


| Basic Information | |
|---|---|
| Family ID | F032183 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 180 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 180 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.78 % |
| % of genes near scaffold ends (potentially truncated) | 28.89 % |
| % of genes from short scaffolds (< 2000 bps) | 72.22 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.556 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (17.222 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.889 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (35.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 60.26% β-sheet: 0.00% Coil/Unstructured: 39.74% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 180 Family Scaffolds |
|---|---|---|
| PF00912 | Transgly | 10.56 |
| PF00072 | Response_reg | 8.33 |
| PF13545 | HTH_Crp_2 | 3.89 |
| PF02518 | HATPase_c | 3.33 |
| PF00210 | Ferritin | 2.78 |
| PF05532 | CsbD | 1.67 |
| PF00534 | Glycos_transf_1 | 1.67 |
| PF02954 | HTH_8 | 1.67 |
| PF01594 | AI-2E_transport | 1.67 |
| PF00990 | GGDEF | 1.67 |
| PF16864 | Dimerisation2 | 1.67 |
| PF13439 | Glyco_transf_4 | 1.11 |
| PF13185 | GAF_2 | 1.11 |
| PF13727 | CoA_binding_3 | 0.56 |
| PF04120 | Iron_permease | 0.56 |
| PF02371 | Transposase_20 | 0.56 |
| PF00872 | Transposase_mut | 0.56 |
| PF03631 | Virul_fac_BrkB | 0.56 |
| PF02915 | Rubrerythrin | 0.56 |
| PF10282 | Lactonase | 0.56 |
| PF00905 | Transpeptidase | 0.56 |
| PF09537 | DUF2383 | 0.56 |
| PF01391 | Collagen | 0.56 |
| PF13188 | PAS_8 | 0.56 |
| COG ID | Name | Functional Category | % Frequency in 180 Family Scaffolds |
|---|---|---|---|
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 10.56 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 10.56 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 10.56 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 1.67 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 1.67 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.56 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.56 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.56 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.56 % |
| Unclassified | root | N/A | 44.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_27092 | All Organisms → cellular organisms → Bacteria | 3717 | Open in IMG/M |
| 2228664021|ICCgaii200_c0675108 | Not Available | 865 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_10824610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 939 | Open in IMG/M |
| 3300000787|JGI11643J11755_11645550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1465 | Open in IMG/M |
| 3300002407|C687J29651_10281525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 525 | Open in IMG/M |
| 3300002681|Ga0005471J37259_108517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300004025|Ga0055433_10098597 | Not Available | 661 | Open in IMG/M |
| 3300004052|Ga0055490_10064869 | Not Available | 979 | Open in IMG/M |
| 3300004137|Ga0058883_1470767 | Not Available | 658 | Open in IMG/M |
| 3300004156|Ga0062589_102327006 | Not Available | 551 | Open in IMG/M |
| 3300004156|Ga0062589_102553197 | Not Available | 529 | Open in IMG/M |
| 3300004463|Ga0063356_100378039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1808 | Open in IMG/M |
| 3300004463|Ga0063356_100620538 | Not Available | 1467 | Open in IMG/M |
| 3300004463|Ga0063356_101160248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300005168|Ga0066809_10070055 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005175|Ga0066673_10530268 | Not Available | 691 | Open in IMG/M |
| 3300005183|Ga0068993_10360879 | Not Available | 533 | Open in IMG/M |
| 3300005294|Ga0065705_10109623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4689 | Open in IMG/M |
| 3300005294|Ga0065705_10710605 | Not Available | 648 | Open in IMG/M |
| 3300005295|Ga0065707_10005777 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3427 | Open in IMG/M |
| 3300005445|Ga0070708_100925912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
| 3300005446|Ga0066686_10696014 | Not Available | 686 | Open in IMG/M |
| 3300005471|Ga0070698_100718181 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300005471|Ga0070698_102020598 | Not Available | 530 | Open in IMG/M |
| 3300005526|Ga0073909_10012597 | All Organisms → cellular organisms → Bacteria | 2607 | Open in IMG/M |
| 3300005536|Ga0070697_100128473 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2124 | Open in IMG/M |
| 3300005543|Ga0070672_101125992 | Not Available | 698 | Open in IMG/M |
| 3300005836|Ga0074470_11274722 | Not Available | 701 | Open in IMG/M |
| 3300005844|Ga0068862_101077613 | Not Available | 798 | Open in IMG/M |
| 3300005886|Ga0075286_1006229 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300006049|Ga0075417_10058678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1680 | Open in IMG/M |
| 3300006844|Ga0075428_101921421 | Not Available | 614 | Open in IMG/M |
| 3300006845|Ga0075421_101925039 | Not Available | 632 | Open in IMG/M |
| 3300006845|Ga0075421_102130185 | Not Available | 594 | Open in IMG/M |
| 3300006852|Ga0075433_10300793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1420 | Open in IMG/M |
| 3300006853|Ga0075420_100848070 | Not Available | 787 | Open in IMG/M |
| 3300006854|Ga0075425_100200172 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300006876|Ga0079217_10010546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2959 | Open in IMG/M |
| 3300006903|Ga0075426_10021685 | All Organisms → cellular organisms → Bacteria | 4592 | Open in IMG/M |
| 3300006903|Ga0075426_10147292 | Not Available | 1698 | Open in IMG/M |
| 3300006914|Ga0075436_100119094 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300006914|Ga0075436_100821631 | Not Available | 693 | Open in IMG/M |
| 3300006918|Ga0079216_10115051 | Not Available | 1334 | Open in IMG/M |
| 3300006954|Ga0079219_11232123 | Not Available | 651 | Open in IMG/M |
| 3300007076|Ga0075435_101637729 | Not Available | 565 | Open in IMG/M |
| 3300009081|Ga0105098_10566648 | Not Available | 587 | Open in IMG/M |
| 3300009147|Ga0114129_10028753 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7876 | Open in IMG/M |
| 3300009147|Ga0114129_10356061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1938 | Open in IMG/M |
| 3300009147|Ga0114129_11431134 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300009162|Ga0075423_13083615 | Not Available | 510 | Open in IMG/M |
| 3300009167|Ga0113563_11926837 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009553|Ga0105249_10998124 | Not Available | 906 | Open in IMG/M |
| 3300009678|Ga0105252_10000414 | All Organisms → cellular organisms → Bacteria | 30082 | Open in IMG/M |
| 3300009678|Ga0105252_10043432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1682 | Open in IMG/M |
| 3300009805|Ga0105079_1045968 | Not Available | 510 | Open in IMG/M |
| 3300009809|Ga0105089_1089331 | Not Available | 533 | Open in IMG/M |
| 3300009818|Ga0105072_1053179 | Not Available | 773 | Open in IMG/M |
| 3300010391|Ga0136847_10046909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 687 | Open in IMG/M |
| 3300010400|Ga0134122_13010272 | Not Available | 525 | Open in IMG/M |
| 3300011120|Ga0150983_15600657 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300011432|Ga0137428_1007128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3075 | Open in IMG/M |
| 3300011433|Ga0137443_1054349 | Not Available | 1096 | Open in IMG/M |
| 3300011442|Ga0137437_1003124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 5897 | Open in IMG/M |
| 3300012040|Ga0137461_1000182 | All Organisms → cellular organisms → Bacteria | 14574 | Open in IMG/M |
| 3300012159|Ga0137344_1021928 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300012174|Ga0137338_1077788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300012202|Ga0137363_10047366 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
| 3300012205|Ga0137362_10334168 | Not Available | 1312 | Open in IMG/M |
| 3300012207|Ga0137381_11445513 | Not Available | 579 | Open in IMG/M |
| 3300012228|Ga0137459_1247785 | Not Available | 515 | Open in IMG/M |
| 3300012353|Ga0137367_10344575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1061 | Open in IMG/M |
| 3300012361|Ga0137360_10233583 | Not Available | 1503 | Open in IMG/M |
| 3300012486|Ga0157331_1016666 | Not Available | 612 | Open in IMG/M |
| 3300012532|Ga0137373_10731343 | Not Available | 736 | Open in IMG/M |
| 3300012922|Ga0137394_10292192 | Not Available | 1393 | Open in IMG/M |
| 3300012923|Ga0137359_10079670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2874 | Open in IMG/M |
| 3300012923|Ga0137359_10689863 | Not Available | 890 | Open in IMG/M |
| 3300012931|Ga0153915_10354239 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300012938|Ga0162651_100046737 | Not Available | 674 | Open in IMG/M |
| 3300012958|Ga0164299_10158495 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300014321|Ga0075353_1077750 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300014861|Ga0180061_1041068 | Not Available | 742 | Open in IMG/M |
| 3300014873|Ga0180066_1005700 | All Organisms → cellular organisms → Bacteria | 1973 | Open in IMG/M |
| 3300014883|Ga0180086_1212502 | Not Available | 500 | Open in IMG/M |
| 3300015259|Ga0180085_1172657 | Not Available | 651 | Open in IMG/M |
| 3300015371|Ga0132258_11463520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1725 | Open in IMG/M |
| 3300015371|Ga0132258_11480115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1715 | Open in IMG/M |
| 3300015371|Ga0132258_11920634 | Not Available | 1490 | Open in IMG/M |
| 3300015372|Ga0132256_100006980 | All Organisms → cellular organisms → Bacteria | 9719 | Open in IMG/M |
| 3300015372|Ga0132256_100660072 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300015372|Ga0132256_101940737 | Not Available | 696 | Open in IMG/M |
| 3300017792|Ga0163161_11521563 | Not Available | 588 | Open in IMG/M |
| 3300017930|Ga0187825_10006391 | All Organisms → cellular organisms → Bacteria | 3943 | Open in IMG/M |
| 3300017997|Ga0184610_1014404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2045 | Open in IMG/M |
| 3300017997|Ga0184610_1146196 | Not Available | 774 | Open in IMG/M |
| 3300018028|Ga0184608_10007279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3654 | Open in IMG/M |
| 3300018031|Ga0184634_10000116 | All Organisms → cellular organisms → Bacteria | 17224 | Open in IMG/M |
| 3300018052|Ga0184638_1049242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1533 | Open in IMG/M |
| 3300018052|Ga0184638_1057649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1418 | Open in IMG/M |
| 3300018053|Ga0184626_10020852 | Not Available | 2658 | Open in IMG/M |
| 3300018054|Ga0184621_10036914 | Not Available | 1587 | Open in IMG/M |
| 3300018056|Ga0184623_10044722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2014 | Open in IMG/M |
| 3300018063|Ga0184637_10075551 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300018071|Ga0184618_10003174 | All Organisms → cellular organisms → Bacteria | 4326 | Open in IMG/M |
| 3300018072|Ga0184635_10358144 | Not Available | 559 | Open in IMG/M |
| 3300018073|Ga0184624_10007042 | All Organisms → cellular organisms → Bacteria | 3746 | Open in IMG/M |
| 3300018073|Ga0184624_10133671 | Not Available | 1082 | Open in IMG/M |
| 3300018074|Ga0184640_10093854 | All Organisms → cellular organisms → Bacteria → PVC group | 1299 | Open in IMG/M |
| 3300018074|Ga0184640_10263060 | Not Available | 783 | Open in IMG/M |
| 3300018074|Ga0184640_10311485 | Not Available | 714 | Open in IMG/M |
| 3300018076|Ga0184609_10059675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1646 | Open in IMG/M |
| 3300018077|Ga0184633_10004304 | All Organisms → cellular organisms → Bacteria | 6479 | Open in IMG/M |
| 3300018077|Ga0184633_10028469 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300018077|Ga0184633_10269802 | Not Available | 872 | Open in IMG/M |
| 3300018077|Ga0184633_10613551 | Not Available | 512 | Open in IMG/M |
| 3300018078|Ga0184612_10001140 | All Organisms → cellular organisms → Bacteria | 12838 | Open in IMG/M |
| 3300018079|Ga0184627_10041421 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300018081|Ga0184625_10008579 | All Organisms → cellular organisms → Bacteria | 4666 | Open in IMG/M |
| 3300018081|Ga0184625_10089849 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300018082|Ga0184639_10048470 | Not Available | 2191 | Open in IMG/M |
| 3300018082|Ga0184639_10499909 | Not Available | 613 | Open in IMG/M |
| 3300018084|Ga0184629_10026202 | All Organisms → cellular organisms → Bacteria | 2476 | Open in IMG/M |
| 3300018084|Ga0184629_10032636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2265 | Open in IMG/M |
| 3300018084|Ga0184629_10105440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1384 | Open in IMG/M |
| 3300018422|Ga0190265_10156946 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2234 | Open in IMG/M |
| 3300018422|Ga0190265_12488200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 617 | Open in IMG/M |
| 3300019263|Ga0184647_1120901 | Not Available | 685 | Open in IMG/M |
| 3300019789|Ga0137408_1366524 | Not Available | 987 | Open in IMG/M |
| 3300019879|Ga0193723_1037090 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300019881|Ga0193707_1001449 | All Organisms → cellular organisms → Bacteria | 8637 | Open in IMG/M |
| 3300019886|Ga0193727_1082333 | Not Available | 975 | Open in IMG/M |
| 3300020003|Ga0193739_1005884 | Not Available | 3312 | Open in IMG/M |
| 3300020018|Ga0193721_1016279 | Not Available | 1956 | Open in IMG/M |
| 3300020063|Ga0180118_1085645 | Not Available | 718 | Open in IMG/M |
| 3300020583|Ga0210401_10927228 | Not Available | 730 | Open in IMG/M |
| 3300021081|Ga0210379_10040757 | All Organisms → cellular organisms → Bacteria | 1825 | Open in IMG/M |
| 3300021090|Ga0210377_10074512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2306 | Open in IMG/M |
| 3300021344|Ga0193719_10021284 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300022756|Ga0222622_10502121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 867 | Open in IMG/M |
| 3300022756|Ga0222622_11342154 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300024241|Ga0233392_1006730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1024 | Open in IMG/M |
| 3300025324|Ga0209640_10019282 | All Organisms → cellular organisms → Bacteria | 5953 | Open in IMG/M |
| 3300025905|Ga0207685_10740738 | Not Available | 538 | Open in IMG/M |
| 3300025910|Ga0207684_11544583 | Not Available | 539 | Open in IMG/M |
| 3300025917|Ga0207660_11112736 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300025939|Ga0207665_10081831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2224 | Open in IMG/M |
| 3300025949|Ga0207667_11164045 | Not Available | 752 | Open in IMG/M |
| 3300026014|Ga0208776_1018202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300026535|Ga0256867_10011811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3817 | Open in IMG/M |
| 3300027027|Ga0209844_1021757 | Not Available | 511 | Open in IMG/M |
| 3300027364|Ga0209967_1002856 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
| 3300027552|Ga0209982_1031588 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300027573|Ga0208454_1000332 | All Organisms → cellular organisms → Bacteria | 30073 | Open in IMG/M |
| 3300027637|Ga0209818_1037427 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300027682|Ga0209971_1007651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2565 | Open in IMG/M |
| 3300027722|Ga0209819_10003643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4886 | Open in IMG/M |
| 3300027873|Ga0209814_10065845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1519 | Open in IMG/M |
| 3300028047|Ga0209526_10084648 | All Organisms → cellular organisms → Bacteria | 2233 | Open in IMG/M |
| 3300028145|Ga0247663_1004663 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300028380|Ga0268265_11764546 | Not Available | 625 | Open in IMG/M |
| 3300028381|Ga0268264_12072206 | Not Available | 578 | Open in IMG/M |
| 3300028814|Ga0307302_10443087 | Not Available | 643 | Open in IMG/M |
| 3300030006|Ga0299907_10086395 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300030006|Ga0299907_10498123 | Not Available | 964 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10020127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1716 | Open in IMG/M |
| 3300031720|Ga0307469_10790644 | Not Available | 869 | Open in IMG/M |
| 3300031720|Ga0307469_11635966 | Not Available | 619 | Open in IMG/M |
| 3300031720|Ga0307469_12407691 | Not Available | 514 | Open in IMG/M |
| 3300031740|Ga0307468_100662319 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031965|Ga0326597_10008087 | All Organisms → cellular organisms → Bacteria | 14234 | Open in IMG/M |
| 3300031965|Ga0326597_10019158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8871 | Open in IMG/M |
| 3300032770|Ga0335085_11092549 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300033417|Ga0214471_10296837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1315 | Open in IMG/M |
| 3300033480|Ga0316620_10162162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1812 | Open in IMG/M |
| 3300033513|Ga0316628_101036757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1089 | Open in IMG/M |
| 3300033513|Ga0316628_101950226 | Not Available | 780 | Open in IMG/M |
| 3300034115|Ga0364945_0002244 | All Organisms → cellular organisms → Bacteria | 5319 | Open in IMG/M |
| 3300034150|Ga0364933_182842 | Not Available | 548 | Open in IMG/M |
| 3300034178|Ga0364934_0063112 | Not Available | 1376 | Open in IMG/M |
| 3300034643|Ga0370545_034861 | Not Available | 922 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 17.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.44% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.44% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.89% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 3.33% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.22% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.22% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.22% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.22% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.22% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.22% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.67% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.67% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.11% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.11% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.11% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.56% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.56% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.56% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.56% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.56% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.56% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.56% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300002407 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 | Environmental | Open in IMG/M |
| 3300002681 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF120 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004137 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012159 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012486 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.120510 | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024241 | Subsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_50_July_PB | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027027 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| 3300034643 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_00052600 | 2199352025 | Soil | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP |
| ICCgaii200_06751082 | 2228664021 | Soil | MLATLLIVVMILLQTGALSLGIMVGRRIITAKASVSRRWFY |
| ICChiseqgaiiFebDRAFT_108246102 | 3300000363 | Soil | MLATILIVVMILLQTGAFSLGLMFDLRFITAKARLIRKSAH* |
| JGI11643J11755_116455502 | 3300000787 | Soil | MLATLLIVVMILLQTGALSLGIMVGRRIITAKASVSRRWFY* |
| C687J29651_102815251 | 3300002407 | Soil | IAVMILLQTGALSLGLMVGRRFITAAASLNRKSALLNKHNRERP* |
| Ga0005471J37259_1085171 | 3300002681 | Forest Soil | RRDMLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP* |
| Ga0055433_100985972 | 3300004025 | Natural And Restored Wetlands | MLATILIVIMILLQTGALSLGLMVGRRVITAAVGSNRKSAQNNR* |
| Ga0055490_100648692 | 3300004052 | Natural And Restored Wetlands | VFATILIVVMIFLQTGALSLGVALARRFLTAAAGSKGKSTLLNGVNN |
| Ga0058883_14707671 | 3300004137 | Forest Soil | ILLQTGALSLGLVVGPSFITEAARLNRKSALLNKHNRERP* |
| Ga0062589_1023270061 | 3300004156 | Soil | IYMLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP* |
| Ga0062589_1025531972 | 3300004156 | Soil | MLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSSAHSTIHKRER |
| Ga0063356_1003780391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLATLLIVVMILLQTGALSLGLMVDRRFISAAVSLNRKLTH* |
| Ga0063356_1006205383 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP* |
| Ga0063356_1011602482 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLATFLIVVMILLQTGALSLGLMVDRRSIAAAVSLNRKLAAQKK* |
| Ga0066809_100700552 | 3300005168 | Soil | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP* |
| Ga0066673_105302681 | 3300005175 | Soil | MLATILVVVMILLQTGALSLGLMVDRRFITAAVRLNRKSAH* |
| Ga0068993_103608792 | 3300005183 | Natural And Restored Wetlands | MLATILIVIMILLQAGVLSLGLMVGRRVITAAAGSNRKSAHKQ* |
| Ga0065705_101096234 | 3300005294 | Switchgrass Rhizosphere | MLATLLIVVMILLQTGALSLGLMVDLRLIVAAVSLNRKLAA* |
| Ga0065705_107106051 | 3300005294 | Switchgrass Rhizosphere | MLATLLIVVMILLQTGALSLGLMVDRRLIVAAMSLNRKLAR* |
| Ga0065707_100057773 | 3300005295 | Switchgrass Rhizosphere | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERH* |
| Ga0070708_1009259121 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIVVMILLQTGALSLGLLVGRRFIAAAVSLNRKSAHSTIHNRE |
| Ga0066686_106960142 | 3300005446 | Soil | MPATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP* |
| Ga0070698_1007181812 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIVVMILLQTGALSLGLMVGRRFITAAASLNRKSAH* |
| Ga0070698_1020205982 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP* |
| Ga0073909_100125973 | 3300005526 | Surface Soil | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP* |
| Ga0070697_1001284732 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIVVMILLQTGVFSLGLMVGRRFITEAARLNRKSALLNKHNRERS* |
| Ga0070672_1011259921 | 3300005543 | Miscanthus Rhizosphere | MLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNKRIRERP* |
| Ga0074470_112747221 | 3300005836 | Sediment (Intertidal) | MRAATLIVVMIFLQTGLLSLGLLLGRRFITVAASFKYKWLI* |
| Ga0068862_1010776132 | 3300005844 | Switchgrass Rhizosphere | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKLALLNKRIRERP* |
| Ga0075286_10062293 | 3300005886 | Rice Paddy Soil | MLATILIVFMILLQTGALSLGLMVDRRFITAKARLIRKSAH* |
| Ga0075417_100586783 | 3300006049 | Populus Rhizosphere | MRATILIVVMILLQTGVLSLGLMVGRTFITEAESVKRKSALLNKHNRERP* |
| Ga0075428_1019214212 | 3300006844 | Populus Rhizosphere | MLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKSALLNKRIRERP* |
| Ga0075421_1019250391 | 3300006845 | Populus Rhizosphere | MLAAILIVVMILLQTGVLSLGLMIDRRFITAKTSLARKAALLQKHDRERP* |
| Ga0075421_1021301851 | 3300006845 | Populus Rhizosphere | ATIFVVMILLQTGALLLSFMIDRRLITAVVRLKCKSAYSTKRKWERP* |
| Ga0075433_103007931 | 3300006852 | Populus Rhizosphere | MLATILIVVMILLQTGVFSLGLMLGRQFITEAVRLNRKSALLNKHNWERP* |
| Ga0075420_1008480701 | 3300006853 | Populus Rhizosphere | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHS |
| Ga0075425_1002001721 | 3300006854 | Populus Rhizosphere | MLATILIVFMILLQTGALSLGLMMDRRFITPAAGSKRKSSHSTIT* |
| Ga0079217_100105464 | 3300006876 | Agricultural Soil | LIVVMILLQTGALSLGLMVDRRFIIAKASLTGKSL* |
| Ga0075426_100216856 | 3300006903 | Populus Rhizosphere | MLATILIIVMILLQTGALALGLKVDRRFITAAVSLTRQSA |
| Ga0075426_101472921 | 3300006903 | Populus Rhizosphere | GVLSLGLMVGCRFIAEAASFNRKSALLNKHNRERP* |
| Ga0075436_1001190942 | 3300006914 | Populus Rhizosphere | MLATILIIVMILLQTGALALGLKVDRRFITAAVSLTRQSAH* |
| Ga0075436_1008216312 | 3300006914 | Populus Rhizosphere | MLAFILIVAMILLQTGVLSLGLMVGRRFIAEAASFNRKSALLNKHNRERP* |
| Ga0079216_101150512 | 3300006918 | Agricultural Soil | MLATILIVVMILLQTGALSLGLMVDRRFIIAKASLTRKSL* |
| Ga0079219_112321232 | 3300006954 | Agricultural Soil | MLASILIVFMILLQTGALSFGLMIDRRFITPAAGSKRKSSHSN |
| Ga0075435_1016377292 | 3300007076 | Populus Rhizosphere | MLATILIVVMILLQTGVFSLGLMLGRQFITEAVRLNRKSALLNKHNRERP* |
| Ga0105098_105666481 | 3300009081 | Freshwater Sediment | MLATILIVVMILLQTGALSLGLMVGRRFVTAAASFNRKSALNNT* |
| Ga0114129_100287536 | 3300009147 | Populus Rhizosphere | MRATILIVVMILLQTGALSLGLMVGRRFITEAASLKRKSALLNKHNQERP* |
| Ga0114129_103560612 | 3300009147 | Populus Rhizosphere | MRATILIVVMISLQTGALSLGLIVGRRFITEAASLNRKPAPRNKQRP* |
| Ga0114129_114311341 | 3300009147 | Populus Rhizosphere | ATILIVVMILLQTGALSLGLMVGPRFITEAASLNRKSALPNKHNRQRP* |
| Ga0075423_130836151 | 3300009162 | Populus Rhizosphere | MLATILIVFMILLQTGALSLGLMMDRRFITPAAGSK |
| Ga0113563_119268371 | 3300009167 | Freshwater Wetlands | MLATILIVVMILLQTGVLSLGLMVGHRFITEAAGSNRKSAHSTTHNRERH* |
| Ga0105249_109981241 | 3300009553 | Switchgrass Rhizosphere | MLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSARSTIHKREWR* |
| Ga0105252_100004145 | 3300009678 | Soil | MLATILIFVMILLQTGALSLGLMIGHGFITAAVGSNRKFTLLNSVYNRERR* |
| Ga0105252_100434323 | 3300009678 | Soil | MLATILIVVMILLQTGAMQLGLMVGRRFFTAAASSNGRSILLNSVYNRERC* |
| Ga0105079_10459681 | 3300009805 | Groundwater Sand | MLATILFAVMILLQTGALSLGLTVGRRFITAAAGSNGKYSRPNSVYHRERH* |
| Ga0105089_10893312 | 3300009809 | Groundwater Sand | MLATILIAAMILLQTGALSLGLMVGRRFITAAASLNLKSALLNKHNRE |
| Ga0105072_10531791 | 3300009818 | Groundwater Sand | MRATILIVVMILLQTGVLSLGLMVGRRFITEAASLNRKSALLN |
| Ga0136847_100469091 | 3300010391 | Freshwater Sediment | MLATILIFVMILLQTGALSLGLMVGRRFITAAAGSNRKSTLLNIVYNRERR* |
| Ga0134122_130102722 | 3300010400 | Terrestrial Soil | MLATFLIVVMILLQTGALSLALMVDRRFMTAAVNRKLAAQ |
| Ga0150983_156006571 | 3300011120 | Forest Soil | QRRDMLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP* |
| Ga0137428_10071282 | 3300011432 | Soil | MRATLLIVVMILLQTGVLSLGLMVGRRFYSRAASVNRKSALFNKHNPQRR* |
| Ga0137443_10543491 | 3300011433 | Soil | MLATILIVVMILLQTGALSLSLMVDRRFIIAAVSSKRKSVHSTIDNRERP* |
| Ga0137437_10031245 | 3300011442 | Soil | MLATILIFVMILLQTGALSLGLIIGRTIINAVAGSNRKSILLNSVYNRERP* |
| Ga0137461_10001823 | 3300012040 | Soil | MLSTILIVVMILLQTGALSLGLRVRRKFIPAAASLNRKSALLNKRNRDRP* |
| Ga0137344_10219282 | 3300012159 | Soil | MLATILIVVMILLQTGALSFGLMVDRRFIAAAASLNRKSAHSTIHNRERP* |
| Ga0137338_10777881 | 3300012174 | Soil | MLATILIAVMILLQTGALSLGLMVGGRFIIAAASLNRK |
| Ga0137363_100473664 | 3300012202 | Vadose Zone Soil | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAQRP* |
| Ga0137362_103341684 | 3300012205 | Vadose Zone Soil | LATILIVVMILLQTGALSLGLMVDRRFITARRRA* |
| Ga0137381_114455131 | 3300012207 | Vadose Zone Soil | ATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP* |
| Ga0137459_12477852 | 3300012228 | Soil | MLATILIVVMILLQTGALSLSLMVDRRFIIAAVSSKRKSVHSTIDNRE |
| Ga0137367_103445752 | 3300012353 | Vadose Zone Soil | MRATILIVVMILLQTGALSLGFMVGRRFITEAASVKRKSALFNKHNRE |
| Ga0137360_102335833 | 3300012361 | Vadose Zone Soil | MLATILIVVMILLQTGALSLGLMVDRRFITAATSLNRKSAHSTIHNRERP* |
| Ga0157331_10166661 | 3300012486 | Soil | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNK |
| Ga0137373_107313432 | 3300012532 | Vadose Zone Soil | MRATILIVVMILLQTGALSLGFMVGRRFINEAASVKRKSALFNKHNRERP* |
| Ga0137394_102921924 | 3300012922 | Vadose Zone Soil | LVVVMILLQTGALSLGLMVDRRFITAAARLNRKSAH* |
| Ga0137359_100796701 | 3300012923 | Vadose Zone Soil | MLATILIVAMILLQTGALSLGLMVDRRFITAAARLNRKSAH* |
| Ga0137359_106898631 | 3300012923 | Vadose Zone Soil | MILLQTGALSLGLMVDRRFITAAASLNRKSAQRP* |
| Ga0153915_103542393 | 3300012931 | Freshwater Wetlands | MLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP* |
| Ga0162651_1000467372 | 3300012938 | Soil | MLATILIIVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP* |
| Ga0164299_101584951 | 3300012958 | Soil | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRER |
| Ga0075353_10777501 | 3300014321 | Natural And Restored Wetlands | MLATILIVVMISLQSGALSLGLMVDRRLITAAASLNRKSALLNKHNRARP* |
| Ga0180061_10410682 | 3300014861 | Soil | MRATLLIVVMILLQTGVLSLGLMVGRRFYSRAASVNRKSALFN |
| Ga0180066_10057003 | 3300014873 | Soil | MLATILIAVMILLQTGALSLGLMVGRRFITAAASLNRKSAL |
| Ga0180086_12125021 | 3300014883 | Soil | MLATILVVVMILLQTGALSLGLMVDRRFITSAFSFNRKSTRWREV* |
| Ga0180085_11726571 | 3300015259 | Soil | MLATILIAVMILLQTGALSLGRMVRRRFITAAASLNRKSALLNKHIR |
| Ga0132258_114635203 | 3300015371 | Arabidopsis Rhizosphere | MLATILIIVMILLQTGALSLGLMAGPRFAAAASLKRKSTLLNKAMRERP* |
| Ga0132258_114801154 | 3300015371 | Arabidopsis Rhizosphere | MLATILIAVMIPLQTGVLSLGLMVGRRFITEAARSNRKPAHSTIRNRERP |
| Ga0132258_119206343 | 3300015371 | Arabidopsis Rhizosphere | MLATILIVVMILLQTGALSLSFMIDRRFITAAVSAKRKSARSTIHKREWR* |
| Ga0132256_10000698014 | 3300015372 | Arabidopsis Rhizosphere | MLATTLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHS |
| Ga0132256_1006600721 | 3300015372 | Arabidopsis Rhizosphere | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSA |
| Ga0132256_1019407371 | 3300015372 | Arabidopsis Rhizosphere | SYMLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP* |
| Ga0163161_115215633 | 3300017792 | Switchgrass Rhizosphere | MLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNKRIRERP |
| Ga0187825_100063913 | 3300017930 | Freshwater Sediment | MLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP |
| Ga0184610_10144041 | 3300017997 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP |
| Ga0184610_11461963 | 3300017997 | Groundwater Sediment | VLATILIVVMILLQAGALSLGLMIGRRFITAAVSSNRKSAR |
| Ga0184608_100072793 | 3300018028 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALLNRHNRERP |
| Ga0184634_100001161 | 3300018031 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVGRRFITAAASLNRKSAH |
| Ga0184638_10492422 | 3300018052 | Groundwater Sediment | MLATILIVVMILLQTGALSFGLMVDRRFIAAAASLNRKSAHSTIHNRERP |
| Ga0184638_10576493 | 3300018052 | Groundwater Sediment | MLAIILIVVMILLQTGALSLGLMVGRRIITAAASLNRKSAH |
| Ga0184626_100208523 | 3300018053 | Groundwater Sediment | MSLQESDMRATILIIVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH |
| Ga0184621_100369142 | 3300018054 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRLITAAASLNRKSAHST |
| Ga0184623_100447222 | 3300018056 | Groundwater Sediment | MSLQGSDMLATILIVVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH |
| Ga0184637_100755513 | 3300018063 | Groundwater Sediment | MLATILILAMILLHTGALSLGLMVGPRFITGAARWNRKSALLNKHNRERP |
| Ga0184618_100031746 | 3300018071 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITGAASLKRKSAVLNRHNRERP |
| Ga0184635_103581441 | 3300018072 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHNRERP |
| Ga0184624_100070425 | 3300018073 | Groundwater Sediment | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERS |
| Ga0184624_101336713 | 3300018073 | Groundwater Sediment | MLATVLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP |
| Ga0184640_100938541 | 3300018074 | Groundwater Sediment | MLATILIVVMILQQTGALSLGLMVSLRFITAAAGSNRNSTLLNRVYNRERR |
| Ga0184640_102630602 | 3300018074 | Groundwater Sediment | MLATILIIVMMLLQTGALSLGLMAIPRFAAAASLKRKSPLLNKRIRERP |
| Ga0184640_103114851 | 3300018074 | Groundwater Sediment | LQTGALSLGLMVGRRFITVAAGSNRKSTVLNSVCNRERR |
| Ga0184609_100596753 | 3300018076 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLKRKSALLNRHNRERP |
| Ga0184633_100043043 | 3300018077 | Groundwater Sediment | MLATILIAVMILLQTGALSLGLMVGRRFISAAASLNRKSALLNKHNRERP |
| Ga0184633_100284691 | 3300018077 | Groundwater Sediment | MLATILIVVMILLQTRALSLGLMVGRRFITAAASLNRKSAH |
| Ga0184633_102698023 | 3300018077 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVGLRFIPSAAGSNRKLVLLN |
| Ga0184633_106135511 | 3300018077 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVGRRFITAAATLNRKSAH |
| Ga0184612_100011406 | 3300018078 | Groundwater Sediment | MRATILIIVMILLQAGALSLGLMIGRRFITAAVSSNRKSAH |
| Ga0184627_100414213 | 3300018079 | Groundwater Sediment | MLATILIFVMILLQTGALSLSLTVGRRFIAAAAGTNRKSTLLNSVYNREQR |
| Ga0184625_100085793 | 3300018081 | Groundwater Sediment | MLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKSALLNKRIRERP |
| Ga0184625_100898493 | 3300018081 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERS |
| Ga0184639_100484703 | 3300018082 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVGLRFIPSAAGSNRKLVLLNKHNRELR |
| Ga0184639_104999091 | 3300018082 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVGRRFITAAATLNRKSA |
| Ga0184629_100262023 | 3300018084 | Groundwater Sediment | MLATILIVVMILLQTGAMQLGLMVGRRFFTAAASSNGRSILLNSVYNRERC |
| Ga0184629_100326362 | 3300018084 | Groundwater Sediment | MLATILIAVMILLQTGALALGLMVGRRFITAAASLNRKSALLNKANRERP |
| Ga0184629_101054402 | 3300018084 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLTIGRRFIAAAASLNRKSALLNKHNRGRP |
| Ga0190265_101569463 | 3300018422 | Soil | MLATILIVVMILLQTGALSLVLMVDRRLITSAVSFNRKSTH |
| Ga0190265_124882001 | 3300018422 | Soil | MLVTILIVVMILLQTGALSLGLMVDRRFITAALSLNRKSAH |
| Ga0184647_11209012 | 3300019263 | Groundwater Sediment | MLATILIVAMILLQTGALSLSFMIDRRFITAAVSSKRKSARSTIHKREWR |
| Ga0137408_13665242 | 3300019789 | Vadose Zone Soil | MRATILIVVMILLQTGVLSLGLMVGRRFITEAASVKRKSSLLKKHNRERP |
| Ga0193723_10370903 | 3300019879 | Soil | MLATILIIVMILLQTGALSLGLMAAPLFAAAASLKRKSALLNKPMRERP |
| Ga0193707_10014493 | 3300019881 | Soil | MLATILIVAMILLQTGALSLGLMVDRRFITGAVSLNRKSAH |
| Ga0193727_10823332 | 3300019886 | Soil | MLATILIIVMILLKTGALSLGLMAIPRFAAAASLKRKSALLNKRIRERP |
| Ga0193739_10058842 | 3300020003 | Soil | MLATILIVVMILLQTGVLSLGLMVGRRFITAAASLNRKSAH |
| Ga0193721_10162791 | 3300020018 | Soil | TILIVVMILLQTGALSLGLMVDRRFITGAVSLNRKSAH |
| Ga0180118_10856453 | 3300020063 | Groundwater Sediment | ILLQTGALSLGLMVGRRFITAAASLNRKSALLNKHNRERP |
| Ga0210401_109272282 | 3300020583 | Soil | MLATILIVVMILLQTGALSLGLVVGRRFITEAARLNRKSALLNKHNRERP |
| Ga0210379_100407572 | 3300021081 | Groundwater Sediment | MLATILIFVMILLQTGALSLGLMVGRTFINAVAGSNRKSILLNSVYNRERP |
| Ga0210377_100745123 | 3300021090 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRLITAAVSLNRKSAH |
| Ga0193719_100212843 | 3300021344 | Soil | LATILVVVMILLQTGALSLGLMVDRRFITAAASLNRKSAH |
| Ga0222622_105021211 | 3300022756 | Groundwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHN |
| Ga0222622_113421542 | 3300022756 | Groundwater Sediment | YACTTVLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSTHSTIHNRERP |
| Ga0233392_10067301 | 3300024241 | Deep Subsurface Sediment | QTGALSLGLMVGRRFITEAVSLNRKSALLNRLNRERP |
| Ga0209640_100192826 | 3300025324 | Soil | MLATILIVVMILQQTGALSLGLMVGRRFITAVAGSNGKSTLLNSVYNRERRQRRRAR |
| Ga0207685_107407382 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKS |
| Ga0207684_115445831 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIVVMILLQTGALSLGLAVGPRFITEAARLNRKSALLNKHNRERP |
| Ga0207660_111127362 | 3300025917 | Corn Rhizosphere | MLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSHSNNP |
| Ga0207665_100818311 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MLATILIVVMILLQTGVFSLGLMVGRRFITEAARLNRKSALLNKHNRERS |
| Ga0207667_111640451 | 3300025949 | Corn Rhizosphere | MLASILIVFMILLQTGALSFGLMMDRRFITPAAGSKRKSSH |
| Ga0208776_10182022 | 3300026014 | Rice Paddy Soil | MLATILIVFMILLQTGALSLGLMVDRRFITTKARLIRKSAH |
| Ga0256867_100118116 | 3300026535 | Soil | MLAIILIVAMILLQTGALSLGLMVGRRFITAVVSLNRKSPR |
| Ga0209844_10217571 | 3300027027 | Groundwater Sand | MLATILFAVMILLQTGALSLGLTVGRRFITAAAGSNGKYSRPNSVYHRERH |
| Ga0209967_10028562 | 3300027364 | Arabidopsis Thaliana Rhizosphere | MLATILIVVMILLQTGAFSLGLMFDLRFITAKARLIRKSAH |
| Ga0209982_10315882 | 3300027552 | Arabidopsis Thaliana Rhizosphere | LIVAMILLQTGALSLGLMVDRRFFTAKARLNRKSAH |
| Ga0208454_10003325 | 3300027573 | Soil | MLATILIFVMILLQTGALSLGLMIGHGFITAAVGSNRKFTLLNSVYNRERR |
| Ga0209818_10374272 | 3300027637 | Agricultural Soil | LIVVMILLQTGALSLGLMVDRRFIIAKASLTGKSL |
| Ga0209971_10076511 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MLATILIVAMILLQTGALSLGLMVDRRFFTAKARLNRKSAH |
| Ga0209819_100036436 | 3300027722 | Freshwater Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSALNNT |
| Ga0209814_100658453 | 3300027873 | Populus Rhizosphere | MRATILIVVMILLQTGVLSLGLMVGRTFITEAESVKRKSALLNKHNRERP |
| Ga0209526_100846483 | 3300028047 | Forest Soil | MLATILIVVMILLQTGALSLGLVVGPRFITEAARLNR |
| Ga0247663_10046632 | 3300028145 | Soil | MLVTIMIVAMILLQTGALSLGFLVDRRFFAAAAGTKRKSALSTIGNREQA |
| Ga0268265_117645461 | 3300028380 | Switchgrass Rhizosphere | MLATILIIVMILLQTGALSLGLMAIPRFAAAASLKRKLALLNKRIRERP |
| Ga0268264_120722062 | 3300028381 | Switchgrass Rhizosphere | MLATILIIVMILLQTGAFSLGLMAIPRFAAAASLKRKLALLNK |
| Ga0307302_104430871 | 3300028814 | Soil | IVVMILLQTGALSLGLMVDRRFITAAASLNRKSAHSTIHNRERP |
| Ga0299907_100863953 | 3300030006 | Soil | MLATILIVGMILLHTGALSLGLMAGRRLITAAASLSPKQRDNSCL |
| Ga0299907_104981231 | 3300030006 | Soil | MLAIILIVAMILLQTGALSLGLMIGRRFITAVVSLNRKSPR |
| (restricted) Ga0255310_100201273 | 3300031197 | Sandy Soil | MLATLLIVVMILLQTGALSLGLMVDRRFIDAATSLIRKLTH |
| Ga0307469_107906442 | 3300031720 | Hardwood Forest Soil | MLATILIVVMILLQTGVFSLGLAVGPRFITEAARLNRKSALLNKHNRERP |
| Ga0307469_116359661 | 3300031720 | Hardwood Forest Soil | MLATILIVVMILLQTGVFSLGLMLGRRFITEAVRLNRKSALFNKHSRERP |
| Ga0307469_124076911 | 3300031720 | Hardwood Forest Soil | VVMILLQTGVLSLGLMVGRRFITEAASVKRKSALLKKHNRERP |
| Ga0307468_1006623192 | 3300031740 | Hardwood Forest Soil | MLATILIVVMILLQTGALSLGLMLGRRFITEAVRLNRKSALFNKHSRERP |
| Ga0326597_100080871 | 3300031965 | Soil | MLATILITVMILPQTGALSLGLMVGRRFITAAATLNRKSALLNKHIRERP |
| Ga0326597_100191581 | 3300031965 | Soil | MLATILIAVMILLQTGALSLGLMVGRRFITSAASLNRKSALLNKHNRERL |
| Ga0335085_110925491 | 3300032770 | Soil | MLATILIVVMILLQTGALSLGLMVGRRFITEAASLKRESALLNKHNPERP |
| Ga0214471_102968373 | 3300033417 | Soil | MRTTILIAVMILLQTGALSLGLMTGHRLFTAALGWNRKSVH |
| Ga0316620_101621621 | 3300033480 | Soil | MLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLKHKSALLKKHNQERP |
| Ga0316628_1010367573 | 3300033513 | Soil | QTGAWSLGLMADRRLITAAVSLIHKSALLNKHNQERP |
| Ga0316628_1019502261 | 3300033513 | Soil | MLAIILIVLTILLQTGAWSLGLMADRRLITAAVSLNHKSALLNKHNQERP |
| Ga0364945_0002244_801_953 | 3300034115 | Sediment | MLATILIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP |
| Ga0364933_182842_160_309 | 3300034150 | Sediment | MLATILIIVMILLQTGALSLGLMAITRFAAAASLKRKSALLNKRIRERP |
| Ga0364934_0063112_593_757 | 3300034178 | Sediment | VLATILIVVMILLQTSALSLGLMVGGKFITAAASSNRKSTLLNSVNNQERAKGG |
| Ga0370545_034861_13_165 | 3300034643 | Soil | MLATSLIVVMILLQTGALSLGLMVDRRFITAAASLNRKSVHSTIHNRERP |
| ⦗Top⦘ |