


| Basic Information | |
|---|---|
| Family ID | F032403 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 46 residues |
| Representative Sequence | SPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLMATLEYRF |
| Number of Associated Samples | 157 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.56 % |
| % of genes near scaffold ends (potentially truncated) | 98.33 % |
| % of genes from short scaffolds (< 2000 bps) | 87.78 % |
| Associated GOLD sequencing projects | 148 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.111 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 38.33 |
| PF11453 | DUF2950 | 8.89 |
| PF03264 | Cytochrom_NNT | 5.56 |
| PF14522 | Cytochrome_C7 | 2.78 |
| PF13426 | PAS_9 | 2.22 |
| PF08802 | Obsolete Pfam Family | 1.67 |
| PF00033 | Cytochrome_B | 1.11 |
| PF00034 | Cytochrom_C | 1.11 |
| PF03372 | Exo_endo_phos | 1.11 |
| PF00072 | Response_reg | 0.56 |
| PF01292 | Ni_hydr_CYTB | 0.56 |
| PF03551 | PadR | 0.56 |
| PF00383 | dCMP_cyt_deam_1 | 0.56 |
| PF13620 | CarboxypepD_reg | 0.56 |
| PF10509 | GalKase_gal_bdg | 0.56 |
| PF00270 | DEAD | 0.56 |
| PF02566 | OsmC | 0.56 |
| PF11799 | IMS_C | 0.56 |
| PF00355 | Rieske | 0.56 |
| PF09699 | Paired_CXXCH_1 | 0.56 |
| PF13414 | TPR_11 | 0.56 |
| PF00239 | Resolvase | 0.56 |
| PF02796 | HTH_7 | 0.56 |
| PF03741 | TerC | 0.56 |
| PF16491 | Peptidase_M48_N | 0.56 |
| PF13751 | DDE_Tnp_1_6 | 0.56 |
| PF12969 | DUF3857 | 0.56 |
| PF11376 | DUF3179 | 0.56 |
| PF13505 | OMP_b-brl | 0.56 |
| PF07730 | HisKA_3 | 0.56 |
| PF01855 | POR_N | 0.56 |
| PF07366 | SnoaL | 0.56 |
| PF13185 | GAF_2 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG3005 | Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductase | Energy production and conversion [C] | 5.56 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 1.11 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.56 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 0.56 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.56 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.56 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.56 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.56 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.56 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.56 |
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.56 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.56 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.56 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.56 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.56 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.56 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.56 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.56 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 0.56 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.56 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.22 % |
| Unclassified | root | N/A | 2.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16499438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2043 | Open in IMG/M |
| 2170459005|F1BAP7Q01BJDS4 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300000574|JGI1357J11328_10077509 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300000579|AP72_2010_repI_A01DRAFT_1062365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300000650|AP72_2010_repI_A1DRAFT_1010764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
| 3300000955|JGI1027J12803_101317316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300001979|JGI24740J21852_10103531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300004140|Ga0058894_1466731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300004152|Ga0062386_100043273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3375 | Open in IMG/M |
| 3300004152|Ga0062386_100754114 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300004592|Ga0068938_1173909 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004615|Ga0068926_1263693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300004633|Ga0066395_10670408 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005166|Ga0066674_10427835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
| 3300005332|Ga0066388_100837165 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300005439|Ga0070711_100896277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 757 | Open in IMG/M |
| 3300005439|Ga0070711_101658237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300005450|Ga0066682_10081161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2015 | Open in IMG/M |
| 3300005574|Ga0066694_10296570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
| 3300005578|Ga0068854_101290822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300005614|Ga0068856_102461646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300005616|Ga0068852_102061347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300005834|Ga0068851_10809783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300005836|Ga0074470_11319540 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005841|Ga0068863_102539181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300006050|Ga0075028_100782182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300006050|Ga0075028_101021360 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300006086|Ga0075019_10675049 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006162|Ga0075030_100485117 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006173|Ga0070716_101418767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300006354|Ga0075021_10053188 | All Organisms → cellular organisms → Bacteria | 2343 | Open in IMG/M |
| 3300006358|Ga0068871_100081373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2683 | Open in IMG/M |
| 3300006358|Ga0068871_100089053 | All Organisms → cellular organisms → Bacteria | 2569 | Open in IMG/M |
| 3300006755|Ga0079222_10081384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1634 | Open in IMG/M |
| 3300006755|Ga0079222_12382887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300006804|Ga0079221_10055200 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300006852|Ga0075433_10345865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1314 | Open in IMG/M |
| 3300006954|Ga0079219_10061213 | All Organisms → cellular organisms → Bacteria | 1675 | Open in IMG/M |
| 3300006954|Ga0079219_11438123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300007255|Ga0099791_10301583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
| 3300007265|Ga0099794_10746908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300009088|Ga0099830_11199995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300009089|Ga0099828_11685424 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009137|Ga0066709_101026156 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009174|Ga0105241_10436489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1156 | Open in IMG/M |
| 3300009545|Ga0105237_10505090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1216 | Open in IMG/M |
| 3300009618|Ga0116127_1069214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 973 | Open in IMG/M |
| 3300010046|Ga0126384_11380034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300010047|Ga0126382_10157576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1564 | Open in IMG/M |
| 3300010048|Ga0126373_10732023 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300010048|Ga0126373_11995995 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300010048|Ga0126373_12075812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300010333|Ga0134080_10019950 | All Organisms → cellular organisms → Bacteria | 2479 | Open in IMG/M |
| 3300010333|Ga0134080_10144854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
| 3300010361|Ga0126378_10254175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1851 | Open in IMG/M |
| 3300010361|Ga0126378_11542867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300010362|Ga0126377_10202002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1906 | Open in IMG/M |
| 3300010391|Ga0136847_13217238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1272 | Open in IMG/M |
| 3300010401|Ga0134121_11466136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
| 3300011120|Ga0150983_10297439 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300011120|Ga0150983_10912418 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300011120|Ga0150983_13936601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300011120|Ga0150983_16288405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300011444|Ga0137463_1302887 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012202|Ga0137363_10470583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1053 | Open in IMG/M |
| 3300012209|Ga0137379_11214007 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 661 | Open in IMG/M |
| 3300012212|Ga0150985_119258900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 762 | Open in IMG/M |
| 3300012349|Ga0137387_11057780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300012361|Ga0137360_10301356 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300012361|Ga0137360_10352046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300012582|Ga0137358_10061330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2514 | Open in IMG/M |
| 3300012683|Ga0137398_10331880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300012685|Ga0137397_11188002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300012931|Ga0153915_11920263 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012944|Ga0137410_10647567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha | 877 | Open in IMG/M |
| 3300012948|Ga0126375_11341349 | Not Available | 603 | Open in IMG/M |
| 3300012957|Ga0164303_10390331 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012958|Ga0164299_10533993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_65_5 | 788 | Open in IMG/M |
| 3300012958|Ga0164299_11671480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012971|Ga0126369_10976185 | Not Available | 934 | Open in IMG/M |
| 3300012971|Ga0126369_12383198 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012986|Ga0164304_10207241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300012989|Ga0164305_10053945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2370 | Open in IMG/M |
| 3300013296|Ga0157374_10401750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
| 3300015374|Ga0132255_104134197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300016294|Ga0182041_11522949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300016357|Ga0182032_11324633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300016371|Ga0182034_11868000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300016387|Ga0182040_10099432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1970 | Open in IMG/M |
| 3300016387|Ga0182040_10172831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1563 | Open in IMG/M |
| 3300016404|Ga0182037_11328004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300016422|Ga0182039_10649089 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300016445|Ga0182038_11362926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300017823|Ga0187818_10367029 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300017938|Ga0187854_10223747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300017972|Ga0187781_10662065 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300017973|Ga0187780_10061604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2585 | Open in IMG/M |
| 3300018002|Ga0187868_1183599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300018003|Ga0187876_1213758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300018012|Ga0187810_10371105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300018021|Ga0187882_1297170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300018060|Ga0187765_10251485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300018064|Ga0187773_10047509 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300018085|Ga0187772_10006230 | All Organisms → cellular organisms → Bacteria | 6208 | Open in IMG/M |
| 3300018089|Ga0187774_10795079 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300020140|Ga0179590_1024564 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
| 3300020581|Ga0210399_11390714 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300021088|Ga0210404_10652566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021168|Ga0210406_10074035 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300021181|Ga0210388_11024804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 707 | Open in IMG/M |
| 3300021344|Ga0193719_10154851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_40CM_55_7 | 988 | Open in IMG/M |
| 3300021420|Ga0210394_10271177 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300021478|Ga0210402_10430283 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300021478|Ga0210402_10512825 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300021559|Ga0210409_10157090 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300022533|Ga0242662_10133271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 738 | Open in IMG/M |
| 3300024249|Ga0247676_1023847 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300025321|Ga0207656_10608552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300025898|Ga0207692_10367928 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300025899|Ga0207642_10274984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 966 | Open in IMG/M |
| 3300025899|Ga0207642_11145357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300025903|Ga0207680_11086034 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300025911|Ga0207654_10559827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300025912|Ga0207707_10410248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
| 3300025924|Ga0207694_10393144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1152 | Open in IMG/M |
| 3300025926|Ga0207659_10029098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3761 | Open in IMG/M |
| 3300025927|Ga0207687_11735548 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025935|Ga0207709_11521310 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300025941|Ga0207711_10169457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Thermoanaerobaculaceae → Thermoanaerobaculum → Thermoanaerobaculum aquaticum | 1981 | Open in IMG/M |
| 3300025961|Ga0207712_10342052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1241 | Open in IMG/M |
| 3300025961|Ga0207712_10795100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
| 3300026095|Ga0207676_11230498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300026291|Ga0209890_10089085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1082 | Open in IMG/M |
| 3300026314|Ga0209268_1103181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300026490|Ga0257153_1038621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 984 | Open in IMG/M |
| 3300026783|Ga0207778_106648 | Not Available | 844 | Open in IMG/M |
| 3300027023|Ga0207736_110136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300027641|Ga0208827_1191360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300027765|Ga0209073_10424876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300027787|Ga0209074_10035164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1456 | Open in IMG/M |
| 3300027825|Ga0209039_10347865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300027854|Ga0209517_10427141 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027894|Ga0209068_10034273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2527 | Open in IMG/M |
| 3300027894|Ga0209068_10040331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2343 | Open in IMG/M |
| 3300027908|Ga0209006_10223173 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300027911|Ga0209698_10324675 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10378362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300028379|Ga0268266_11977893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300029701|Ga0222748_1105667 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300029981|Ga0302293_10186045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300030974|Ga0075371_11534110 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10129605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300031446|Ga0170820_11164609 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300031543|Ga0318516_10532346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300031573|Ga0310915_10462478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 901 | Open in IMG/M |
| 3300031573|Ga0310915_10656519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300031754|Ga0307475_10218726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 1524 | Open in IMG/M |
| 3300031771|Ga0318546_10295845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1120 | Open in IMG/M |
| 3300031795|Ga0318557_10384685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300031823|Ga0307478_10525691 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031896|Ga0318551_10663851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300031912|Ga0306921_10964792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 964 | Open in IMG/M |
| 3300031946|Ga0310910_10694489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 804 | Open in IMG/M |
| 3300031954|Ga0306926_11214317 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300032060|Ga0318505_10264047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300032063|Ga0318504_10125481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1168 | Open in IMG/M |
| 3300032068|Ga0318553_10548388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300032160|Ga0311301_11295903 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300032180|Ga0307471_101305156 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300032205|Ga0307472_100536169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300032342|Ga0315286_12030605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300032421|Ga0310812_10013635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2755 | Open in IMG/M |
| 3300032770|Ga0335085_10114804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3449 | Open in IMG/M |
| 3300032783|Ga0335079_10780421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300032805|Ga0335078_10505116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1552 | Open in IMG/M |
| 3300032898|Ga0335072_10047638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5798 | Open in IMG/M |
| 3300033289|Ga0310914_10203896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1766 | Open in IMG/M |
| 3300033412|Ga0310810_10200137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2259 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.56% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.44% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.89% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.33% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.33% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.33% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.78% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.78% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.22% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.22% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.22% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.56% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.56% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.56% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.56% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.56% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.56% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000650 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300004140 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF224 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004592 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004615 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026783 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 36 (SPAdes) | Environmental | Open in IMG/M |
| 3300027023 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029981 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_2 | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02024300 | 2088090014 | Soil | GCTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF |
| E41_04351690 | 2170459005 | Grass Soil | TPSPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| JGI1357J11328_100775094 | 3300000574 | Groundwater | YPFFVVGDTSAARYYFLGVDQPSYRTHRIAASIQYTF* |
| AP72_2010_repI_A01DRAFT_10623651 | 3300000579 | Forest Soil | SPSPFNPGFVVGDPSAARYLFLGVDQPSYQAHTIMATLEYRF* |
| AP72_2010_repI_A1DRAFT_10107643 | 3300000650 | Forest Soil | SPFYPGFVXGDTAAARYVFLGADQPSYHAHVITATLEYHF* |
| JGI1027J12803_1013173161 | 3300000955 | Soil | PYFQVGDTSAARYLFLGVDQPSYRAYYISATLEFHF* |
| JGI24740J21852_101035313 | 3300001979 | Corn Rhizosphere | FFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF* |
| Ga0058894_14667311 | 3300004140 | Forest Soil | PFYPYFVVGDPSAARYLFLGVDQPSYHAHTVTASLEYRF* |
| Ga0062386_1000432735 | 3300004152 | Bog Forest Soil | PVLGCTSPILNSATSPTPLPGAASPFYPGFVVGDPSSARYLFLGVDQPSYHVHIVTATLEYRF* |
| Ga0062386_1007541141 | 3300004152 | Bog Forest Soil | SPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF* |
| Ga0068938_11739091 | 3300004592 | Peatlands Soil | PILSSATATNPVGVASPFYPYFVVGDSSAARYLFLGVDQPSYRAHFLTATLEYRF* |
| Ga0068926_12636931 | 3300004615 | Peatlands Soil | PGCTSPLIGTPSPYYPFFVVGDTSAARYLFLGADQPSYRAHYLAASIEYSF* |
| Ga0066395_106704081 | 3300004633 | Tropical Forest Soil | TSPTPLPGAASPFYPGFVVGDPSSARYLFLGVDQPSYHAHTIIATLEYRF* |
| Ga0066674_104278352 | 3300005166 | Soil | PFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF* |
| Ga0066388_1008371653 | 3300005332 | Tropical Forest Soil | TNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF* |
| Ga0070711_1008962771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FFFPTATPGMYPYQVVGDPSAARYLFMGVDQPSYRAHYLAATLEYSF* |
| Ga0070711_1016582372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PVAGCSTRILDSSTSPSPNPGAASPFYPYFVVGDPSAARYLFLGVDQPSYRAHIFTATLEYRF* |
| Ga0066682_100811611 | 3300005450 | Soil | TNAVPGCTTPILTSNTPSPQPVPGPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF* |
| Ga0066694_102965701 | 3300005574 | Soil | PGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF* |
| Ga0068854_1012908222 | 3300005578 | Corn Rhizosphere | GCTSPLIGTPSPFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF* |
| Ga0068856_1024616461 | 3300005614 | Corn Rhizosphere | PYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF* |
| Ga0068852_1020613471 | 3300005616 | Corn Rhizosphere | APIPGCTSPLLGTPSPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF* |
| Ga0068851_108097831 | 3300005834 | Corn Rhizosphere | VPGCTSRLLGTPSPFYPFFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF* |
| Ga0074470_113195402 | 3300005836 | Sediment (Intertidal) | SPYYPYFTVGDTSSARYLFLGADQPSYRTHYVAATMEIHF* |
| Ga0068863_1025391811 | 3300005841 | Switchgrass Rhizosphere | SPNGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF* |
| Ga0075028_1007821821 | 3300006050 | Watersheds | GCTTPILTSATSASPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLTASLEYRF* |
| Ga0075028_1010213601 | 3300006050 | Watersheds | STSPAPNPGALSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTLMATLEYRF* |
| Ga0075019_106750491 | 3300006086 | Watersheds | ASPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLTASLEYRF* |
| Ga0075030_1004851172 | 3300006162 | Watersheds | TSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF* |
| Ga0070716_1014187671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GSTVAAKSPSPFYPFFVVGDTAAARYLFLGADQPSYRSHIITGTLEYHF* |
| Ga0075021_100531885 | 3300006354 | Watersheds | SYPYFVVGDTSSARYLFLGVDQPSYHAHTIAASLEYRF* |
| Ga0068871_1000813734 | 3300006358 | Miscanthus Rhizosphere | LLGTPSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF* |
| Ga0068871_1000890531 | 3300006358 | Miscanthus Rhizosphere | VPGCPNVLLGTPSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF* |
| Ga0079222_100813844 | 3300006755 | Agricultural Soil | PTPVAVTSSFYPYFVVGDPSAARYLFLGTDQPSYKAHTLLATLEYRF* |
| Ga0079222_123828871 | 3300006755 | Agricultural Soil | PFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF* |
| Ga0079221_100552001 | 3300006804 | Agricultural Soil | PGATSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLFATLEYRF* |
| Ga0075433_103458652 | 3300006852 | Populus Rhizosphere | IPFYPYFQVGDTSAARYLFLGVDQPSYRAYYISATLEFHF* |
| Ga0079219_100612131 | 3300006954 | Agricultural Soil | PSPTPTPGATSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLFATLEYRF* |
| Ga0079219_114381231 | 3300006954 | Agricultural Soil | FYPYFVVGDPSAARYLFLGVDQPSYKAHTLLATLEYRF* |
| Ga0099791_103015832 | 3300007255 | Vadose Zone Soil | TLSPNGPTSFYPYFQVGDTSAARYLFLGVDQPSYRAYSISATLEFHF* |
| Ga0099794_107469082 | 3300007265 | Vadose Zone Soil | AAPVAGCTKRILDSSTSPSPNPGAISPFYPYSVVGDPSGARYLFLGVDQPSYRAHFLSATLEYRF* |
| Ga0099830_111999952 | 3300009088 | Vadose Zone Soil | IGTTSTNPTFTPNSFYPGFVVGDTSAARYLFLGVDQPSYRVHTVTATLEYRF* |
| Ga0099828_116854241 | 3300009089 | Vadose Zone Soil | SPNPVGAPSPFYPYFVVGDPSAARYLFLGVDQPSYHAHTLTATLEYRF* |
| Ga0066709_1010261561 | 3300009137 | Grasslands Soil | RYPSPYYPNFVVGDTGAARYIFLGADQPSYRAHVLSVTVQYHF* |
| Ga0105241_104364894 | 3300009174 | Corn Rhizosphere | YPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF* |
| Ga0105237_105050901 | 3300009545 | Corn Rhizosphere | PSSFYPYFFVGDTSAARYLFMGADQPSYHAHYVAATLEYSF* |
| Ga0116127_10692141 | 3300009618 | Peatland | FYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF* |
| Ga0126384_113800342 | 3300010046 | Tropical Forest Soil | FVVGDPSSARYLFLGVDQPSYHAHTVIATIEYRF* |
| Ga0126382_101575765 | 3300010047 | Tropical Forest Soil | STTAGKVPSPFYPGFVVGDTAAARYVFLGADQPSYHAHIITATLEYHF* |
| Ga0126373_107320232 | 3300010048 | Tropical Forest Soil | PILNSSTSPTPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVMATLEYRF* |
| Ga0126373_119959951 | 3300010048 | Tropical Forest Soil | SPFYPGFVVGDPSSARYLFLGVDQPSYHAHTIMATLEYRF* |
| Ga0126373_120758121 | 3300010048 | Tropical Forest Soil | FYPGFVVGDPSAARYLFLGVDQPSYHAHIITATLEYRF* |
| Ga0134080_100199504 | 3300010333 | Grasslands Soil | AARYPSPYYGNIVVGDTGAARYIFLGADQPSYRAHVLSVTVQYHF* |
| Ga0134080_101448541 | 3300010333 | Grasslands Soil | PFYPGFVVGDTAAARYLFLGVDQPSYRAHIFIATLEYHF* |
| Ga0126378_102541751 | 3300010361 | Tropical Forest Soil | TPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF* |
| Ga0126378_115428671 | 3300010361 | Tropical Forest Soil | TNPILNSSTSPTPLPGALSPFYPGFVVGDPSSARYLFLGVDQPSYHAHIIMATLEYRF* |
| Ga0126377_102020023 | 3300010362 | Tropical Forest Soil | PFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF* |
| Ga0136847_132172383 | 3300010391 | Freshwater Sediment | PTFTPSPYYPNAVVGDTSAARYIFLGVDQPSYRVHVITATLEYSW* |
| Ga0134121_114661363 | 3300010401 | Terrestrial Soil | PFFVVGDTSAARYLFMGVDEPSYRAHYLAGTLEYSF* |
| Ga0150983_102974391 | 3300011120 | Forest Soil | FPILNSSTSPTPLPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF* |
| Ga0150983_109124182 | 3300011120 | Forest Soil | SPFYPYFVVGDPSAARYLFLGVDQPSYRAHTLMATLEYRF* |
| Ga0150983_139366011 | 3300011120 | Forest Soil | NSSTSPTPAPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF* |
| Ga0150983_162884051 | 3300011120 | Forest Soil | PGCTTPFLTSNTINPVGVASPFYPYFVVGDPSSARYLFLGVDQPSYRAHTLMASLEYRF* |
| Ga0137463_13028871 | 3300011444 | Soil | TRILNSATSPNPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYRAHTITASLEYRF* |
| Ga0137363_104705831 | 3300012202 | Vadose Zone Soil | PILTSNIPSPQPIPGPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVIATLEYRF* |
| Ga0137379_112140071 | 3300012209 | Vadose Zone Soil | PGFVVGDTAAARYLFLGADQPSYRVHIFIATLEYHF* |
| Ga0150985_1192589001 | 3300012212 | Avena Fatua Rhizosphere | VCSSDLFFVVGDTSAARYLFMGADQPSYHAHYLAATLEYHF* |
| Ga0137387_110577802 | 3300012349 | Vadose Zone Soil | FYPYFVVGDPSAARYMFLGVDQPSYHAHTVMATLEYRF* |
| Ga0137360_103013561 | 3300012361 | Vadose Zone Soil | NSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF* |
| Ga0137360_103520461 | 3300012361 | Vadose Zone Soil | NSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTITATLEYRF* |
| Ga0137358_100613305 | 3300012582 | Vadose Zone Soil | NAVPGCTTPILTAKTASPQPVPGPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVIATLEYRF* |
| Ga0137398_103318801 | 3300012683 | Vadose Zone Soil | NSATSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDHPSYHAHTITATLEYRF* |
| Ga0137397_111880022 | 3300012685 | Vadose Zone Soil | GFVVGDPSAARYLFLGVDQPSYHAHTITATLEYRF* |
| Ga0153915_119202632 | 3300012931 | Freshwater Wetlands | CTTPLLTSATSATPVAVSSPFYPGFVVGDSSAARFLFLGVDQPSYHAHYLTATLEYHF* |
| Ga0137410_106475672 | 3300012944 | Vadose Zone Soil | PGPFYPGFVVGDPSSARYLFLGADQPSYHAHTVIATLEYRF* |
| Ga0126375_113413491 | 3300012948 | Tropical Forest Soil | SYYPGFVVGDTSAARYLFLGADQPSYRVHIFTATLEYRF* |
| Ga0164303_103903313 | 3300012957 | Soil | SPFYPYFVVGDTGAARYLFLGADQPSYRAHYLAATVEYHF* |
| Ga0164299_105339933 | 3300012958 | Soil | GFVVGDTAAARYIFLGADQPSYRAHIITATLEYRF* |
| Ga0164299_116714801 | 3300012958 | Soil | PSQFYPFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF* |
| Ga0126369_109761852 | 3300012971 | Tropical Forest Soil | GVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF* |
| Ga0126369_123831981 | 3300012971 | Tropical Forest Soil | KSPNVYYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEYHF* |
| Ga0164304_102072414 | 3300012986 | Soil | FYPYFVVGDTSAARYLFLGADQPSYRAHYVAATVEYHF* |
| Ga0164305_100539451 | 3300012989 | Soil | PLIGTPSPFYPYFVVGDTSSARFLFLGADQPSYRANYLAGTLEYSF* |
| Ga0157374_104017501 | 3300013296 | Miscanthus Rhizosphere | PNGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF* |
| Ga0132255_1041341972 | 3300015374 | Arabidopsis Rhizosphere | VGTNLSIKSPSSFYPGFVVGDTAAARYLFLGADQPSYRAHVITATLEYRF* |
| Ga0182041_115229491 | 3300016294 | Soil | SPAPTPGATSPFYPYFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0182032_113246331 | 3300016357 | Soil | APNAVPGCTTPILTTNTSNPMGVPSSFYPGFVVGDPSAARYLFLGVDQPSYHAHTVVATIEFQF |
| Ga0182034_118680001 | 3300016371 | Soil | AVKSPNVYYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEYRF |
| Ga0182040_100994321 | 3300016387 | Soil | PNPVGVPSPFYPGFVVGDTSEARYLFLGVDQPSYHAHTIIATLEYRF |
| Ga0182040_101728311 | 3300016387 | Soil | SPVGVASPFYPYFVVGDPSAARYLFLGVDQPSYHAHTVVATIEFNF |
| Ga0182037_113280041 | 3300016404 | Soil | PGGASPFYPGFVVGDTNAARYLFLGVDQPSYHAHTIMATLEYRF |
| Ga0182039_106490891 | 3300016422 | Soil | PGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF |
| Ga0182038_113629261 | 3300016445 | Soil | PYYPYFVVGDTAAARYLFLGADQPSYHAHVFTGTVEYHF |
| Ga0187818_103670291 | 3300017823 | Freshwater Sediment | NPLIGTPSPYYPFFVVGDTSSARYLFLGADQPSYRAHYLAASIEYSF |
| Ga0187854_102237472 | 3300017938 | Peatland | FYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF |
| Ga0187781_106620651 | 3300017972 | Tropical Peatland | LSPNGASPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSATMEYHF |
| Ga0187780_100616044 | 3300017973 | Tropical Peatland | PYYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF |
| Ga0187868_11835991 | 3300018002 | Peatland | SFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF |
| Ga0187876_12137581 | 3300018003 | Peatland | IPQPSSFYPGFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF |
| Ga0187810_103711052 | 3300018012 | Freshwater Sediment | SPPPVPGAASPFYPGFVVGDPSAARFLFLGVDQPSYHAHIVSATLEYRF |
| Ga0187882_12971701 | 3300018021 | Peatland | GFVVGDPSAARYIFMGVDQPSYRVNVMSATIEYQF |
| Ga0187765_102514851 | 3300018060 | Tropical Peatland | GVVASPFYPFFVVGDPSAARYLFLGSDQPSYHVHYLAATLEIHF |
| Ga0187773_100475094 | 3300018064 | Tropical Peatland | SSPFYPTFVVGDTSAARYLFLGVDQPSYHAHYLAATLEYHF |
| Ga0187772_100062306 | 3300018085 | Tropical Peatland | FYPYFVVGDPSAARYLFLGVDQPSYHAHTIMATLEYRF |
| Ga0187774_107950792 | 3300018089 | Tropical Peatland | MLTSSTSATATPVPGSSPFYPYFVVGDSSAARYLFLGVDQPSYHAHYVAATMEYHF |
| Ga0179590_10245643 | 3300020140 | Vadose Zone Soil | PGPAPGTVPNCTSPILNSGTSPTPVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0210399_113907142 | 3300020581 | Soil | PGCTFPILNSSTSPTPLPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYR |
| Ga0210404_106525661 | 3300021088 | Soil | LTSNTINPVGVASPFYPYFVVGDPSSARYLFLGVDQPSYHAHTLMASLEYRF |
| Ga0210406_100740353 | 3300021168 | Soil | KPQPGAPSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0210388_110248041 | 3300021181 | Soil | LTSNTPAPVGVPSPFYPYFTVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF |
| Ga0193719_101548512 | 3300021344 | Soil | SPLLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYVAATLEYTF |
| Ga0210394_102711773 | 3300021420 | Soil | CTAPILTSNTPNPQPGAPSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0210402_104302833 | 3300021478 | Soil | AASPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0210402_105128251 | 3300021478 | Soil | ASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0210409_101570903 | 3300021559 | Soil | PSPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0242662_101332711 | 3300022533 | Soil | GFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF |
| Ga0247676_10238471 | 3300024249 | Soil | PILTSNTPNPQPGAPSPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0207656_106085521 | 3300025321 | Corn Rhizosphere | VVPGCTSRLLGTPSPFYPFFVVGDTSAARYLFMGVDQPSYRAHYLAGTLEYSF |
| Ga0207692_103679283 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | QLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYLAATVEYHF |
| Ga0207642_102749841 | 3300025899 | Miscanthus Rhizosphere | YPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF |
| Ga0207642_111453571 | 3300025899 | Miscanthus Rhizosphere | GCTSPVLGTPSPYYPFFVVGDPSAARYLFMGVDQPSYHAHYIAGTLEYSF |
| Ga0207680_110860341 | 3300025903 | Switchgrass Rhizosphere | PSPFYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF |
| Ga0207654_105598271 | 3300025911 | Corn Rhizosphere | SPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF |
| Ga0207707_104102481 | 3300025912 | Corn Rhizosphere | FYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF |
| Ga0207694_103931443 | 3300025924 | Corn Rhizosphere | PYFVVGDTAAARYLFLGADQPSYRAHVFTGTLEYRF |
| Ga0207659_100290981 | 3300025926 | Miscanthus Rhizosphere | NGAIPFYPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF |
| Ga0207687_117355481 | 3300025927 | Miscanthus Rhizosphere | TSPQLGTPSPFYPYFVVGDTSAARYLFLGADQPSYRAHYLAATVEYHF |
| Ga0207709_115213102 | 3300025935 | Miscanthus Rhizosphere | LGTPSPYYPFFVVGDTNAARYLFMGVDQPSYRAHYIAGTLEYSF |
| Ga0207711_101694571 | 3300025941 | Switchgrass Rhizosphere | PNPEPVPGPFYPGFIVGDPSAARYLFLGADQPSYHAHTIIATLEYRF |
| Ga0207712_103420521 | 3300025961 | Switchgrass Rhizosphere | IPFYPYFQVGDTSAARFLFLGVDQPSYRAYSVSGTLEFHF |
| Ga0207712_107951003 | 3300025961 | Switchgrass Rhizosphere | PFFVVGDTSAARYLFLGTDQPSYKAHYLATTLEYHF |
| Ga0207676_112304983 | 3300026095 | Switchgrass Rhizosphere | APVPGCTSPLLGTPSPFYPYFLVGDTSAARYLFLGADQPSYRAHYLAATVEYHF |
| Ga0209890_100890853 | 3300026291 | Soil | APVPGCTSPLIGTPSPYYPFFVVGDPSAARYLFLGADEPSYRAHYIAASLEYTF |
| Ga0209268_11031812 | 3300026314 | Soil | GPFYPGFVVGDPSSARYLFLGVDQPSYHAHTVIATLEYRF |
| Ga0257153_10386211 | 3300026490 | Soil | NPILNSSTSPTPLPGALSPFYPGFVVGDPSAARYLFLGVDQPSYHAHTILATLEYRF |
| Ga0207778_1066482 | 3300026783 | Tropical Forest Soil | TPILTSNTPNPVGVTSPFYPYYVVGDTSAARYLFLGVDQPSYRAHSVIATIEFNF |
| Ga0207736_1101361 | 3300027023 | Tropical Forest Soil | ASPFYPGFVVGDPSSARYIFLGVDQPSYHAHTVIATVEYRF |
| Ga0208827_11913602 | 3300027641 | Peatlands Soil | TPVLTSNTVNPVGSPSPFYPYFTVGDPSAARYLFLGVDQPSYHAHTVLATLEYRF |
| Ga0209009_11338401 | 3300027667 | Forest Soil | LIVSTSISPTFTPSPFYPGFVVGDTSAARYLFLGVDQPSYRVHIITATLEYRF |
| Ga0209073_104248762 | 3300027765 | Agricultural Soil | ATSSFYPYFVVGDPSAARYLFLGVDQPSYHAHTLMATLEYRF |
| Ga0209074_100351644 | 3300027787 | Agricultural Soil | FPSAFYPFFVVGDTAAARYLFLGADQPSYRAHYFSATLEIRF |
| Ga0209039_103478651 | 3300027825 | Bog Forest Soil | PSTILNSATSATPLPGAASPYYPYFVVGDPSSARYLFLGVDQPSYHVHTVMATLEYRF |
| Ga0209517_104271412 | 3300027854 | Peatlands Soil | SPFYPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF |
| Ga0209068_100342734 | 3300027894 | Watersheds | PYFMVGDPSSARYLFLGVDQPSYRAHYIAGTLEYHF |
| Ga0209068_100403315 | 3300027894 | Watersheds | SYPYFVVGDTSSARYLFLGVDQPSYHAHTIAASLEYRF |
| Ga0209006_102231733 | 3300027908 | Forest Soil | PVPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVTATLEYRF |
| Ga0209698_103246752 | 3300027911 | Watersheds | VPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| (restricted) Ga0233417_103783621 | 3300028043 | Sediment | PYFVVGDTSSARFIFLGADQPSYRVHTLSATLEIRF |
| Ga0268266_119778931 | 3300028379 | Switchgrass Rhizosphere | PYFQVGDTSAARFLFLGVDQPSYRAYYVSATLEFHF |
| Ga0222748_11056671 | 3300029701 | Soil | PGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHIVTATLEYRF |
| Ga0302293_101860451 | 3300029981 | Fen | PVPGCTSPLIGTPSPFYPFFVVGDTSAARYLFLGADQPSYRAHYLAVSLQYTF |
| Ga0075371_115341102 | 3300030974 | Soil | PFYPGFVVGDPSSARYLFLGVDQPSYHAHTVMATLEYRF |
| (restricted) Ga0255310_101296051 | 3300031197 | Sandy Soil | SPFYPYFVVGDSAAARYYFLGADQPSYRTHRIAASIQYTF |
| Ga0170820_111646091 | 3300031446 | Forest Soil | YPGFVVGDPSAARYLFLGVDQPSYHAHTVMATLEYRF |
| Ga0318516_105323462 | 3300031543 | Soil | YPSLNYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF |
| Ga0310915_104624781 | 3300031573 | Soil | CTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF |
| Ga0310915_106565191 | 3300031573 | Soil | SPNGLTQFYPYFQVGDNSAARYLFLGVDQPSYHAYYVAATLEFHF |
| Ga0307475_102187263 | 3300031754 | Hardwood Forest Soil | FYPYFQVGDTSAARYLFLGVDQPSYRAYSVSATLEFHF |
| Ga0318546_102958451 | 3300031771 | Soil | NYPGFVVGDTAAARYLFLGADQPSYRTHIFTATLEFRF |
| Ga0318557_103846851 | 3300031795 | Soil | SLNYPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF |
| Ga0307478_105256912 | 3300031823 | Hardwood Forest Soil | PVPGCTSPILNSSTSPTPLPGAASPFYPGFVVGDPSAARYLFLGVDQPSYHAHTIMVTLEYRF |
| Ga0318551_106638512 | 3300031896 | Soil | SVPGCTTPILLTNTASPAPGAASPFYPYFVVGDPSAARYLFLGTDQPSYHAHTLIATLEYRF |
| Ga0306921_109647921 | 3300031912 | Soil | QFYPYFQVGDNSAARYLFLGVDQPSYHAYYVAATLEFHF |
| Ga0310910_106944893 | 3300031946 | Soil | TNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF |
| Ga0306926_112143171 | 3300031954 | Soil | SPSLYYPGFVVGDTAAARYLFLGADQPSYRVHIISATLEYRF |
| Ga0318505_102640471 | 3300032060 | Soil | CTTPILLTNTASPAPGAASPFYPYFVVGDPSAARYLFLGTDQPSYHAHTLIATLEYRF |
| Ga0318504_101254813 | 3300032063 | Soil | SVPGCTTPILTTNTPNPVGVPSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYR |
| Ga0318553_105483882 | 3300032068 | Soil | YPGFVVGDTAAARYLFLGADQPSYRTHIITATLEFRF |
| Ga0311301_112959033 | 3300032160 | Peatlands Soil | YPYFQVGDPSAARYLFLGVDQPSYHAYYVSGTLEYHF |
| Ga0307471_1013051562 | 3300032180 | Hardwood Forest Soil | FYPYFVVGDPSAARYLFLGVDQPSYHAHTVLATLEYRF |
| Ga0307472_1005361691 | 3300032205 | Hardwood Forest Soil | YFQVGDTSAARYLFLGVDQPSYRAYSVSATVEFHF |
| Ga0307472_1022108191 | 3300032205 | Hardwood Forest Soil | STSPSPNPGSISPFYPYFVVGDPSAARYLFLGVDQPSYRAHFLSATLEYRF |
| Ga0315286_120306051 | 3300032342 | Sediment | SPTYTPNSFYPGFVVGDTSAARYLFLGADQPSYRVHALTVALEYRF |
| Ga0310812_100136351 | 3300032421 | Soil | VPGCSSVVLGTASAYYPFFVVGDPSAARYLFMGVDQPSYRAHYLAATLEYSF |
| Ga0335085_101148041 | 3300032770 | Soil | PGCTDPLIGTPSPYYPYFVVGDTSAARYLFLGADQPSYRAHYVAASLEYHF |
| Ga0335079_107804211 | 3300032783 | Soil | YYPYFVVGDTSAARYLFLGADQPSYRAHYLAASLEYHF |
| Ga0335078_105051161 | 3300032805 | Soil | DPLIGTPSPYYPYFVVGDTSAARYLFLGADQPSYRAHYLAASLEYHF |
| Ga0335072_100476381 | 3300032898 | Soil | GSVLIGTPSLYYPYSVVGDTSAARYLFLGADEPSYRAHYLAGTLEYQF |
| Ga0310914_102038963 | 3300033289 | Soil | PSPFYPGFVVGDTSAARYLFLGVDQPSYHAHTIIATLEYRF |
| Ga0310810_102001371 | 3300033412 | Soil | SPLIGTPSPFYPYFVVGDTSAARYLFMGADQPSYHAHYVAATLEYSF |
| ⦗Top⦘ |