


| Basic Information | |
|---|---|
| Family ID | F032441 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEQEEE |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 9.44 % |
| % of genes near scaffold ends (potentially truncated) | 18.33 % |
| % of genes from short scaffolds (< 2000 bps) | 80.56 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (33.333 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (42.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.75% β-sheet: 0.00% Coil/Unstructured: 42.25% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF11697 | DUF3293 | 10.00 |
| PF00551 | Formyl_trans_N | 2.78 |
| PF01106 | NifU | 2.22 |
| PF07728 | AAA_5 | 2.22 |
| PF00127 | Copper-bind | 1.11 |
| PF03237 | Terminase_6N | 1.11 |
| PF13640 | 2OG-FeII_Oxy_3 | 1.11 |
| PF11211 | DUF2997 | 1.11 |
| PF11053 | DNA_Packaging | 1.11 |
| PF04984 | Phage_sheath_1 | 0.56 |
| PF00504 | Chloroa_b-bind | 0.56 |
| PF01979 | Amidohydro_1 | 0.56 |
| PF00586 | AIRS | 0.56 |
| PF05050 | Methyltransf_21 | 0.56 |
| PF11649 | T4_neck-protein | 0.56 |
| PF02700 | PurS | 0.56 |
| PF08406 | CbbQ_C | 0.56 |
| PF05996 | Fe_bilin_red | 0.56 |
| PF01259 | SAICAR_synt | 0.56 |
| PF11753 | DUF3310 | 0.56 |
| PF02769 | AIRS_C | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 2.22 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.56 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 0.56 |
| COG1828 | Phosphoribosylformylglycinamidine (FGAM) synthase, PurS subunit | Nucleotide transport and metabolism [F] | 0.56 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.56 % |
| Unclassified | root | N/A | 29.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001946|GOS2244_1021365 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300001955|GOS2237_1021013 | All Organisms → Viruses → Predicted Viral | 1728 | Open in IMG/M |
| 3300001972|GOS2216_10053785 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
| 3300002231|KVRMV2_100813912 | Not Available | 840 | Open in IMG/M |
| 3300002488|JGI25128J35275_1025547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 1415 | Open in IMG/M |
| 3300002488|JGI25128J35275_1042956 | All Organisms → cellular organisms → Eukaryota | 1004 | Open in IMG/M |
| 3300004831|Ga0069134_164045 | Not Available | 743 | Open in IMG/M |
| 3300005404|Ga0066856_10080516 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300005404|Ga0066856_10091854 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
| 3300005521|Ga0066862_10080479 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1122 | Open in IMG/M |
| 3300005522|Ga0066861_10203554 | Not Available | 678 | Open in IMG/M |
| 3300005523|Ga0066865_10367731 | Not Available | 546 | Open in IMG/M |
| 3300006024|Ga0066371_10009720 | All Organisms → Viruses → Predicted Viral | 2526 | Open in IMG/M |
| 3300006024|Ga0066371_10014006 | All Organisms → Viruses → Predicted Viral | 2142 | Open in IMG/M |
| 3300006024|Ga0066371_10040204 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
| 3300006024|Ga0066371_10132732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 759 | Open in IMG/M |
| 3300006024|Ga0066371_10143340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 731 | Open in IMG/M |
| 3300006024|Ga0066371_10206780 | All Organisms → Viruses | 610 | Open in IMG/M |
| 3300006166|Ga0066836_10132511 | All Organisms → Viruses → Predicted Viral | 1460 | Open in IMG/M |
| 3300006166|Ga0066836_10306222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 952 | Open in IMG/M |
| 3300006332|Ga0068500_1101532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 17618 | Open in IMG/M |
| 3300006332|Ga0068500_1131579 | Not Available | 1543 | Open in IMG/M |
| 3300006332|Ga0068500_1155037 | All Organisms → Viruses → Predicted Viral | 2621 | Open in IMG/M |
| 3300006332|Ga0068500_1742105 | Not Available | 952 | Open in IMG/M |
| 3300006412|Ga0099955_1075081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 981 | Open in IMG/M |
| 3300006412|Ga0099955_1237475 | Not Available | 638 | Open in IMG/M |
| 3300006478|Ga0100224_1023125 | All Organisms → Viruses → Predicted Viral | 1486 | Open in IMG/M |
| 3300006478|Ga0100224_1157202 | Not Available | 615 | Open in IMG/M |
| 3300006565|Ga0100228_1027077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 5505 | Open in IMG/M |
| 3300006565|Ga0100228_1027482 | All Organisms → Viruses → Predicted Viral | 4129 | Open in IMG/M |
| 3300006565|Ga0100228_1041510 | All Organisms → Viruses → Predicted Viral | 3169 | Open in IMG/M |
| 3300006565|Ga0100228_1064663 | All Organisms → Viruses → Predicted Viral | 1026 | Open in IMG/M |
| 3300006565|Ga0100228_1381523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 585 | Open in IMG/M |
| 3300006565|Ga0100228_1388621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-SSM7 | 627 | Open in IMG/M |
| 3300006735|Ga0098038_1008453 | All Organisms → Viruses → Predicted Viral | 4096 | Open in IMG/M |
| 3300006735|Ga0098038_1110111 | Not Available | 943 | Open in IMG/M |
| 3300006735|Ga0098038_1116973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 909 | Open in IMG/M |
| 3300006752|Ga0098048_1141437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 719 | Open in IMG/M |
| 3300006793|Ga0098055_1205642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 747 | Open in IMG/M |
| 3300006928|Ga0098041_1008265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 3497 | Open in IMG/M |
| 3300006928|Ga0098041_1079180 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300008097|Ga0111541_10006991 | All Organisms → Viruses → Predicted Viral | 4008 | Open in IMG/M |
| 3300008097|Ga0111541_10104962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1144 | Open in IMG/M |
| 3300008097|Ga0111541_10201856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 834 | Open in IMG/M |
| 3300008097|Ga0111541_10354724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 633 | Open in IMG/M |
| 3300008097|Ga0111541_10445221 | All Organisms → Viruses | 566 | Open in IMG/M |
| 3300009481|Ga0114932_10836429 | Not Available | 533 | Open in IMG/M |
| 3300009593|Ga0115011_10043542 | All Organisms → Viruses → Predicted Viral | 3053 | Open in IMG/M |
| 3300009593|Ga0115011_10260659 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300009593|Ga0115011_10362848 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1118 | Open in IMG/M |
| 3300009593|Ga0115011_10388572 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300009593|Ga0115011_10400482 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300009593|Ga0115011_10504601 | Not Available | 961 | Open in IMG/M |
| 3300009593|Ga0115011_11058198 | Not Available | 690 | Open in IMG/M |
| 3300009593|Ga0115011_11317764 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 629 | Open in IMG/M |
| 3300009593|Ga0115011_12157706 | Not Available | 512 | Open in IMG/M |
| 3300009679|Ga0115105_10281945 | Not Available | 661 | Open in IMG/M |
| 3300009790|Ga0115012_10016793 | All Organisms → Viruses → Predicted Viral | 4544 | Open in IMG/M |
| 3300009790|Ga0115012_10099927 | All Organisms → Viruses → Predicted Viral | 2028 | Open in IMG/M |
| 3300009790|Ga0115012_10984557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 696 | Open in IMG/M |
| 3300009790|Ga0115012_11209448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 635 | Open in IMG/M |
| 3300009790|Ga0115012_11613218 | Not Available | 562 | Open in IMG/M |
| 3300009790|Ga0115012_11684345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 552 | Open in IMG/M |
| 3300009790|Ga0115012_11934128 | Not Available | 521 | Open in IMG/M |
| 3300009794|Ga0105189_1011957 | Not Available | 801 | Open in IMG/M |
| 3300010934|Ga0137844_1207330 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
| 3300011013|Ga0114934_10368117 | Not Available | 642 | Open in IMG/M |
| 3300012952|Ga0163180_11901920 | Not Available | 506 | Open in IMG/M |
| 3300012953|Ga0163179_10094510 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300012953|Ga0163179_10313588 | All Organisms → Viruses | 1245 | Open in IMG/M |
| 3300012953|Ga0163179_10458448 | Not Available | 1046 | Open in IMG/M |
| 3300012953|Ga0163179_10741026 | Not Available | 837 | Open in IMG/M |
| 3300012953|Ga0163179_11972649 | Not Available | 537 | Open in IMG/M |
| 3300012954|Ga0163111_10330812 | All Organisms → Viruses → Predicted Viral | 1362 | Open in IMG/M |
| 3300017726|Ga0181381_1086723 | Not Available | 667 | Open in IMG/M |
| 3300017760|Ga0181408_1019348 | All Organisms → Viruses → Predicted Viral | 1886 | Open in IMG/M |
| 3300017764|Ga0181385_1016406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 2370 | Open in IMG/M |
| 3300017767|Ga0181406_1058748 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
| 3300020247|Ga0211654_1001379 | All Organisms → Viruses → Predicted Viral | 4430 | Open in IMG/M |
| 3300020255|Ga0211586_1003411 | All Organisms → Viruses → Predicted Viral | 3799 | Open in IMG/M |
| 3300020255|Ga0211586_1015108 | All Organisms → Viruses → Predicted Viral | 1493 | Open in IMG/M |
| 3300020279|Ga0211634_1113308 | Not Available | 587 | Open in IMG/M |
| 3300020310|Ga0211515_1053424 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 754 | Open in IMG/M |
| 3300020311|Ga0211628_1067429 | Not Available | 577 | Open in IMG/M |
| 3300020312|Ga0211542_1031729 | Not Available | 1041 | Open in IMG/M |
| 3300020312|Ga0211542_1043716 | Not Available | 843 | Open in IMG/M |
| 3300020312|Ga0211542_1061122 | Not Available | 682 | Open in IMG/M |
| 3300020345|Ga0211706_1018350 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
| 3300020345|Ga0211706_1018788 | All Organisms → Viruses → Predicted Viral | 1572 | Open in IMG/M |
| 3300020345|Ga0211706_1049786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 | 879 | Open in IMG/M |
| 3300020345|Ga0211706_1081853 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 657 | Open in IMG/M |
| 3300020345|Ga0211706_1083677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 649 | Open in IMG/M |
| 3300020345|Ga0211706_1106132 | All Organisms → Viruses | 564 | Open in IMG/M |
| 3300020345|Ga0211706_1126381 | Not Available | 506 | Open in IMG/M |
| 3300020348|Ga0211600_1014952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 → Prochlorococcus phage P-SSM2 | 2261 | Open in IMG/M |
| 3300020355|Ga0211598_1147354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 526 | Open in IMG/M |
| 3300020370|Ga0211672_10065186 | All Organisms → Viruses → Predicted Viral | 1086 | Open in IMG/M |
| 3300020377|Ga0211647_10109887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Haifavirus → Haifavirus tim68 | 940 | Open in IMG/M |
| 3300020395|Ga0211705_10040649 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
| 3300020395|Ga0211705_10052456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1470 | Open in IMG/M |
| 3300020395|Ga0211705_10156494 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 834 | Open in IMG/M |
| 3300020395|Ga0211705_10273711 | Not Available | 624 | Open in IMG/M |
| 3300020404|Ga0211659_10033704 | All Organisms → Viruses → Predicted Viral | 2469 | Open in IMG/M |
| 3300020411|Ga0211587_10036803 | All Organisms → Viruses → Predicted Viral | 2302 | Open in IMG/M |
| 3300020411|Ga0211587_10071696 | All Organisms → Viruses → Predicted Viral | 1540 | Open in IMG/M |
| 3300020411|Ga0211587_10080261 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
| 3300020411|Ga0211587_10102672 | All Organisms → Viruses → Predicted Viral | 1241 | Open in IMG/M |
| 3300020411|Ga0211587_10243356 | All Organisms → Viruses | 746 | Open in IMG/M |
| 3300020411|Ga0211587_10310412 | Not Available | 647 | Open in IMG/M |
| 3300020411|Ga0211587_10352312 | Not Available | 600 | Open in IMG/M |
| 3300020411|Ga0211587_10475824 | Not Available | 501 | Open in IMG/M |
| 3300020416|Ga0211644_10006168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | 5184 | Open in IMG/M |
| 3300020416|Ga0211644_10022939 | All Organisms → Viruses → Predicted Viral | 2540 | Open in IMG/M |
| 3300020421|Ga0211653_10062623 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 1673 | Open in IMG/M |
| 3300020421|Ga0211653_10123176 | Not Available | 1149 | Open in IMG/M |
| 3300020421|Ga0211653_10374220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 614 | Open in IMG/M |
| 3300020428|Ga0211521_10161192 | Not Available | 1043 | Open in IMG/M |
| 3300020436|Ga0211708_10263838 | Not Available | 697 | Open in IMG/M |
| 3300020436|Ga0211708_10280491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 676 | Open in IMG/M |
| 3300020438|Ga0211576_10571165 | Not Available | 566 | Open in IMG/M |
| 3300020445|Ga0211564_10000009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 95515 | Open in IMG/M |
| 3300020445|Ga0211564_10030151 | All Organisms → Viruses → Predicted Viral | 2715 | Open in IMG/M |
| 3300020445|Ga0211564_10095222 | All Organisms → Viruses → Predicted Viral | 1483 | Open in IMG/M |
| 3300020445|Ga0211564_10170629 | All Organisms → Viruses → Predicted Viral | 1081 | Open in IMG/M |
| 3300020445|Ga0211564_10211403 | Not Available | 961 | Open in IMG/M |
| 3300020445|Ga0211564_10236803 | Not Available | 902 | Open in IMG/M |
| 3300020455|Ga0211664_10175238 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300020457|Ga0211643_10054123 | All Organisms → Viruses → Predicted Viral | 1999 | Open in IMG/M |
| 3300020457|Ga0211643_10194788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 997 | Open in IMG/M |
| 3300020457|Ga0211643_10319473 | All Organisms → Viruses | 763 | Open in IMG/M |
| 3300020457|Ga0211643_10633712 | All Organisms → Viruses | 523 | Open in IMG/M |
| 3300020459|Ga0211514_10659156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 510 | Open in IMG/M |
| 3300020465|Ga0211640_10436575 | All Organisms → Viruses | 717 | Open in IMG/M |
| 3300020467|Ga0211713_10370527 | All Organisms → Viruses | 693 | Open in IMG/M |
| 3300020470|Ga0211543_10017285 | All Organisms → Viruses → Predicted Viral | 4101 | Open in IMG/M |
| 3300020470|Ga0211543_10039278 | All Organisms → Viruses → Predicted Viral | 2539 | Open in IMG/M |
| 3300020470|Ga0211543_10130716 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
| 3300020470|Ga0211543_10243489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 882 | Open in IMG/M |
| 3300020470|Ga0211543_10381425 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 678 | Open in IMG/M |
| 3300020470|Ga0211543_10389470 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 670 | Open in IMG/M |
| 3300020471|Ga0211614_10329284 | Not Available | 671 | Open in IMG/M |
| 3300020472|Ga0211579_10005398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 9099 | Open in IMG/M |
| 3300020472|Ga0211579_10120088 | All Organisms → Viruses → Predicted Viral | 1563 | Open in IMG/M |
| 3300020472|Ga0211579_10272532 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 970 | Open in IMG/M |
| 3300020472|Ga0211579_10632656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 599 | Open in IMG/M |
| 3300020472|Ga0211579_10828746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Thermus → Thermus thermophilus | 510 | Open in IMG/M |
| 3300020473|Ga0211625_10056090 | All Organisms → Viruses → Predicted Viral | 2395 | Open in IMG/M |
| 3300020473|Ga0211625_10057707 | All Organisms → Viruses → Predicted Viral | 2353 | Open in IMG/M |
| 3300020473|Ga0211625_10430736 | Not Available | 659 | Open in IMG/M |
| 3300020477|Ga0211585_10238534 | All Organisms → Viruses → Predicted Viral | 1123 | Open in IMG/M |
| 3300020478|Ga0211503_10429302 | Not Available | 705 | Open in IMG/M |
| 3300025086|Ga0208157_1125209 | Not Available | 592 | Open in IMG/M |
| 3300025102|Ga0208666_1140944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 548 | Open in IMG/M |
| 3300025110|Ga0208158_1000040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 87598 | Open in IMG/M |
| 3300025110|Ga0208158_1144946 | Not Available | 541 | Open in IMG/M |
| 3300025132|Ga0209232_1042329 | All Organisms → Viruses → Predicted Viral | 1697 | Open in IMG/M |
| 3300025132|Ga0209232_1114278 | Not Available | 897 | Open in IMG/M |
| 3300025132|Ga0209232_1142826 | All Organisms → Viruses | 771 | Open in IMG/M |
| 3300025132|Ga0209232_1245982 | Not Available | 519 | Open in IMG/M |
| 3300026076|Ga0208261_1038169 | All Organisms → Viruses → Predicted Viral | 1360 | Open in IMG/M |
| 3300026076|Ga0208261_1067983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 → Prochlorococcus phage P-SSM2 | 960 | Open in IMG/M |
| 3300026077|Ga0208749_1006919 | All Organisms → Viruses → Predicted Viral | 2390 | Open in IMG/M |
| 3300026134|Ga0208815_1027393 | Not Available | 739 | Open in IMG/M |
| 3300026263|Ga0207992_1121866 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 672 | Open in IMG/M |
| 3300026266|Ga0208410_1113759 | Not Available | 661 | Open in IMG/M |
| 3300026292|Ga0208277_1135075 | Not Available | 847 | Open in IMG/M |
| 3300026292|Ga0208277_1174547 | Not Available | 703 | Open in IMG/M |
| 3300026292|Ga0208277_1270679 | Not Available | 504 | Open in IMG/M |
| 3300027906|Ga0209404_10008239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Salacisavirus → Prochlorococcus virus PSSM2 → Prochlorococcus phage P-SSM2 | 5788 | Open in IMG/M |
| 3300027906|Ga0209404_10022116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 3500 | Open in IMG/M |
| 3300027906|Ga0209404_10060775 | All Organisms → Viruses → Predicted Viral | 2159 | Open in IMG/M |
| 3300027906|Ga0209404_10073452 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300027906|Ga0209404_10215911 | All Organisms → Viruses → Predicted Viral | 1196 | Open in IMG/M |
| 3300029319|Ga0183748_1082155 | Not Available | 791 | Open in IMG/M |
| 3300029787|Ga0183757_1028021 | All Organisms → Viruses | 1221 | Open in IMG/M |
| 3300031773|Ga0315332_10148673 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| 3300032006|Ga0310344_11380339 | All Organisms → Viruses → environmental samples → uncultured Mediterranean phage | 579 | Open in IMG/M |
| 3300032011|Ga0315316_11111633 | Not Available | 639 | Open in IMG/M |
| 3300032011|Ga0315316_11127935 | All Organisms → Viruses | 633 | Open in IMG/M |
| 3300032820|Ga0310342_100013541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 5981 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 42.22% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 36.11% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 7.78% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.33% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.22% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.67% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.11% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.11% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.11% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.11% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.56% |
| Surface Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater | 0.56% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.56% |
| Subsea Pool Microbial Mat | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001946 | Marine microbial communities from North James Bay, Santigo Island, Equador | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004831 | Marine surface microbial communities from the North Atlantic Ocean - filtered matter | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005521 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006412 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0125m | Environmental | Open in IMG/M |
| 3300006478 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010934 | Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3 | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300020247 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556048-ERR598962) | Environmental | Open in IMG/M |
| 3300020255 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013) | Environmental | Open in IMG/M |
| 3300020279 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017) | Environmental | Open in IMG/M |
| 3300020310 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX556067-ERR598950) | Environmental | Open in IMG/M |
| 3300020311 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171) | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020345 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX556079-ERR599137) | Environmental | Open in IMG/M |
| 3300020348 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161) | Environmental | Open in IMG/M |
| 3300020355 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556077-ERR598988) | Environmental | Open in IMG/M |
| 3300020370 | Marine microbial communities from Tara Oceans - TARA_B100001029 (ERX556065-ERR599079) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020445 | Marine microbial communities from Tara Oceans - TARA_B100001996 (ERX555961-ERR599087) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025110 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026134 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 (SPAdes) | Environmental | Open in IMG/M |
| 3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
| 3300026266 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2244_10213652 | 3300001946 | Marine | MSVIIYQDHIEILEEENAELQREVLTLRRKIKYYQQILEEEE* |
| GOS2237_10210135 | 3300001955 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEKEE* |
| GOS2216_100537853 | 3300001972 | Marine | IIYQDHIEVLEEENAELLKEVKILRRRLAYYKAIVEQEEE* |
| KVRMV2_1008139121 | 3300002231 | Marine Sediment | DHIEILEEENAQLQKEVMFLRRRLDYYKTIVEVDEEGK* |
| JGI25128J35275_10255471 | 3300002488 | Marine | MSVIIYQDHIEILEEEKAELQKEVLFLRRKVAYYQTILEEEEGNEWRL* |
| JGI25128J35275_10429563 | 3300002488 | Marine | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTVLEEEKGDEWRL* |
| Ga0069134_1640451 | 3300004831 | Surface Seawater | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEEAEN* |
| Ga0066856_100805163 | 3300005404 | Marine | MSVIIYQDHIEVLEEENAELQKEVHALRRRIKYYQTIIQEDE* |
| Ga0066856_100918545 | 3300005404 | Marine | MSVIIYQDHIEILEEENAELQKEVLSLRRKVAYYQTILEEEEGNEWRL* |
| Ga0066862_100804791 | 3300005521 | Marine | NNFMSVIIYQEHIEILEEENAELQQEVVMLKQRLKYYQEFTEEEKNTK* |
| Ga0066861_102035542 | 3300005522 | Marine | MSVIIYQDHIEILEEENAELLKEVKVLRRKLAYYKTVIEEKEE* |
| Ga0066865_103677312 | 3300005523 | Marine | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTILEEEEGNEWRL* |
| Ga0066371_100097203 | 3300006024 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVDEKE* |
| Ga0066371_100140063 | 3300006024 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKLKYYQQVLEED* |
| Ga0066371_100402041 | 3300006024 | Marine | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTILEE |
| Ga0066371_101327323 | 3300006024 | Marine | HMSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEKEEE* |
| Ga0066371_101433401 | 3300006024 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEREEE* |
| Ga0066371_102067803 | 3300006024 | Marine | MSVIIYQDHIEILEEENAQLLQEVMMLRRKLKYYQTIVEGKEL* |
| Ga0066836_101325113 | 3300006166 | Marine | MSIIIYQDHIEILEEEKAELQKEVLSLRRKVSYYQTILEEDEDNEWGL* |
| Ga0066836_103062222 | 3300006166 | Marine | MSVIIYQEHIEILEEENAELQQEVVMLKQRLKYYQEFTEEEKNTK* |
| Ga0068500_11015329 | 3300006332 | Marine | MSVIIYQDHIEVLEEENAELLKEVKFLRRELAYYKTIVEDEEE* |
| Ga0068500_11315792 | 3300006332 | Marine | MSVIIYQDHIEILEEENEQLLQEVTMLRRKLKYYQTIVEEGEE* |
| Ga0068500_11550372 | 3300006332 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEEEE* |
| Ga0068500_17421053 | 3300006332 | Marine | IEVLEEENAELQKEVLILRSKLEYYKTIVEQEEE* |
| Ga0099955_10750812 | 3300006412 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRSKLEYYKTIVEQEEE* |
| Ga0099955_12374752 | 3300006412 | Marine | CLNNFMSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEQEEE* |
| Ga0100224_10231253 | 3300006478 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEQEEE* |
| Ga0100224_11572021 | 3300006478 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVMEEEE* |
| Ga0100228_10270774 | 3300006565 | Marine | MSVIIYQDHIEILEEEKAELQKEVLFLRRKVAYYQTVLEEEDV* |
| Ga0100228_10274822 | 3300006565 | Marine | MSVIIYQEHIEVLEEENAELQQEVLVLRRRLNYYKSLIEEDEIDK* |
| Ga0100228_10415104 | 3300006565 | Marine | MSVIIYQEEIELLEEEKAELQQEVLILRRRLKYYQSSLEEEENTK* |
| Ga0100228_10646633 | 3300006565 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKTVMEEEE* |
| Ga0100228_13815233 | 3300006565 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRRRLAYYKTIVEQEEE* |
| Ga0100228_13886211 | 3300006565 | Marine | MSIIIYQDHIEILEEEKAELQKEVLFLRRKIKYYQQVLEEEE* |
| Ga0098038_10084535 | 3300006735 | Marine | MSVIIYQDHIQILEEENAELQKEVMLLRRRLRYYRAIVELDHEEN* |
| Ga0098038_11101112 | 3300006735 | Marine | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEEEEN* |
| Ga0098038_11169732 | 3300006735 | Marine | MSVIIYQDHIEILEEENVELQKEVLLLRRKVAYYQTILEEEEGNEWRL* |
| Ga0098048_11414372 | 3300006752 | Marine | MSVIIYQDHIEILEEENAELQKEVMHLRRRLRYYRAIVELDHEEN* |
| Ga0098055_12056421 | 3300006793 | Marine | IIK*LNNFMSVIIYQEHIEILEEENAELQQEVVMLKQRLKYYQEFTEEEENTK* |
| Ga0098041_10082655 | 3300006928 | Marine | MSIIIYQDEIELLEEEKAELQKEVLLLRRKLKYYQKVLEEEGE* |
| Ga0098041_10791801 | 3300006928 | Marine | MSVIIYQDHIEVLEEENAELQKEVLFLRRKLEYYKSRVEQEVE* |
| Ga0111541_100069915 | 3300008097 | Marine | MSVIIYQDHIEILEQENADLQKEVLALKRKIRYYKKLEMEETDVES* |
| Ga0111541_101049621 | 3300008097 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKIKYYQQVLEEEG* |
| Ga0111541_102018561 | 3300008097 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKIKYYQQVLEEEE* |
| Ga0111541_103547242 | 3300008097 | Marine | MSVIIYSDHIEILEEENAELREEVLALRRRVKYYQTVMEDYEED* |
| Ga0111541_104452212 | 3300008097 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTMVEQEEE* |
| Ga0114932_108364293 | 3300009481 | Deep Subsurface | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKTVVEEEK* |
| Ga0115011_100435423 | 3300009593 | Marine | MSVIIYQDHIEVLEQENEELQKEVFDLKREVKYYKTLFTSEGDK* |
| Ga0115011_102606593 | 3300009593 | Marine | MSIIIYQDHIEILEEEKAELQKEVMFLRRKLEYYKTMVEEEEE* |
| Ga0115011_103628483 | 3300009593 | Marine | MSVIIYQEHIEILEEENAELQQEVVMLKQRLKFYQQYTEEQENTK* |
| Ga0115011_103885724 | 3300009593 | Marine | YQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEREEE* |
| Ga0115011_104004824 | 3300009593 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEQEVE* |
| Ga0115011_105046013 | 3300009593 | Marine | MSIIIYQDEIELLEEEKAELQKEVLLLRRKLKYYQKVMEEEEE* |
| Ga0115011_110581982 | 3300009593 | Marine | IYQEEIELLEEEKAELQREVLFLRRKLKYYQQALEEE* |
| Ga0115011_113177642 | 3300009593 | Marine | MSVIIYSEHIEVLEEENAVLQQEVLLLRRRLKYYKKLVEQDKEINN* |
| Ga0115011_121577062 | 3300009593 | Marine | MSVIIYQEEIELLEEEKAELQREVLFLRRKLKYYQQALEEER* |
| Ga0115105_102819451 | 3300009679 | Marine | MSVIIYQDEIELLEEEKAELQQEVLLLRRKLKYYQKVLEEEEE* |
| Ga0115012_100167936 | 3300009790 | Marine | MSVIIYQDHIEILEEENAELQKEVLLLRRKVAYYQTILEEEEGNEWRL* |
| Ga0115012_100999274 | 3300009790 | Marine | MSVIIYQDHIEVLEEEKAELQKEVLILRKRLRYYKKLVEESE* |
| Ga0115012_109845571 | 3300009790 | Marine | MSVIIYQDHIEILEEENAELQKEVLSLRRKVAYYQTILEEEEGNEWRL |
| Ga0115012_112094482 | 3300009790 | Marine | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTILEEEEGNEWGL* |
| Ga0115012_116132181 | 3300009790 | Marine | MSIIIYQDHIEILEEEKAELQKEVLILRRQVEYYKA |
| Ga0115012_116843452 | 3300009790 | Marine | MSVIIYQDHIEVLEEEKAELQKEVLILRRRLKYYKTIVEESE* |
| Ga0115012_119341281 | 3300009790 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKLKYYQQALEED* |
| Ga0105189_10119572 | 3300009794 | Marine Oceanic | MSIIIYQEEIELLEGEKAELQQEVLVLRKRLMYYEKLVEQDKEINN* |
| Ga0137844_12073305 | 3300010934 | Subsea Pool Microbial Mat | HIEILEEENAQLQKEVMFLRRRLDYYKTIVEVDEEGK* |
| Ga0114934_103681173 | 3300011013 | Deep Subsurface | ILEEENAQLQKEVMFLRRRLDYYKTIVEVDEGEK* |
| Ga0163180_119019202 | 3300012952 | Seawater | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKAVMEEEE* |
| Ga0163179_100945103 | 3300012953 | Seawater | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVSYYQTILEEEEDNEW* |
| Ga0163179_103135884 | 3300012953 | Seawater | MSVIIYQDHIEILEEEKAELQKEVLFLRRKVTYYQTVLEEEEVE* |
| Ga0163179_104584484 | 3300012953 | Seawater | SVIIYQDHIEILEEENAELLKEVKILRRKLAYYKTVVEEEK* |
| Ga0163179_107410262 | 3300012953 | Seawater | MSVIIYQDHIEVLEEENAELLKEVKILRRKLAYYKSVVEEEEE* |
| Ga0163179_119726491 | 3300012953 | Seawater | IEILEEENAQLQKEVMFLRRRLDYYKTIVEVDEGEK* |
| Ga0163111_103308123 | 3300012954 | Surface Seawater | MSVIIYQDHIEVLEEENAELQKEVHALRRRIKYYQTIIQEEE* |
| Ga0181381_10867233 | 3300017726 | Seawater | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEE |
| Ga0181408_10193485 | 3300017760 | Seawater | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEEAEN |
| Ga0181385_10164064 | 3300017764 | Seawater | MSVIIYQDEIELLEEEKAELQQEVLLLRRKLKYYQKVMEEEEE |
| Ga0181406_10587482 | 3300017767 | Seawater | MSVIIYQDEIELLEEEKAELQQEVLLLRRKLKYYQKVLEEEEE |
| Ga0211654_10013795 | 3300020247 | Marine | MSVIIYQEEIELLEEEKAELQREVLFLRRKLKYYQQALEEER |
| Ga0211586_100341111 | 3300020255 | Marine | MSVIIYQDHIEVLEEEKAELQKEVLILRRRLKYYKTIVEESE |
| Ga0211586_10151081 | 3300020255 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRRRLAYYKTIVEQEEE |
| Ga0211634_11133083 | 3300020279 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKTVMEEEE |
| Ga0211515_10534242 | 3300020310 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKIKYYQQVLEEEE |
| Ga0211628_10674293 | 3300020311 | Marine | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYK |
| Ga0211542_10317294 | 3300020312 | Marine | MSVIIYQDHIEILEEENAELQREVLFLRKRLAYYQSILEEEEK |
| Ga0211542_10437163 | 3300020312 | Marine | MSVIIYQDHIEILEEENAELQKEVLFLRRRLAYYESVVNKEKK |
| Ga0211542_10611222 | 3300020312 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKLKYYQQVLEED |
| Ga0211706_10183503 | 3300020345 | Marine | MSVIIYQDHIEILEEENAELLKEVKVLRRRLAYYKSVVEEEEE |
| Ga0211706_10187881 | 3300020345 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEREEE |
| Ga0211706_10497862 | 3300020345 | Marine | MSVIIYQDHIEVLEEENAELLKEVKFLRRELAYYKTIVEDEEE |
| Ga0211706_10818532 | 3300020345 | Marine | MSVIIYQEHIELLEEENEELQQEVLILKQRLKYYENYLEEGKNTK |
| Ga0211706_10836772 | 3300020345 | Marine | MSIIIYQDEIELLEEEKAELQQQVLVLRRRLRYYEKLVEQDKEINN |
| Ga0211706_11061323 | 3300020345 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEEEE |
| Ga0211706_11263812 | 3300020345 | Marine | MSIIIYQDHIEILEEEKAELQKEVLILRRQVEYYKAIVEDEEE |
| Ga0211600_10149521 | 3300020348 | Marine | MSVIIYQDHIEILEEENAELQKEVLFLRRKVAYYQTILEEEEGNEWRL |
| Ga0211598_11473541 | 3300020355 | Marine | DHIEILEEENAELQKEVLFLRRKVAYYQTILEEEEGNEWRL |
| Ga0211672_100651863 | 3300020370 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKIKYYQEVLEEEE |
| Ga0211647_101098872 | 3300020377 | Marine | MSVIIYQDHIQILEEENAELQKEVMLLRRRLRYYRAIVELDHEEN |
| Ga0211705_100406493 | 3300020395 | Marine | MSVIIYQDHIEILEEEKAELQKEVLFLRRKVAYYQTVLEEEDV |
| Ga0211705_100524564 | 3300020395 | Marine | MSVIIYQDHIEVLEEEKAELQKEVLILRRRLNYYKTIVEESE |
| Ga0211705_101564943 | 3300020395 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVE |
| Ga0211705_102737112 | 3300020395 | Marine | MSVIIYQDHIEILEEENAELQREVLFLRRKLSYYQSILEEEEK |
| Ga0211659_100337042 | 3300020404 | Marine | MSVIIYQDHIEILEEENAELQKEVMHLRRRLRYYRAIVELDHEEN |
| Ga0211587_100368032 | 3300020411 | Marine | MSVIIYQDHIEILEEEKAELQKEVLFLRRKIAYYQTVLDKEEEDVESGY |
| Ga0211587_100716963 | 3300020411 | Marine | MSVIIYQDHIEILEEENEQLLQEVMMLRRKLKYYQTIVEGEEK |
| Ga0211587_100802616 | 3300020411 | Marine | MSVIIYQDHIEILEEENAQLLEEVMMLKRKLKYYRSIVEEEE |
| Ga0211587_101026722 | 3300020411 | Marine | MSVIIYQDHIEVLEEENAELQKEVHALRRRIKYYQTIIQEDEEE |
| Ga0211587_102433563 | 3300020411 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRRRLAYYKAIVEQEEE |
| Ga0211587_103104123 | 3300020411 | Marine | MSVIIYQDHIEILEEENAQLLQEVMMLRRKLKYYQTIVEEEE |
| Ga0211587_103523121 | 3300020411 | Marine | MSVIIYQDHIEILEEENAELQREVLFLRKRLAYYQSILEKEEK |
| Ga0211587_104758243 | 3300020411 | Marine | MSVIIYQDHIEFLEEENAELQREVLSLRRKVAYYQTILEEEDGDEWXL |
| Ga0211644_100061688 | 3300020416 | Marine | MSVIIYQDHIEILEEENAELQREVLTLRRKIKYYQQILEEEE |
| Ga0211644_100229395 | 3300020416 | Marine | MSVIIYQDHIEILEEENAELQKEVLSLRRKIAFYQTILEEEKNDEWGL |
| Ga0211653_100626233 | 3300020421 | Marine | MSVIIYSEHIEVLEEENAVLQQEVLLLRRRLKYYKKLVEQDKEINN |
| Ga0211653_101231762 | 3300020421 | Marine | MSVIIYQDHIEVLEQENEELQKEVFDLKREVKYYKTLFTSEGDK |
| Ga0211653_103742202 | 3300020421 | Marine | MSVIIYQDHIEILEEENAELQKEVMLLRRRLRYYRAIVELDHEEN |
| Ga0211521_101611923 | 3300020428 | Marine | MSVIIYQDHIEVLEEEKAELQKEVMFLRRRLEYYK |
| Ga0211708_102638383 | 3300020436 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEEEEE |
| Ga0211708_102804913 | 3300020436 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRRRLAYYKTIVEHEEE |
| Ga0211576_105711652 | 3300020438 | Marine | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEEVEN |
| Ga0211564_1000000961 | 3300020445 | Marine | MSIIIYQDHIEILEEEKAELQKEVLSLRRKVSYYQTILEEDEDNEWGL |
| Ga0211564_100301513 | 3300020445 | Marine | MSVIIYQDHIEVLEQENEDLQKEVFELRREVRYYKTLFTSESDK |
| Ga0211564_100952222 | 3300020445 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKLKYYQQALEED |
| Ga0211564_101706292 | 3300020445 | Marine | MSVIIYQEHIEILEEENAELQQEVVMLKQRLKYYQEFTEEEKNTK |
| Ga0211564_102114032 | 3300020445 | Marine | MSVIIYQDHIEVLEEENAELLKEVKVLRRKLAYYKTVIEEKEE |
| Ga0211564_102368033 | 3300020445 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVDEKE |
| Ga0211664_101752383 | 3300020455 | Marine | MSVIIYQDHIEILEQENADLQREVRALKRKIRYYKTLEMEEYNVES |
| Ga0211643_100541234 | 3300020457 | Marine | MSVIIYQDHIEILEEEKAELQKEVLFLRRKVAYYQTILEEEEGNEWRL |
| Ga0211643_101947882 | 3300020457 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRKRLAYYKTIVEQEEE |
| Ga0211643_103194731 | 3300020457 | Marine | MSVIIYQEEIELLEEEKAELQQEVLLLRRRLKYYQEVLEEEEG |
| Ga0211643_106337122 | 3300020457 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVEQEVE |
| Ga0211514_106591562 | 3300020459 | Marine | MSVIIYQDHIEVLEEENAELLKEVKILRRKLAYYKSVVEEEEE |
| Ga0211640_104365751 | 3300020465 | Marine | YQDHIEILEQENADLQREVRALKRKIRYYKTLEMEEYNVES |
| Ga0211713_103705273 | 3300020467 | Marine | MSVIIYSDHIEILEEENAELREEVLALRRRIKYYQTVMEDYEED |
| Ga0211543_1001728512 | 3300020470 | Marine | MSIIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTILEEEEDNEWRL |
| Ga0211543_100392783 | 3300020470 | Marine | MSVIIYQDHIEILEEENAQLLQEVTMLRRKLKYYRSIVEEEE |
| Ga0211543_101307162 | 3300020470 | Marine | MSIIIYQDHIEILEEENAELQKEVLILRKRLAYYKSIVEEEEE |
| Ga0211543_102434892 | 3300020470 | Marine | MSIIIYQDHIEVLEEEKAELQKEVLALRRRIKYYQAVIEEDEEE |
| Ga0211543_103814252 | 3300020470 | Marine | MSVIIYQEHIEVLEEEKAELQREVLALRRRIKYYQTVIDEDEDINN |
| Ga0211543_103894702 | 3300020470 | Marine | MSVIIYQEHIEVLEEENAELQQEVIMLKQRLRYYQNYVEEEENTK |
| Ga0211614_103292843 | 3300020471 | Marine | MSVIIYQDHIEILEEENEQLLQEVTMLRRKLKYYQTIVEEGEE |
| Ga0211579_100053989 | 3300020472 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRSKLAYYRSVVEQEVE |
| Ga0211579_101200883 | 3300020472 | Marine | MSVIIYQDHIEVLEQENEDLQKEVFELRRKVRYYKTLFTSNSDK |
| Ga0211579_102725323 | 3300020472 | Marine | MSVIIYQDHIEILEEENAELQKEVLSLRRKLDYYQTILEEEQDNEW |
| Ga0211579_106326563 | 3300020472 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEQEEE |
| Ga0211579_108287463 | 3300020472 | Marine | MSVIIYQDHIEILEEENAELQKEVMFLRRKVEYYKTIVEEEE |
| Ga0211625_100560905 | 3300020473 | Marine | MSVIIYQDHIEILEEENEQLLQEVMMLRRKLKYYQTILEEEGR |
| Ga0211625_100577075 | 3300020473 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKDVVEEEE |
| Ga0211625_104307361 | 3300020473 | Marine | MSVIIYQDHIEVLEEEKAELQKEVLILRKRLRYYKKLVEESE |
| Ga0211585_102385344 | 3300020477 | Marine | MSVIIYQEHIEVLEEENAELQQEVLVLRRRLNYYKSLIEEDEIDK |
| Ga0211503_104293022 | 3300020478 | Marine | MSVIIYQDHIEILEEENAELQKEVLFLRRRLAYYESVVTEEEE |
| Ga0208157_11252091 | 3300025086 | Marine | MSVIIYQDHIEVLEEENAELQKEVMLLRRRLRYYRAVVGLEEEEN |
| Ga0208666_11409442 | 3300025102 | Marine | MSVIIYQDHIEILEEENVELQKEVLLLRRKVAYYQTILEEEE |
| Ga0208158_100004029 | 3300025110 | Marine | MSIIIYQDEIELLEEEKAELQKEVLLLRRKLKYYQKVLEEEGE |
| Ga0208158_11449462 | 3300025110 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTMVEQEEE |
| Ga0209232_10423296 | 3300025132 | Marine | MSVIIYQDHIEILEEEKAELQKEVLSLRRKVAYYQTILEEEEGNEWRL |
| Ga0209232_11142783 | 3300025132 | Marine | MSIIIYQDHIEILEEEKAELQKEVMFLRRKLEYYKTMVEQEEE |
| Ga0209232_11428261 | 3300025132 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKS |
| Ga0209232_12459822 | 3300025132 | Marine | MSVIIYQDHIEVLEEENAELQKEVHALRRRIKYYQTIIQEDE |
| Ga0208261_10381692 | 3300026076 | Marine | MSVIIYQDHIEILEQENADLQKEVLALKRKIRYYKKLEMEETDVES |
| Ga0208261_10679833 | 3300026076 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKIKYYQQVLEE |
| Ga0208749_10069193 | 3300026077 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIVEKEEE |
| Ga0208815_10273932 | 3300026134 | Marine Oceanic | MSIIIYQEEIELLEEEKAELQQEVLVLRKRLMYYEKLVEQDKEINN |
| Ga0207992_11218661 | 3300026263 | Marine | XLNNFMSVIIYQEHIEILEEENAELQQEVVMLKQRLKYYQEFTEEEKNTK |
| Ga0208410_11137591 | 3300026266 | Marine | YQDHIEILEEENAELLKEVKVLRRKLAYYKTVIEEKEE |
| Ga0208277_11350753 | 3300026292 | Marine | MSVIIYQDHIEVLEEENAELQKEVLILRRKLEYYKTIV |
| Ga0208277_11745471 | 3300026292 | Marine | QDHIEVLEEENAELQKEVLILRRKLEYYKTIVEKEEE |
| Ga0208277_12706792 | 3300026292 | Marine | QDHIEVLEEENAELQKEVLILRRKLEYYKTIVEQEEE |
| Ga0209404_100082395 | 3300027906 | Marine | MSVIIYQDHIEVLEEENAELQKEVLFLRRKLEYYKSRVEQEVE |
| Ga0209404_100221165 | 3300027906 | Marine | MSIIIYQDEIELLEEEKAELQKEVLLLRRKLKYYQKVMEEEEE |
| Ga0209404_100607754 | 3300027906 | Marine | MSVIIYQEHIEILEEENAELQQEVVMLKQRLKFYQQYTEEQENTK |
| Ga0209404_100734522 | 3300027906 | Marine | MSIIIYQDHIEILEEEKAELQKEVMFLRRKLEYYKTMVEEEEE |
| Ga0209404_102159112 | 3300027906 | Marine | MSVIIYQDHIEILEEENAELLKEVKILRRKLAYYKSVVDEEVE |
| Ga0183748_10821552 | 3300029319 | Marine | MSVIIYQEEIELLEEEKAELQKEVLFLRRKLKYYQQVLEEEQ |
| Ga0183757_10280212 | 3300029787 | Marine | MSIIIYQDHIEILEEEKAELQKEVLFLRRKLNYYQTVLEEEEV |
| Ga0315332_101486732 | 3300031773 | Seawater | MSVIIYSDHIEILEQENAELQKEVQELRSRVKYYQTVMEDYEED |
| Ga0310344_113803392 | 3300032006 | Seawater | MSVIIYQEEIELLEEEKAELQQEVLILRRRLKYYQSSLEEEENTK |
| Ga0315316_111116332 | 3300032011 | Seawater | MSVIIYQDHIEVLEQENEDLQKELFELRRKVRYYKNLFTSESDK |
| Ga0315316_111279353 | 3300032011 | Seawater | MSVIIYQDHIEILEEENAELLKEVKILRSKLAYYRSVVE |
| Ga0310342_1000135416 | 3300032820 | Seawater | MSVIIYQDHIEILEEENEQLLQEVTMLRRKLKYYQTLVEEGEE |
| ⦗Top⦘ |