


| Basic Information | |
|---|---|
| Family ID | F032466 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFPTPAD |
| Number of Associated Samples | 153 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.89 % |
| % of genes from short scaffolds (< 2000 bps) | 91.11 % |
| Associated GOLD sequencing projects | 147 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.556 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (12.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.66% β-sheet: 0.00% Coil/Unstructured: 56.34% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 18.33 |
| PF00248 | Aldo_ket_red | 7.78 |
| PF13561 | adh_short_C2 | 7.22 |
| PF12804 | NTP_transf_3 | 6.11 |
| PF04909 | Amidohydro_2 | 4.44 |
| PF00753 | Lactamase_B | 4.44 |
| PF16868 | NMT1_3 | 3.89 |
| PF06348 | DUF1059 | 2.78 |
| PF05977 | MFS_3 | 2.22 |
| PF02515 | CoA_transf_3 | 2.22 |
| PF03401 | TctC | 1.67 |
| PF13442 | Cytochrome_CBB3 | 1.67 |
| PF00575 | S1 | 1.67 |
| PF06314 | ADC | 1.11 |
| PF02775 | TPP_enzyme_C | 1.11 |
| PF01019 | G_glu_transpept | 1.11 |
| PF05721 | PhyH | 1.11 |
| PF09084 | NMT1 | 1.11 |
| PF12146 | Hydrolase_4 | 1.11 |
| PF02668 | TauD | 1.11 |
| PF00326 | Peptidase_S9 | 1.11 |
| PF00072 | Response_reg | 0.56 |
| PF00106 | adh_short | 0.56 |
| PF00496 | SBP_bac_5 | 0.56 |
| PF11893 | DUF3413 | 0.56 |
| PF12802 | MarR_2 | 0.56 |
| PF09448 | MmlI | 0.56 |
| PF00005 | ABC_tran | 0.56 |
| PF03446 | NAD_binding_2 | 0.56 |
| PF07969 | Amidohydro_3 | 0.56 |
| PF08659 | KR | 0.56 |
| PF02776 | TPP_enzyme_N | 0.56 |
| PF01022 | HTH_5 | 0.56 |
| PF13185 | GAF_2 | 0.56 |
| PF00710 | Asparaginase | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 18.33 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.22 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 2.22 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.67 |
| COG0252 | L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D | Translation, ribosomal structure and biogenesis [J] | 1.11 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.11 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.11 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.11 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 1.11 |
| COG4689 | Acetoacetate decarboxylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.11 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.11 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.56 % |
| Unclassified | root | N/A | 19.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c1813648 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300000443|F12B_10018749 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
| 3300000550|F24TB_10580343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 868 | Open in IMG/M |
| 3300000955|JGI1027J12803_106648559 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300002558|JGI25385J37094_10038863 | Not Available | 1646 | Open in IMG/M |
| 3300002561|JGI25384J37096_10064276 | Not Available | 1360 | Open in IMG/M |
| 3300005181|Ga0066678_10220876 | Not Available | 1216 | Open in IMG/M |
| 3300005183|Ga0068993_10074268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1043 | Open in IMG/M |
| 3300005334|Ga0068869_100010991 | All Organisms → cellular organisms → Bacteria | 5928 | Open in IMG/M |
| 3300005336|Ga0070680_100519957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 1019 | Open in IMG/M |
| 3300005441|Ga0070700_100760146 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005446|Ga0066686_10686884 | Not Available | 692 | Open in IMG/M |
| 3300005447|Ga0066689_11034983 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005458|Ga0070681_10589528 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1026 | Open in IMG/M |
| 3300005467|Ga0070706_102026145 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005526|Ga0073909_10488141 | Not Available | 594 | Open in IMG/M |
| 3300005556|Ga0066707_10934263 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 531 | Open in IMG/M |
| 3300005561|Ga0066699_11094053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300005577|Ga0068857_102354898 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005618|Ga0068864_101417614 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300005618|Ga0068864_102035090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 580 | Open in IMG/M |
| 3300005718|Ga0068866_10994132 | Not Available | 596 | Open in IMG/M |
| 3300005764|Ga0066903_103501826 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005764|Ga0066903_106834066 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005843|Ga0068860_100505842 | Not Available | 1206 | Open in IMG/M |
| 3300006163|Ga0070715_10192805 | Not Available | 1030 | Open in IMG/M |
| 3300006796|Ga0066665_10038350 | All Organisms → cellular organisms → Bacteria | 3214 | Open in IMG/M |
| 3300006797|Ga0066659_10017383 | All Organisms → cellular organisms → Bacteria | 4033 | Open in IMG/M |
| 3300006846|Ga0075430_101250885 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300006847|Ga0075431_100315648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1577 | Open in IMG/M |
| 3300006852|Ga0075433_11075775 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006852|Ga0075433_11204962 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006853|Ga0075420_100443317 | Not Available | 1122 | Open in IMG/M |
| 3300006854|Ga0075425_100577783 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300006871|Ga0075434_100719586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1015 | Open in IMG/M |
| 3300006880|Ga0075429_100493935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1072 | Open in IMG/M |
| 3300006894|Ga0079215_10934074 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 627 | Open in IMG/M |
| 3300006904|Ga0075424_100253213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1872 | Open in IMG/M |
| 3300006954|Ga0079219_10815752 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300007076|Ga0075435_101874156 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300007255|Ga0099791_10223332 | Not Available | 890 | Open in IMG/M |
| 3300009088|Ga0099830_10809452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 773 | Open in IMG/M |
| 3300009089|Ga0099828_11502118 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300009090|Ga0099827_11745880 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009094|Ga0111539_11464454 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300009100|Ga0075418_11055725 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300009100|Ga0075418_11412127 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300009147|Ga0114129_10915196 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
| 3300009156|Ga0111538_11505499 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300009162|Ga0075423_12111551 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300009162|Ga0075423_12362369 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300009174|Ga0105241_10772032 | Not Available | 883 | Open in IMG/M |
| 3300009177|Ga0105248_12465374 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009814|Ga0105082_1126285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300010029|Ga0105074_1051108 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 730 | Open in IMG/M |
| 3300010043|Ga0126380_11613552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300010154|Ga0127503_10925419 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 867 | Open in IMG/M |
| 3300010301|Ga0134070_10000797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9492 | Open in IMG/M |
| 3300010325|Ga0134064_10499787 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010358|Ga0126370_11826800 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300010359|Ga0126376_10830572 | Not Available | 905 | Open in IMG/M |
| 3300010359|Ga0126376_11518522 | Not Available | 699 | Open in IMG/M |
| 3300010360|Ga0126372_10823971 | Not Available | 922 | Open in IMG/M |
| 3300010361|Ga0126378_10964407 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010361|Ga0126378_11146794 | Not Available | 877 | Open in IMG/M |
| 3300010362|Ga0126377_12949686 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300010397|Ga0134124_10021698 | All Organisms → cellular organisms → Bacteria | 5270 | Open in IMG/M |
| 3300010868|Ga0124844_1091876 | Not Available | 1146 | Open in IMG/M |
| 3300011271|Ga0137393_10444631 | Not Available | 1111 | Open in IMG/M |
| 3300012096|Ga0137389_11050125 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012202|Ga0137363_10451605 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300012205|Ga0137362_10673313 | Not Available | 890 | Open in IMG/M |
| 3300012205|Ga0137362_11429103 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012207|Ga0137381_10051965 | All Organisms → cellular organisms → Bacteria | 3387 | Open in IMG/M |
| 3300012207|Ga0137381_11454882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300012351|Ga0137386_10042146 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3135 | Open in IMG/M |
| 3300012351|Ga0137386_10424708 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300012362|Ga0137361_11692418 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300012685|Ga0137397_10245637 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300012922|Ga0137394_10272875 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300012922|Ga0137394_10417832 | Not Available | 1143 | Open in IMG/M |
| 3300012971|Ga0126369_12866385 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300012971|Ga0126369_13149396 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300012975|Ga0134110_10374878 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300013306|Ga0163162_12708741 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300014150|Ga0134081_10143275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 780 | Open in IMG/M |
| 3300014254|Ga0075312_1069810 | Not Available | 694 | Open in IMG/M |
| 3300014265|Ga0075314_1147377 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300014310|Ga0075331_1142061 | Not Available | 583 | Open in IMG/M |
| 3300014326|Ga0157380_10680290 | Not Available | 1031 | Open in IMG/M |
| 3300014326|Ga0157380_10881385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 919 | Open in IMG/M |
| 3300015054|Ga0137420_1454636 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300015241|Ga0137418_10974787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 616 | Open in IMG/M |
| 3300015264|Ga0137403_11599039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 505 | Open in IMG/M |
| 3300015372|Ga0132256_101106195 | Not Available | 907 | Open in IMG/M |
| 3300015373|Ga0132257_101173471 | Not Available | 971 | Open in IMG/M |
| 3300015373|Ga0132257_103175969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300015374|Ga0132255_100702467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1502 | Open in IMG/M |
| 3300016357|Ga0182032_11526668 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300016445|Ga0182038_10760079 | Not Available | 847 | Open in IMG/M |
| 3300017997|Ga0184610_1066160 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1096 | Open in IMG/M |
| 3300018056|Ga0184623_10141571 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1112 | Open in IMG/M |
| 3300018089|Ga0187774_11029363 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300018422|Ga0190265_11512508 | All Organisms → cellular organisms → Bacteria | 784 | Open in IMG/M |
| 3300018422|Ga0190265_12947614 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300018429|Ga0190272_10634666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 946 | Open in IMG/M |
| 3300018433|Ga0066667_10494429 | Not Available | 1007 | Open in IMG/M |
| 3300018468|Ga0066662_10751958 | Not Available | 939 | Open in IMG/M |
| 3300019259|Ga0184646_1231536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300020004|Ga0193755_1192178 | Not Available | 589 | Open in IMG/M |
| 3300021088|Ga0210404_10135814 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300021090|Ga0210377_10040746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3261 | Open in IMG/M |
| 3300021344|Ga0193719_10041149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2002 | Open in IMG/M |
| 3300021344|Ga0193719_10304067 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300021344|Ga0193719_10374440 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300024330|Ga0137417_1246410 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300025313|Ga0209431_10606442 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300025792|Ga0210143_1023115 | Not Available | 1083 | Open in IMG/M |
| 3300025899|Ga0207642_10362898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
| 3300025910|Ga0207684_10718780 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300025917|Ga0207660_10005982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7901 | Open in IMG/M |
| 3300025921|Ga0207652_11343645 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300025930|Ga0207701_10641332 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300025959|Ga0210116_1101739 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300026029|Ga0208002_1022746 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300026032|Ga0208419_1005233 | Not Available | 1489 | Open in IMG/M |
| 3300026325|Ga0209152_10146539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 897 | Open in IMG/M |
| 3300026331|Ga0209267_1220591 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300026334|Ga0209377_1182044 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300026377|Ga0257171_1017553 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300026480|Ga0257177_1044709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 677 | Open in IMG/M |
| 3300026499|Ga0257181_1057923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 651 | Open in IMG/M |
| 3300026548|Ga0209161_10199634 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300027378|Ga0209981_1082942 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027448|Ga0207446_101653 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300027462|Ga0210000_1048579 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027471|Ga0209995_1007802 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
| 3300027527|Ga0209684_1011600 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300027654|Ga0209799_1058398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300027654|Ga0209799_1079965 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 737 | Open in IMG/M |
| 3300027655|Ga0209388_1130327 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027657|Ga0256865_1164950 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300027873|Ga0209814_10068557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
| 3300027874|Ga0209465_10034779 | Not Available | 2382 | Open in IMG/M |
| 3300027880|Ga0209481_10456229 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027882|Ga0209590_10371839 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300028608|Ga0247819_10137044 | Not Available | 1265 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1028226 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300031548|Ga0307408_100594263 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300031564|Ga0318573_10014708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3407 | Open in IMG/M |
| 3300031564|Ga0318573_10017339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3182 | Open in IMG/M |
| 3300031640|Ga0318555_10018360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3249 | Open in IMG/M |
| 3300031640|Ga0318555_10447636 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300031720|Ga0307469_10568376 | Not Available | 1007 | Open in IMG/M |
| 3300031720|Ga0307469_11948999 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300031740|Ga0307468_100463513 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300031769|Ga0318526_10432153 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300031805|Ga0318497_10251264 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300031820|Ga0307473_10123539 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300031896|Ga0318551_10404680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300032012|Ga0310902_10993834 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300032075|Ga0310890_10706977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 790 | Open in IMG/M |
| 3300032090|Ga0318518_10055303 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1898 | Open in IMG/M |
| 3300032174|Ga0307470_10229629 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300032174|Ga0307470_11157367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 626 | Open in IMG/M |
| 3300032174|Ga0307470_11290929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300032179|Ga0310889_10036129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1852 | Open in IMG/M |
| 3300032180|Ga0307471_100078548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2890 | Open in IMG/M |
| 3300032180|Ga0307471_101141412 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300032180|Ga0307471_102662164 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032211|Ga0310896_10087864 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300032421|Ga0310812_10149020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 993 | Open in IMG/M |
| 3300033550|Ga0247829_11249144 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300033551|Ga0247830_10141032 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300033551|Ga0247830_10538521 | Not Available | 921 | Open in IMG/M |
| 3300034114|Ga0364938_091732 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300034665|Ga0314787_097753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 542 | Open in IMG/M |
| 3300034667|Ga0314792_134613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 647 | Open in IMG/M |
| 3300034673|Ga0314798_106183 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 599 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.78% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.89% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.22% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.67% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.67% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.11% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.11% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.11% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.56% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.56% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.56% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025959 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026032 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027448 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G08K5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027657 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeq | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034114 | Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17 | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034667 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034673 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_18136481 | 3300000033 | Soil | VTTRGIQVVRGHLAKLPPANALTIEQRRAQYDRAERVFPTPADVKIEQVTAPD |
| F12B_100187493 | 3300000443 | Soil | VTTRGIQAVRGHLAKLPPASALTIEQRRAQYDRAE |
| F24TB_105803435 | 3300000550 | Soil | MAERGIHIVRAHLAKLPPSXXXXXXXXRAQYDRAE |
| JGI1027J12803_1066485591 | 3300000955 | Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFPTPAD |
| JGI25385J37094_100388631 | 3300002558 | Grasslands Soil | MSDKGIHLVREHLAKLPASNTLTTAQRRAQYERAERVFPTPPDVKVETIAAP |
| JGI25384J37096_100642762 | 3300002561 | Grasslands Soil | MSDKGIHLVREHLAKLPAPNTLTTAQRRAQYERAERVFPTPPDVKVETIA |
| Ga0066678_102208761 | 3300005181 | Soil | MSERGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPD |
| Ga0068993_100742683 | 3300005183 | Natural And Restored Wetlands | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAEKAFPTPPDVKVE |
| Ga0068869_1000109911 | 3300005334 | Miscanthus Rhizosphere | MADRGIEAVRAHLAKLPPSDTLTVAERRLQYERAERVFPIPP |
| Ga0070680_1005199571 | 3300005336 | Corn Rhizosphere | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAETVFPTPPEV |
| Ga0070700_1007601462 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTRGIQVVRGHLAKLPPANALTIEQRRAQYDRAERVFPTPADV |
| Ga0066686_106868841 | 3300005446 | Soil | MTTRGIDAVLAHLAKLPPPESLTLAEQRAQYERAERAFPIPTDVTVER |
| Ga0066689_110349832 | 3300005447 | Soil | VTERGIHVVREHLAKLPPASSLTTEQRRAQYDRAERAFPTPADVAIERV |
| Ga0070681_105895281 | 3300005458 | Corn Rhizosphere | MSQRGIDVVRAHLAKLPRTDSMTIAERRAQYDRAERVFATPADV |
| Ga0070706_1020261452 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGDGIAVVRAHLAKIPPANTVAERRAQYDRAERVFPMPADVSVKP |
| Ga0073909_104881412 | 3300005526 | Surface Soil | MSDRGIQAVREHLAKLPPSNTLTIEQRRKQYERAERVFPT |
| Ga0066707_100153404 | 3300005556 | Soil | MTTRGVDAVLAHLAKLPPQESLTLAEQRAQYERAERAFPVPADVTV |
| Ga0066707_109342632 | 3300005556 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRGQYDRAERVFSTPADVAVEVVK |
| Ga0066699_110940532 | 3300005561 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRGQYDRAERVFPTPADVAVEVVKAP |
| Ga0068857_1023548981 | 3300005577 | Corn Rhizosphere | MTARGIDVVRAHLAKLPPSASLSIAERRAQYDRAERVFPTPADV |
| Ga0068864_1014176142 | 3300005618 | Switchgrass Rhizosphere | MDKGIDAVRAHLAKLPPSDSMTVAQRRTQYERAEKAFPTPPDVKVEHVT |
| Ga0068864_1020350901 | 3300005618 | Switchgrass Rhizosphere | MADRGIEVVHAHLAKLPPADSLTVAERRAQYERAEKVF |
| Ga0068866_109941322 | 3300005718 | Miscanthus Rhizosphere | MSDRGIQAVREHLAKLPPSNTLTIEQRRKQYERAERVFPTPADV |
| Ga0066903_1035018262 | 3300005764 | Tropical Forest Soil | MSARGIDVVRAHLAKIPPATTVAEKRAQYDRAERVFPVPGDVAVKAV |
| Ga0066903_1068340661 | 3300005764 | Tropical Forest Soil | MAERGIEVVRAHLAKLPPADSLTLAERRSQYERAEKVFP |
| Ga0068860_1005058421 | 3300005843 | Switchgrass Rhizosphere | MADRGIEVVHAHLAKLPPADSLTVAERRAQYERAE |
| Ga0070715_101928051 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MADRGIEVVRAHLAKLPPSDSLTVAERRAQYERAEKVFP |
| Ga0066665_100383504 | 3300006796 | Soil | MADRGIEVVRAHLAKLPPADSLTLAERRAQYERAEK |
| Ga0066659_100173834 | 3300006797 | Soil | MSERGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTP |
| Ga0075430_1012508851 | 3300006846 | Populus Rhizosphere | MSDKGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTP |
| Ga0075431_1003156482 | 3300006847 | Populus Rhizosphere | MTARGIKVVREHLAKHPAPADVAEKRAQYDRAERVFKTPADVRVE |
| Ga0075433_110757751 | 3300006852 | Populus Rhizosphere | MSDKGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPD |
| Ga0075433_112049622 | 3300006852 | Populus Rhizosphere | MADRGIEVVRAHLAKLPPSDSLTIAERRAQYERAEKAFPIPPEVKVER |
| Ga0075420_1004433172 | 3300006853 | Populus Rhizosphere | MPAMSDKGIHVVREHLAKLPPSNTLTIAERRAQYERAERIFPTPPDVKVET |
| Ga0075425_1005777831 | 3300006854 | Populus Rhizosphere | VIDRGIGAVRAHLAKLPPSDSLTIAERRAQYERAERVFPIPLDV |
| Ga0075434_1007195863 | 3300006871 | Populus Rhizosphere | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFATPADVAIEV |
| Ga0075429_1004939353 | 3300006880 | Populus Rhizosphere | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTP |
| Ga0079215_109340741 | 3300006894 | Agricultural Soil | MSDRGIHFVREHLAKLPPSSTLTLEQRRAQYERAERVFPTPADVAVE |
| Ga0075424_1002532131 | 3300006904 | Populus Rhizosphere | VTTRGIQAVRGHLAKLPPASALTIEQRRAQYDRAERVFPTPADVRIE |
| Ga0079219_108157522 | 3300006954 | Agricultural Soil | MSDKGIHLVREHLAKLPPSNTLTIAQRRAQYERAERAFPTPPD |
| Ga0075435_1018741561 | 3300007076 | Populus Rhizosphere | MSQRGIDVVRAHLAKLPPTDSMTVAERRAQYDRAERVFVTP |
| Ga0099791_102233321 | 3300007255 | Vadose Zone Soil | MADRGIDVVRAHLAKLPPSDSLTVAERRAQYERAEKAFPTPAEVKVER |
| Ga0099830_108094522 | 3300009088 | Vadose Zone Soil | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAEKVF |
| Ga0099828_115021181 | 3300009089 | Vadose Zone Soil | MTDRGIHVVREHLAKLPPSATLSIEQRRAQNDRAERVFATPDDVSREP |
| Ga0099827_117458801 | 3300009090 | Vadose Zone Soil | MADRGIDVVRAHLAKLPPSDSLTVAERRAQYERAEKAFPT |
| Ga0111539_114644542 | 3300009094 | Populus Rhizosphere | MDKGIDAVRAHLAKLPPSDSMTVAQRRTQYERAEKAFPTP |
| Ga0075418_110557251 | 3300009100 | Populus Rhizosphere | MTARGIDIVRAHLAKLPPSGSLTIPERRAQYDRAERVFPTPADVVVET |
| Ga0075418_114121272 | 3300009100 | Populus Rhizosphere | VRGHLARLPPANALTIEQRRAQYDRAERVFPTPADVKIEQV |
| Ga0114129_109151962 | 3300009147 | Populus Rhizosphere | VRGHLAKLPPANALTIEQRRAQYDRAERVFPTPADVKIEQVTA |
| Ga0111538_115054991 | 3300009156 | Populus Rhizosphere | MDKGIDAVRAHLAKLPPSDSMTVAQRRTQYERAEKAFPTPSDVKVEHVT |
| Ga0075423_121115512 | 3300009162 | Populus Rhizosphere | MSDKGIHLVREHLAKLPPSNTLTIAQRRAQYERAERVFP |
| Ga0075423_123623692 | 3300009162 | Populus Rhizosphere | VRGHLAKLPPASALTIEQRRAQYDRAERVFPTPADVRIE |
| Ga0105241_107720322 | 3300009174 | Corn Rhizosphere | MSDRGIQAVREHLAKLPPSNTLTIEQRRMQYERAERVFPTPA |
| Ga0105248_124653741 | 3300009177 | Switchgrass Rhizosphere | MADRGIEVVHAHLAKLPPADSLTVAERRAQYERAEKVFPVSPDVK |
| Ga0105082_11262851 | 3300009814 | Groundwater Sand | VTNRGIHAVREHLAKLPPSNTLTIEQRRAQYDRAERVFPTP |
| Ga0105074_10511081 | 3300010029 | Groundwater Sand | MADRGIQIVREHLAKLPPSSSLTTEQRRAQYDRAERVFP |
| Ga0126380_116135521 | 3300010043 | Tropical Forest Soil | MSDRGIQAVREHLAKLPPSNTLTIEQRRAQYERAER |
| Ga0127503_109254192 | 3300010154 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFATPADV |
| Ga0134070_100007971 | 3300010301 | Grasslands Soil | MSDKGIHLVREHLAKLPAPNTLTTAQRRAQYERAERVFPTP |
| Ga0134064_104997872 | 3300010325 | Grasslands Soil | VIDRGIGAVRAHLAKLPPSDSLTIAERRAQYERAERVFPVPVDV |
| Ga0126370_118268002 | 3300010358 | Tropical Forest Soil | MADRGIDVVRAHLAKLPPPESLTTAERRAQYERAEKV |
| Ga0126376_108305722 | 3300010359 | Tropical Forest Soil | MNDKGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKIETITAPA |
| Ga0126376_115185222 | 3300010359 | Tropical Forest Soil | MSDRGIQAVREHLAKLPPSNTLTIEQRRSQYERAERVLPTP |
| Ga0126372_108239712 | 3300010360 | Tropical Forest Soil | MAERGIDVVRAHLAKLPPPESLTIAERRAQYERAEKVFPTPPEVK |
| Ga0126378_109644072 | 3300010361 | Tropical Forest Soil | MADRGIEIVRAHLAKLPPTESMTIAEQRAQYERAERAFPIPP |
| Ga0126378_111467942 | 3300010361 | Tropical Forest Soil | MAERGIDVVRAHLAKLPPPESLTIAERRAQYERAEKVFPTPPEVKIERVT |
| Ga0126377_129496861 | 3300010362 | Tropical Forest Soil | MNDKGIHLVRDHLAKLPPSNTLTIEQRRAQYERAERV |
| Ga0134124_100216981 | 3300010397 | Terrestrial Soil | MTARGIRAVRDHLAKLPPSSSLTLVERRAQYDRAERVFATPADVAIEVV |
| Ga0124844_10918762 | 3300010868 | Tropical Forest Soil | MAERGIGVVRAHLAKLPPPESLTIAERRAQYERAEKVFPTPLEVKI |
| Ga0137393_104446311 | 3300011271 | Vadose Zone Soil | MNDHGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKVETIAAP |
| Ga0137389_110501252 | 3300012096 | Vadose Zone Soil | MADRGIDVVRAHLAKLPLSDSLTVAERRTQYERAEKA |
| Ga0137363_104516051 | 3300012202 | Vadose Zone Soil | MAERGIHIVREHLAKLPPSDSLTIAERRAQYERAEKVFPT |
| Ga0137362_106733131 | 3300012205 | Vadose Zone Soil | MNDHGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKVET |
| Ga0137362_114291031 | 3300012205 | Vadose Zone Soil | MSERGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKVET |
| Ga0137381_100519651 | 3300012207 | Vadose Zone Soil | MADRGIEVVRAHLAKLPPADSLTLAERRAQYERAEKVF |
| Ga0137381_114548822 | 3300012207 | Vadose Zone Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFPTPADVAI |
| Ga0137386_100421465 | 3300012351 | Vadose Zone Soil | MSDKGIHLVREHLAKLPAPNTLTTAQRRAQYERAERV |
| Ga0137386_104247082 | 3300012351 | Vadose Zone Soil | LAKLPPSSALTIEQRRAQYDRAERVFPTPADVAIEIVKAPQ |
| Ga0137361_116924182 | 3300012362 | Vadose Zone Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFPTPADVAIE |
| Ga0137397_102456373 | 3300012685 | Vadose Zone Soil | MADRGIDAVRAHLAKLPPSDSLTTAERRAQYERAEKVFPTPSDV |
| Ga0137394_102728751 | 3300012922 | Vadose Zone Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERV |
| Ga0137394_104178321 | 3300012922 | Vadose Zone Soil | MSDRGIQAVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPADVTIDRVTA |
| Ga0126369_128663851 | 3300012971 | Tropical Forest Soil | MNDKGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKIETLAA |
| Ga0126369_131493962 | 3300012971 | Tropical Forest Soil | MAERGIDVVRTHLAKLPPPESLTIAERRAQYERAEKVFPTPPEVKIER |
| Ga0134110_103748782 | 3300012975 | Grasslands Soil | MTQHGIEAVLAHLAKLPPPGSLTLAEQRAQYERAERAFQIP |
| Ga0163162_127087411 | 3300013306 | Switchgrass Rhizosphere | MAERGIHIVREHLAKLPPSDSLTIAERRAQYERAEKV |
| Ga0134081_101432753 | 3300014150 | Grasslands Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRGQYDRAER |
| Ga0075312_10698102 | 3300014254 | Natural And Restored Wetlands | MTTRGIDVVRAHLAKLPPSASLTIAERRAQYDRAERVFPTPAD |
| Ga0075314_11473772 | 3300014265 | Natural And Restored Wetlands | MRAMSDRGIHLVREHLAKLPPSSTLTIAQLRAQYDRA |
| Ga0075331_11420611 | 3300014310 | Natural And Restored Wetlands | MTTRGIDVVRAHLAKLPPSASLTIAERRAQYERAERVFPTPADVAVEVVA |
| Ga0157380_106802901 | 3300014326 | Switchgrass Rhizosphere | MSDRGIQAVREHLAKLPPSNTLTIEQRRKQYERAERVFPTPADVTIDRV |
| Ga0157380_108813852 | 3300014326 | Switchgrass Rhizosphere | MTARGIKVVREHLAKHPAPADVAARREQYDRAERVFKTP |
| Ga0137420_14546362 | 3300015054 | Vadose Zone Soil | MNDQGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTRRT* |
| Ga0137418_109747871 | 3300015241 | Vadose Zone Soil | MSARGIQAVREHLAKLPPASSLTTEQRRAQYDRAER |
| Ga0137403_115990392 | 3300015264 | Vadose Zone Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFPTP |
| Ga0132256_1011061951 | 3300015372 | Arabidopsis Rhizosphere | MADRGIDVVRAHLAKLPPSETLTTAERRAQYERAEKAFP |
| Ga0132257_1011734712 | 3300015373 | Arabidopsis Rhizosphere | MADRGIDVVRAHLAKLPPSETLTTAERRAQYERAEKAF |
| Ga0132257_1031759692 | 3300015373 | Arabidopsis Rhizosphere | MTARGIRAVRDHLAKLPPSSSLTLSERRAQYDRAERVFPT |
| Ga0132255_1007024671 | 3300015374 | Arabidopsis Rhizosphere | MSDRGIQAVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPADV |
| Ga0182032_115266681 | 3300016357 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFQTP |
| Ga0182038_107600792 | 3300016445 | Soil | MADRGIDVVRAHLAKLPPSESLTTAERRAQYERAEKVFPTPAEVKVERVT |
| Ga0184610_10661603 | 3300017997 | Groundwater Sediment | VTERGIHVVREHLAKLPPASSLSTEQRRAQYDRAERVF |
| Ga0184623_101415713 | 3300018056 | Groundwater Sediment | VTERGIHVVREHLAKLPPASSLSTEQRRAQYDRAERVFP |
| Ga0187774_110293631 | 3300018089 | Tropical Peatland | MADRGIDLVRAHLAKLPSSETMTTAERRAQYERAEKVFPTPPE |
| Ga0190265_115125081 | 3300018422 | Soil | VSGGGIALVRAHLAKLPPVTTVAERRAQYDRAERVFPMPADVS |
| Ga0190265_129476142 | 3300018422 | Soil | VITRGIAVVRAHLAKLPPSDTLTLAERRRQYERAERVFPIAADVKV |
| Ga0190272_106346661 | 3300018429 | Soil | MADRGIDVVRAHLAKLPPSDSLTIAERRAQYERAEKVFPTPPDVKVERVNV |
| Ga0066667_104944291 | 3300018433 | Grasslands Soil | MTQHGIEAVLAHLAKLPPPGSLTLAEQRAQYERAERAFPIPPEVAVR |
| Ga0066662_107519582 | 3300018468 | Grasslands Soil | MSERGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKVETI |
| Ga0184646_12315361 | 3300019259 | Groundwater Sediment | MADRGIDVVRAHLAKLPPSDSLTTAEHRAQYERAEKVFPTPPDVKVER |
| Ga0193755_11921782 | 3300020004 | Soil | MSDRGIQAVREHLAKLPPSNTLTIEQRRSQYERAER |
| Ga0210404_101358143 | 3300021088 | Soil | MADRGIEAVRAHLAKLPPSDSLTVAERRAQYERAEKVFPTPAEVKV |
| Ga0210377_100407464 | 3300021090 | Groundwater Sediment | MPPHGIAAVRAHLAKLPPTETIAERRAMYDRAERVF |
| Ga0193719_100411491 | 3300021344 | Soil | VSEGGGIAAVRAHLAKIPPANTVAERRAQYDRAERVFPMPADVSVKPV |
| Ga0193719_103040671 | 3300021344 | Soil | MSGGGIAAVRAHLAKIPPANTVAERRAQYDRAERVFPMPADVSVKPV |
| Ga0193719_103744401 | 3300021344 | Soil | MADRGIEVVRAHLAKLPPPDSLTIAERRAQYERAEKV |
| Ga0137417_12464102 | 3300024330 | Vadose Zone Soil | MSDQGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPT |
| Ga0209431_106064421 | 3300025313 | Soil | MTARGIDVVRAHLAKLPPSASLTIAERRAQYDRAERV |
| Ga0210143_10231151 | 3300025792 | Natural And Restored Wetlands | MRAMSDRGIHLVREHLAKLPPSSTLTIAQLRAQYDRAERAFPTPPDVTVEVVAA |
| Ga0207642_103628983 | 3300025899 | Miscanthus Rhizosphere | MSQRGIDVVRAHLAKLPRTDSMTVAERRAQYDRAERVFVTPADVAVERV |
| Ga0207684_107187801 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAERGIHIVRAHLAKLPPSESLTIAERRAQYERAEKAFPTPAEVK |
| Ga0207660_100059828 | 3300025917 | Corn Rhizosphere | MADRGIEAVRAHLAKLPLSDTLTVAERRLQYERAE |
| Ga0207652_113436451 | 3300025921 | Corn Rhizosphere | MSGIAVVRAHLAKIPPANTVAERRAQYDRAERVFPMPADV |
| Ga0207701_106413321 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VTTRGIQVVRGHLAKLPPANALTIEQRRAQYDRAERVFPTPA |
| Ga0210116_11017391 | 3300025959 | Natural And Restored Wetlands | MIARGIEVVRAHLAKLPPSASLSIAERRAQYDRAERVFPTPDDVARRGEHA |
| Ga0208002_10227461 | 3300026029 | Natural And Restored Wetlands | MRAMSDKGIHLVRAHLAKLPPSSTLTIAQLRAQYDRAERAFPAPP |
| Ga0208419_10052331 | 3300026032 | Natural And Restored Wetlands | MRAMSDKGIHLVRAHLAKLPPSSTLTIAQLRAQYDRAERAFPTPPD |
| Ga0209152_101465392 | 3300026325 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFSTPADVAVEV |
| Ga0209267_12205912 | 3300026331 | Soil | MSDKGIHLVREHLAKLPAPNTLTTAQRRAQYERAERVFPTPPDVKVET |
| Ga0209377_11820441 | 3300026334 | Soil | VTERGIRVVREHLAKLPPSSTLTIEQRRAQYDRAERVFPTPADVAIET |
| Ga0257171_10175531 | 3300026377 | Soil | MADRGIDVVRAHLAKLPPSDSLTVAERRAQYERAEKAFPTPAEVKVERVS |
| Ga0257177_10447091 | 3300026480 | Soil | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAEKVFPTPPDVKVER |
| Ga0257181_10579231 | 3300026499 | Soil | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAEKVFPTPPD |
| Ga0209161_101996342 | 3300026548 | Soil | VIDRGIGAVRAHLAKLPPSDSLTIAERRAQYERAERVFPVPLDVKVE |
| Ga0209981_10829421 | 3300027378 | Arabidopsis Thaliana Rhizosphere | MADRGIDVVRAHLAKLPPSETLTTAERRTQYERAEK |
| Ga0207446_1016531 | 3300027448 | Soil | MTARGIDVVRAHLAKLPPSASLSIAERRAQYDRAE |
| Ga0210000_10485791 | 3300027462 | Arabidopsis Thaliana Rhizosphere | MADRGIDVVRAHLAKLPPSETLTTAERRTQYERAEKVFPTP |
| Ga0209995_10078023 | 3300027471 | Arabidopsis Thaliana Rhizosphere | MADRGIDVVRAHLAKLPPSETLTTAERRTQYERAEKVFPTPAEVK |
| Ga0209684_10116001 | 3300027527 | Tropical Forest Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFATPSD |
| Ga0209799_10583983 | 3300027654 | Tropical Forest Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFPTPS |
| Ga0209799_10799651 | 3300027654 | Tropical Forest Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVF |
| Ga0209388_11303271 | 3300027655 | Vadose Zone Soil | MADRGIDVVRAHLAKLPPSDSLTVAERRAQYERAEKAFPTPAEVKVERV |
| Ga0256865_11649501 | 3300027657 | Soil | MADRGIAVVRAHLAKLPPSASLTIAERRAQYDRAERVFPT |
| Ga0209814_100685571 | 3300027873 | Populus Rhizosphere | MTDRGIDVVRSHLATLPPSASMTIPERRAQYERAERVFP |
| Ga0209465_100347791 | 3300027874 | Tropical Forest Soil | MAERGIDVVRTHLAKLPPPESLTIAERRAQYERAE |
| Ga0209481_104562291 | 3300027880 | Populus Rhizosphere | MTARGIKVVREHLAKHPAPADVAEKRAQYDRAERVFKTPADVR |
| Ga0209590_103718392 | 3300027882 | Vadose Zone Soil | VIDRGIGAVRAHLAKLPPSDSLTIAERRAQYERAERVFPIPLDVK |
| Ga0247819_101370443 | 3300028608 | Soil | MSDRGIQVVREHLAKLPPSNTLTIEQRRSQYERAERVFPTPADV |
| (restricted) Ga0255312_10282261 | 3300031248 | Sandy Soil | MAEHGIDVVRAHLAKLPPSDSLTVAERRAQYERAEK |
| Ga0307408_1005942631 | 3300031548 | Rhizosphere | MNDRGIHVVRAHLAKLPPPTSLTIAERRAQYDKAERVFRTPPDVKVERVE |
| Ga0318573_100147086 | 3300031564 | Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFATPSDVSVEIAQTPD |
| Ga0318573_100173391 | 3300031564 | Soil | MADRGIDVVRAHLAKLPPSESLTTAERRAQYERAEKVFPTRAE |
| Ga0318555_100183605 | 3300031640 | Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFATPSDVSVEI |
| Ga0318555_104476363 | 3300031640 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFQTPADVVIEVVK |
| Ga0307469_105683762 | 3300031720 | Hardwood Forest Soil | MADRGIDVVRAHLAKLPPSDSLTVAERRAQYERAEKAFP |
| Ga0307469_119489992 | 3300031720 | Hardwood Forest Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFPTPADVA |
| Ga0307468_1004635131 | 3300031740 | Hardwood Forest Soil | MSDRGIQVVREPLAKLPPSYTLTIEQRRSQYERAERV |
| Ga0318526_104321533 | 3300031769 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFQTPADVVIE |
| Ga0318497_102512641 | 3300031805 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFQTPADVAI |
| Ga0307473_101235393 | 3300031820 | Hardwood Forest Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFPTPADVTVETVQ |
| Ga0318551_104046801 | 3300031896 | Soil | MTARGIRAVRDHLAKLPPSSSLTLAERRAQYDRAERVFQTPADVAIEAVK |
| Ga0310902_109938341 | 3300032012 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTPP |
| Ga0310890_107069771 | 3300032075 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAEHVF |
| Ga0318518_100553031 | 3300032090 | Soil | MTARGIRAVREHLAKLPPSSSLTLAERRAQYDRAERVFATPSDVS |
| Ga0307470_102296292 | 3300032174 | Hardwood Forest Soil | VATRGIQAVRGHLAKLPPANALTIEQRRAQYDRAERVFP |
| Ga0307470_111573672 | 3300032174 | Hardwood Forest Soil | MAERGIHIVRAHLAKLPPSESLTIAERRAQYERAE |
| Ga0307470_112909293 | 3300032174 | Hardwood Forest Soil | MAERGIHIVREHLAKLPPSDSLTIAERRAQYERAEKVFPTPAE |
| Ga0310889_100361293 | 3300032179 | Soil | MTARGIDVVRAHLAKLPPSASLSIAERRAQYDRAERVFPTPADVKVETVT |
| Ga0307471_1000785481 | 3300032180 | Hardwood Forest Soil | MADRGIDVVRAHLAKLPPSDSLTTAERRAQYERAEKVFPTPAEVKVERVN |
| Ga0307471_1011414122 | 3300032180 | Hardwood Forest Soil | VTTRGIQAVRGHLAKLPPASALTIEQRRAQYDRAERVFPTPADVRIELVAAPD |
| Ga0307471_1026621641 | 3300032180 | Hardwood Forest Soil | MRAMSDKGIQLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKVETIAA |
| Ga0310896_100878643 | 3300032211 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTPSDVAVELVK |
| Ga0310812_101490203 | 3300032421 | Soil | MSDKGIHLVREHLAKLPPSNTLTIEQRRAQYERAERVFPTPPDVKIETIAA |
| Ga0247829_112491441 | 3300033550 | Soil | MTERGIEAVRQHLAKLPPSSSLTVAQRRAQYERAERVFPT |
| Ga0247830_101410323 | 3300033551 | Soil | MADRGIDAVRAHLAKLPPSDSLTTAERRAQYERAETVFPTPPEVKV |
| Ga0247830_105385211 | 3300033551 | Soil | MTDKGIHFVRAHLARLPPSNTLTLAERRAHEVNALV |
| Ga0364938_091732_468_578 | 3300034114 | Sediment | MTDRGIDVVRAHLAKLPPSASMTIAERRAQYDRAERV |
| Ga0314787_097753_1_156 | 3300034665 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTPPDVAVELVKAP |
| Ga0314792_134613_500_646 | 3300034667 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTPPDVAVELV |
| Ga0314798_106183_3_143 | 3300034673 | Soil | MTARGIRAVREHLAKLPPSSSLTLEQRRSQYDRAERVFTTPSDVAVE |
| ⦗Top⦘ |