTKSG* |
| Ga0066689_105309621 | 3300005447 | Soil | ARLIGSLIGLTDEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAADQATRAGSG* |
| Ga0068867_1014194841 | 3300005459 | Miscanthus Rhizosphere | TAPGEWTYRVIAKHVLALEHDSLNTIAEDQAARPAGSGGSA* |
| Ga0070706_1007485473 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | DEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAADQATRTKSG* |
| Ga0070698_1014323301 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARTNTG* |
| Ga0066661_104087111 | 3300005554 | Soil | TDEQFNRETAPGQWTYRVVAKHLLMLERDSLKTIADDQAARESAR* |
| Ga0068855_1014308915 | 3300005563 | Corn Rhizosphere | IGLTDAQFNSETAPGQWTYRVIAKHVLALEQDSLSTMAEDQAARAAGR* |
| Ga0066703_100424124 | 3300005568 | Soil | DAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR* |
| Ga0066905_1009990321 | 3300005713 | Tropical Forest Soil | EQFNRETAPGQWTYRAVAKHVLRLEQDSLKTLAADQAKRAAGG* |
| Ga0068861_1014866752 | 3300005719 | Switchgrass Rhizosphere | QFNSETAPGQWTYRVVAKHVLTLEQDSLKTIAEDPAARAGRL* |
| Ga0066903_1077441692 | 3300005764 | Tropical Forest Soil | QFNSETGPGQWSYRVVAKHVLALEQDSLKTLAADRAARASDGVARVSG* |
| Ga0068860_1002518451 | 3300005843 | Switchgrass Rhizosphere | GLTDEQFNRETVPGEWTYRVVAKHVLTLEQDSLKTIAVDQATRPSHG* |
| Ga0068862_1013912111 | 3300005844 | Switchgrass Rhizosphere | EQFNAETAPGQWTYRVVAKHVLGLEQDSLRTIAADQAARGPRQPPSAH* |
| Ga0075300_10133642 | 3300005876 | Rice Paddy Soil | LIGLTDEQFNRETAPGQWTYRVMAKHVLTLEQDSLKSVAADLATGMSQE* |
| Ga0066696_106707544 | 3300006032 | Soil | DAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARTAGR* |
| Ga0066658_100607041 | 3300006794 | Soil | LTDEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAADQATRAGSG* |
| Ga0066665_105417481 | 3300006796 | Soil | IGLTDEQFNSETAPGQWTYRAVARHVLALEQDSLKTLAADQAARRSGD* |
| Ga0066660_108598921 | 3300006800 | Soil | NGETAPGQWTYRVIAKHILTLEQDSLKTVAEDQAARAAGR* |
| Ga0075428_1001429751 | 3300006844 | Populus Rhizosphere | QFNSETAPGQWTYRVVAKHVLTLEQDSLRTIADDQAARASAPPA* |
| Ga0075421_10001181518 | 3300006845 | Populus Rhizosphere | LTDEQFNSETAAGQWTYRVVAKHVLTLEQDSLKTIAADRAARQAS* |
| Ga0075421_1005577131 | 3300006845 | Populus Rhizosphere | ERARFIGSLIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQDSLKTVAEDQAARAAGR* |
| Ga0075430_1011230531 | 3300006846 | Populus Rhizosphere | SLVGLTDEQFNAETAPGQWTYRAVAKHVLRLEQDSLATIASDRARVN* |
| Ga0075431_1010916231 | 3300006847 | Populus Rhizosphere | QFNSETAPGQWTYRVIAKHVLTLEQDSLKTVAEDQAARAAGR* |
| Ga0075425_1005061423 | 3300006854 | Populus Rhizosphere | GSLVGLTDEQFNSETAPGQWTYRAVAKHVLMLEQHSLRTMAEDRAAREGIR* |
| Ga0075425_1005807441 | 3300006854 | Populus Rhizosphere | QFNMETAPGQWTYRVIAKHVLALEQDSLKALAADRAARASGG* |
| Ga0075429_1012821511 | 3300006880 | Populus Rhizosphere | IGLTDTQFNSETAAGQWTYRVVAKHVLTLEQDSLKTIAADRAGRSGTKSTEQVN* |
| Ga0075426_105250633 | 3300006903 | Populus Rhizosphere | LTDEQFNSETAPGQWTYRAVAKHVLTLEQHSLQTMAEDRSARDGLR* |
| Ga0075424_1020347472 | 3300006904 | Populus Rhizosphere | ARLIGSLVGLTDEQFNGETAPGQWTYRVIAKHVLSLEQDSLQSLARDREARANA* |
| Ga0075436_1010937853 | 3300006914 | Populus Rhizosphere | FNMETAPGQWTYRVIAKHVLALEQDSLKALAADRAARASGG* |
| Ga0099791_103870583 | 3300007255 | Vadose Zone Soil | LIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR* |
| Ga0066710_1000511357 | 3300009012 | Grasslands Soil | GLTDEQFNAETAPGQWTYRVVAKHVLALEQDSLKTMAVDRAARPGDGLAR |
| Ga0099829_104224231 | 3300009038 | Vadose Zone Soil | IGLSDEQFNSETAPGQWTYRVVAKHVLMLERDSLKTIADDRAARERAG* |
| Ga0099829_109357781 | 3300009038 | Vadose Zone Soil | LTDEQFNSETAPGQWTYRVVAKHVLALEQDSLKTIAADQATRTSSG* |
| Ga0099830_106331432 | 3300009088 | Vadose Zone Soil | LIGLTDEQFNSETAPGQWTYRVVAKHVLALEQDSLKTIAADQATRTSSG* |
| Ga0099827_111892771 | 3300009090 | Vadose Zone Soil | DEQFNSETAPGQWTYRVIAKHVLTLEQDTVKTIAEDQAARAAGG* |
| Ga0111539_109055993 | 3300009094 | Populus Rhizosphere | LIGSLIGLTDEQFNRETAPGQWTYRAVSKHVLALEQDSLKTIAADRATRTRHE* |
| Ga0075418_101425591 | 3300009100 | Populus Rhizosphere | GLTDEQFNAETAPGQWTYRVVAKHVLMLEQDSLKTIAADRADAHA* |
| Ga0075418_104762351 | 3300009100 | Populus Rhizosphere | RARFIGSLIGLTDEQLNTDTAPGQWTYRVVAKPALTLEQDSLKTIAADRAGRASTK* |
| Ga0075418_127895431 | 3300009100 | Populus Rhizosphere | DEQFNGETAPGQWTYRVIAKHVLMLEQDSLKTLAADRAARAGVEGTATR* |
| Ga0075423_122640921 | 3300009162 | Populus Rhizosphere | GLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTITADRAARTNGG* |
| Ga0105104_104255991 | 3300009168 | Freshwater Sediment | DAQFNSETAPGQWNYRVIDKHVLTLEQDSLKTVAEDQAARAAGRRP* |
| Ga0126374_105248972 | 3300009792 | Tropical Forest Soil | GLTDQQFNGETAPGQWTYHAVAKHVLMLERNSLQTIADDRAAREPLR* |
| Ga0105057_10350632 | 3300009813 | Groundwater Sand | LIGLTDAQFNSETAAGQWTYAAIAKHVLTLEQDSLKTIAVDSAARAAGR* |
| Ga0105068_10705932 | 3300009836 | Groundwater Sand | TDEQFNRDTAPGQWTYRAVAKHVLVVEQDSLKTMAADRLARPDSGDPSR* |
| Ga0126382_102566121 | 3300010047 | Tropical Forest Soil | RARFIGSLVGLSDAQFNSETAPGQWTYRVVAKHVLVLEQDTLKTMAADQLARPGGPSR* |
| Ga0134088_104717061 | 3300010304 | Grasslands Soil | IGSLIGLTDEQFNSETAPGQWTYRVVAKHVLALEQDSLKTIAADQATRTSGG* |
| Ga0134086_100791721 | 3300010323 | Grasslands Soil | ARFIGSLIGLSDEQFNSETAAGQWTYRVVAKHVVTLEQDSLKTMTADRAGRASTK* |
| Ga0134063_101745935 | 3300010335 | Grasslands Soil | FNGETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR* |
| Ga0134062_104269902 | 3300010337 | Grasslands Soil | GLTDEQFNRETAAGQWTYRVVAKHVLTLEQDSLKTMTADRAGRANSH* |
| Ga0126370_103952671 | 3300010358 | Tropical Forest Soil | LTDEQFNSETAPGQWTYRAVAKHVLMLEQHTLKTMAEDRAAREERR* |
| Ga0126370_106390604 | 3300010358 | Tropical Forest Soil | SLVGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAAREGEPSP* |
| Ga0126376_114056561 | 3300010359 | Tropical Forest Soil | FNRETAPGQWTYRVVAKHVLTLEQDSLRTIAADQAARTTAPTP* |
| Ga0126372_104395484 | 3300010360 | Tropical Forest Soil | TDEQFNRETAPGQWTYRAVAKHVLMLERNSLQTMADDRVARGQLR* |
| Ga0126372_122047002 | 3300010360 | Tropical Forest Soil | GSLVGLTDEQFNGQTAPGQWTYRAVAKHVLMLERDSLQTIVDDRAAREPLR* |
| Ga0126372_127803882 | 3300010360 | Tropical Forest Soil | VGSLVGLTDAQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAASEGVASP* |
| Ga0126378_115662742 | 3300010361 | Tropical Forest Soil | DEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAAREGEPSP* |
| Ga0126378_132477572 | 3300010361 | Tropical Forest Soil | DEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAASEGVASP* |
| Ga0126379_119431971 | 3300010366 | Tropical Forest Soil | SSLVGLTDAQFNTETAPGQWTYRAIAKHVLAVEQDSLKVLAADRSARAGQGA* |
| Ga0126381_1000242256 | 3300010376 | Tropical Forest Soil | RLVGSLVGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAGGDGVPAPSD* |
| Ga0126381_1026340551 | 3300010376 | Tropical Forest Soil | EQFNSETAAGQWTYRVVAKHVLTLEQDSLKTIAADRAARQAS* |
| Ga0134126_119557511 | 3300010396 | Terrestrial Soil | QFNRETAPGQWTYRVVAKHVLTLEQDSLKTIAADQGTRPGHG* |
| Ga0126383_108377943 | 3300010398 | Tropical Forest Soil | GLTDEQFNAETAPGQWTYRVIAKHVLALEQGSLETLAADRAARDGREGAERISTRATKS* |
| Ga0126383_121528501 | 3300010398 | Tropical Forest Soil | GSLVGLTDEQFNGQTAPGQWTYRAVAKHVLTLERDSLQTIADDRAAREPLR* |
| Ga0134127_113445572 | 3300010399 | Terrestrial Soil | LTDEQFNGETAPGQWTYRVIAKHVLMLERDSLKTIADDQAARESAR* |
| Ga0134127_130770432 | 3300010399 | Terrestrial Soil | SLIGLTDEQFNRETAPGEWTYRVVAKHVLTLEQDSLKTIAADQATRTSRG* |
| Ga0137391_102749163 | 3300011270 | Vadose Zone Soil | FNSETAPGQWTYRVVAKHVLTLEQDSLKTIAADQASRTSSA* |
| Ga0137393_100486538 | 3300011271 | Vadose Zone Soil | LIGSLIGLTDEQFNSETAPGQWTYRVVAKHVLALEQDSLKTIAADQATRTSSG* |
| Ga0154003_10171094 | 3300012081 | Attine Ant Fungus Gardens | LTDEQFNSETAPGQWTYRVVAKHVLLLEQDSLKAIAADQAARQGTS* |
| Ga0137389_101428331 | 3300012096 | Vadose Zone Soil | GSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARVSRG* |
| Ga0137389_116329821 | 3300012096 | Vadose Zone Soil | RLVGSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARASRG* |
| Ga0137389_116733311 | 3300012096 | Vadose Zone Soil | GSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARVSSG* |
| Ga0137362_111310331 | 3300012205 | Vadose Zone Soil | EQFNRETAPGPWTYRVVAKHVLALEQDSLKTIAADQATMTRSV* |
| Ga0137377_103789291 | 3300012211 | Vadose Zone Soil | GSLLGLTDEQFNRETAPGQWTYRVIAKHLLMLERDSLKTIADDQAAGESAR* |
| Ga0137369_106360033 | 3300012355 | Vadose Zone Soil | ITASQFNSETAPGQWTYRVVAKHVLGLEQDSFRTVAADQAMRSGGA* |
| Ga0137371_101153091 | 3300012356 | Vadose Zone Soil | LIGSLIGLTDEQFNSETAPGQWTYRVVAEHVLALEQHSLKTIAAEQATRTKTTTT* |
| Ga0137384_115584392 | 3300012357 | Vadose Zone Soil | EQFNAETAPGQWTYRTVAKHLLALEQDSLKTVTADRAARASSGSGS* |
| Ga0137385_115102681 | 3300012359 | Vadose Zone Soil | AERARFIGSLIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQHSRKTIAEDQAARTADR* |
| Ga0137375_101902111 | 3300012360 | Vadose Zone Soil | LVGLTDEQFNRETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARASGG* |
| Ga0137361_110159552 | 3300012362 | Vadose Zone Soil | ARFVGTLIGLTDEQFNSETAPGQWTYRVVAKHVLVLEQDSLKTLAADQAARRSGD* |
| Ga0137390_108992861 | 3300012363 | Vadose Zone Soil | IGLTDEQFNSETAPGQWTYRVVAKHLLVLEQDSLKTLAADQAARRSGD* |
| Ga0137396_105760164 | 3300012918 | Vadose Zone Soil | TDAQFNGETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR* |
| Ga0137404_102266275 | 3300012929 | Vadose Zone Soil | TDEQFNSETAPNQWTYRVVAKHVLKLEQDSLKAIAADRAARTDNG* |
| Ga0137410_120743492 | 3300012944 | Vadose Zone Soil | IGSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARTNTG* |
| Ga0126375_100773101 | 3300012948 | Tropical Forest Soil | NAETAPGQWTYRVIAKHVLALEQDSLKTLATDRAARAAREELTSP* |
| Ga0126375_120795832 | 3300012948 | Tropical Forest Soil | ERARLIGSFVGLTDEQFNMETAPGQWTYRVIAKHVLALEQDSLKALAADSSSRRRG* |
| Ga0126369_126384461 | 3300012971 | Tropical Forest Soil | TETAPGQWTYRVVARHVLALEQDTLKTMAADRVKRSGQS* |
| Ga0134077_104780301 | 3300012972 | Grasslands Soil | ERTRLIGSLIGLTDEQFNSETAPGQWTYRAVAEHVLALEQHSLKTIAADQATRMKTTTT* |
| Ga0132258_115643193 | 3300015371 | Arabidopsis Rhizosphere | GLIGSLIGLTDEQFNRETGPGQWTYRVVSKHVLALEQDSLKTIAADQATRTRSE* |
| Ga0132255_1014942771 | 3300015374 | Arabidopsis Rhizosphere | IGSLIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARVASQ* |
| Ga0182033_108097651 | 3300016319 | Soil | GSLVGLTDEQFNGETAPGQWTYRAVAKHVLMLERDSLQTIADDRAAREPLR |
| Ga0182040_115969552 | 3300016387 | Soil | ARLVGSLVGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADIAARGGAEGLAAP |
| Ga0184634_105014751 | 3300018031 | Groundwater Sediment | QFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARVSSG |
| Ga0184621_101945842 | 3300018054 | Groundwater Sediment | GLTDAQFNGETAPGQWTYRVIAKHVLTLEQDSLETIAEDQAARAAGSVGSG |
| Ga0184619_100364481 | 3300018061 | Groundwater Sediment | TAPGQWTYRIIAKHVLTLEQDSVKTIAEDQAARAAGSVGSG |
| Ga0184637_103664602 | 3300018063 | Groundwater Sediment | GSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLRTIAADRAARTSTG |
| Ga0190265_100441364 | 3300018422 | Soil | EQFNRETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARMDNP |
| Ga0066655_107956352 | 3300018431 | Grasslands Soil | VGTLIGLTDEQFNSETAPDQWTYRVVARHVLALEQDSLKTLAADQAARRSGD |
| Ga0184646_14279051 | 3300019259 | Groundwater Sediment | VGLTDEQFNSETAPGQWTYRVVAKHVLRLEQDSLKTLAADQAARAGGG |
| Ga0187892_100429394 | 3300019458 | Bio-Ooze | VVGGARAFIASLIGLTDEQFNSETAPGQWTYRVVAKHVLALERDSLKTLAADQAARAAG |
| Ga0193723_10772431 | 3300019879 | Soil | TDEQFNSETAPGEWTYRVIAKHVLALEQDSLKTIAADQAARATTQPAR |
| Ga0193713_11212351 | 3300019882 | Soil | TDEQFNSETAPNQWTYRVVAKHVLKLEQDSLATIARDRAARTDNV |
| Ga0210407_102098103 | 3300020579 | Soil | IGLTDEQFNSETAPSQWTYRVVAKHVLTLEQDSLKTIAADQASRPSTT |
| Ga0210377_100601601 | 3300021090 | Groundwater Sediment | ETAPGQWTYRVIAKHVLALEQDSLKTIATDQAARANSR |
| Ga0210409_115903531 | 3300021559 | Soil | LIGLTDEQFNSETAPSQWTYRVVAKHVLTLEQDSLKTIAADQAARASTT |
| Ga0126371_107294493 | 3300021560 | Tropical Forest Soil | LTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARAAREGEPSP |
| Ga0126371_107470823 | 3300021560 | Tropical Forest Soil | VGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRAARGGAEGLASP |
| Ga0126371_124474291 | 3300021560 | Tropical Forest Soil | FNAETKPGEWTYRVIAKHVLALEQDSLKTLAADRAARASGQGAVSG |
| Ga0222622_110769322 | 3300022756 | Groundwater Sediment | NNETAPDQWTYRVIAKHILTLEQHSLKTIAEDQAARAANR |
| Ga0209431_104679132 | 3300025313 | Soil | SLIGLTDEQFNGETAPGQWTYRVVAKHVLTLEQDSLKTIAMDQAARASASPAGSPATLR |
| Ga0210108_10781883 | 3300025560 | Natural And Restored Wetlands | TDEQFNAETAPGHWTYRVVAKHVLAVEQDSLKAMAADRAGRASGMSAS |
| Ga0207643_110767122 | 3300025908 | Miscanthus Rhizosphere | RLIGSLIGLTDEQFNRETVPGEWTYRVVAKHVLTLEQDSLKTIAVDQATRPSHG |
| Ga0207684_102598663 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GSLIGLTDEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAADQATRTKSG |
| Ga0207684_106932971 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLIGSLVGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADQAARTSNG |
| Ga0207689_100422381 | 3300025942 | Miscanthus Rhizosphere | ARLVGSLVGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRTARTNGG |
| Ga0207667_119028801 | 3300025949 | Corn Rhizosphere | RLIGSLIGLTDEQFNRETAPGEWTYRVVAKHVLTLEQDSLKTIAADQATRTSRG |
| Ga0207712_105548232 | 3300025961 | Switchgrass Rhizosphere | TDEQFNAETAPGQWTYRVVAKHVLGLEQDSLKTIAADQAARGPSEPSRAH |
| Ga0209237_11176741 | 3300026297 | Grasslands Soil | RTRLIGSLIGLTDEQFNSETAPGQWTYRAVAEHVLALEQHSLKTIAADQATRTKATTT |
| Ga0209761_11608872 | 3300026313 | Grasslands Soil | GSLIGLTDEQFNSETAPGQWTYRAVAEHVLALEQHSLKTIAADQATRTKATTT |
| Ga0209471_11084202 | 3300026318 | Soil | LTDEQFNSETAAGQWTYRVVAKHLLTLEQDSLKTIAADRASRASTQLPAEVRGAPS |
| Ga0209470_10403461 | 3300026324 | Soil | LIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQDSLKTLAEDQAARAASR |
| Ga0209152_100400541 | 3300026325 | Soil | LTDEQFNRETAPGQWTYRVVAEHVLALEQHSLKTIAADQATRAGSG |
| Ga0209803_12360044 | 3300026332 | Soil | LTDAQFNGETAPGQWTYRVIAKHILTLEQDSLKTVAEDQAARAAGR |
| Ga0209161_102845631 | 3300026548 | Soil | QFNSETGPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR |
| Ga0209684_10025701 | 3300027527 | Tropical Forest Soil | NAETAPGQWTYRVIAKHVLALEQDSLKTLAADRASRAAREGVASP |
| Ga0209117_10129961 | 3300027645 | Forest Soil | DEQFNTETAPGQWTYRVVAKHVLTLEQDSLKTIAANHATRTSSG |
| Ga0209466_10480521 | 3300027646 | Tropical Forest Soil | SLVGLTDEQFNAETAPGQWTYRVIAKHVLALERDSLKTLAADRAARGGAEGLASP |
| Ga0209466_11115321 | 3300027646 | Tropical Forest Soil | SLVGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLATDRAARAAREELTSP |
| Ga0209283_106391733 | 3300027875 | Vadose Zone Soil | IGSLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRAARVSRG |
| Ga0209488_103476872 | 3300027903 | Vadose Zone Soil | SLIGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSPKTVAEDQTARAAGR |
| Ga0209488_106770452 | 3300027903 | Vadose Zone Soil | IGLTDEQFNRETAPSQWTYRVVAKHVLTLEQDSLNTIAADRAARTNSG |
| Ga0209382_105019073 | 3300027909 | Populus Rhizosphere | GSLIGLTDAQFNSETAPGQWTYRVIAKHVLTLEQDSLKTVAEDQAARAAGR |
| Ga0209382_120782342 | 3300027909 | Populus Rhizosphere | DEQFNSETAPGQWTYRVVAKHVLTLEQDSLKTIAEDQAARAGSRPPQWV |
| Ga0209583_104054321 | 3300027910 | Watersheds | LIGLTDEQFNRETAPGEWTYRVVAKHVLTLEQDSLKTIAADQATRTSRG |
| Ga0268265_105152901 | 3300028380 | Switchgrass Rhizosphere | VGSLVGLTDEQFNSETAPNQWTYRVVAKHVLTLEQDSLKTIAADRTARTNGG |
| (restricted) Ga0255311_11151091 | 3300031150 | Sandy Soil | LTDAQFNSGTAPGQWTYRVIAKHVLTLEQDSLKTIAEDLAARTAGW |
| (restricted) Ga0255310_100777512 | 3300031197 | Sandy Soil | LTDAQFNSETAPGQWTYRVIAKHVLTLEQHSLKTIAEDQAARAASR |
| Ga0307497_102428651 | 3300031226 | Soil | GLTDEQFNRETAPGQWTYRVVSKHVLALEQDSLKTIAADQATRTRSE |
| Ga0307505_104877972 | 3300031455 | Soil | LIGSLIGLTDEQFNRETAPGQWTYRVIAKHVLALEQDSLKTIAADQATMSRSE |
| Ga0307469_110802103 | 3300031720 | Hardwood Forest Soil | TDEQFNRETAPGQWTYRVIAKHVLTLEQDSLRTMASDRAARASAGPAS |
| Ga0307468_1003348671 | 3300031740 | Hardwood Forest Soil | DAQFNNETAPGQWSYRVIAKHVLTLEQHSLKTIAEDQTARAASR |
| Ga0307468_1005085262 | 3300031740 | Hardwood Forest Soil | IGLTDEQFNSETAPGEWTYRVIAKHVLAIEQDSLKTIASDQAARVSTRSEA |
| Ga0307475_106620542 | 3300031754 | Hardwood Forest Soil | EWTYRVIAKHVLALEQDSLRTMAADQTARATGRPAS |
| Ga0306921_125343042 | 3300031912 | Soil | QFNSETAAGQWTYRVVAKHVLALEQDTLKTIAADRVQRSGRP |
| Ga0310884_103164171 | 3300031944 | Soil | ARFIGSLVGLTDEQFNAETAPGQWTYRVVAKHVLMLEQDSLKTIAADRADAHA |
| Ga0214473_104736921 | 3300031949 | Soil | RFIGSLTGLTAEQFNSETAPGQWTYRVIAKHVLALEQDSLKTIATDQAARANSR |
| Ga0306922_101384881 | 3300032001 | Soil | LVGLTDEQFNGETAPGQWTYRAVAKHVLMLERDSLQTIADDRAAREPLR |
| Ga0310899_103044622 | 3300032017 | Soil | NSETAPDQWTYRVIAKHVLTLEQHSLKTIAEDQAARGANR |
| Ga0318559_105607661 | 3300032039 | Soil | LVGLTDEQFNTETAPGQWTYRVIAKHVLAVEQDSLKTLAADRAARASDGATRASG |
| Ga0306924_112905641 | 3300032076 | Soil | FVGSLVGLTDEQFNAETAPGQWTYRVIAKHVLALEQDSLKTLAADRASRAAAEKVASP |
| Ga0307470_105305122 | 3300032174 | Hardwood Forest Soil | LIGSLIGLTDEQFNRETMPGQWTYRVVSKHVLALEQDSLKTIATDQATRTRSE |
| Ga0307471_1005636631 | 3300032180 | Hardwood Forest Soil | ERARFIGSLIGLTDEQFNSETAAGQWTYRVVAKHVLTLEQDSLKTMTADRAGRASTE |
| Ga0335084_104162261 | 3300033004 | Soil | ARFIGSLIGLSDAQFNGETAPGQWTYRVIAKHVLALEQDSLNTMAADQAARAAGR |
| Ga0247829_115333673 | 3300033550 | Soil | LIGSLIGLTDEQFNQETAPGQWTYRVIAKHVLTLEQDSLKTITADQAARANCR |
| ⦗Top⦘ |