


| Basic Information | |
|---|---|
| Family ID | F032045 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MAKYNKEAVDKAIKKDPKIKGKEAKLIHRLLKGRS |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.56 % |
| % of genes near scaffold ends (potentially truncated) | 19.34 % |
| % of genes from short scaffolds (< 2000 bps) | 66.85 % |
| Associated GOLD sequencing projects | 125 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.514 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (19.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.746 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.320 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 2.76 |
| PF00239 | Resolvase | 2.76 |
| PF13328 | HD_4 | 2.21 |
| PF06941 | NT5C | 1.66 |
| PF13578 | Methyltransf_24 | 1.66 |
| PF01041 | DegT_DnrJ_EryC1 | 1.66 |
| PF01541 | GIY-YIG | 1.10 |
| PF06945 | DUF1289 | 1.10 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.10 |
| PF07486 | Hydrolase_2 | 1.10 |
| PF00959 | Phage_lysozyme | 1.10 |
| PF01764 | Lipase_3 | 1.10 |
| PF11753 | DUF3310 | 1.10 |
| PF00565 | SNase | 1.10 |
| PF02562 | PhoH | 0.55 |
| PF13489 | Methyltransf_23 | 0.55 |
| PF00583 | Acetyltransf_1 | 0.55 |
| PF13472 | Lipase_GDSL_2 | 0.55 |
| PF11171 | DUF2958 | 0.55 |
| PF10902 | WYL_2 | 0.55 |
| PF06414 | Zeta_toxin | 0.55 |
| PF00676 | E1_dh | 0.55 |
| PF13155 | Toprim_2 | 0.55 |
| PF04480 | DUF559 | 0.55 |
| PF03819 | MazG | 0.55 |
| PF13058 | DUF3920 | 0.55 |
| PF06035 | Peptidase_C93 | 0.55 |
| PF12684 | DUF3799 | 0.55 |
| PF00551 | Formyl_trans_N | 0.55 |
| PF10263 | SprT-like | 0.55 |
| PF08804 | gp32 | 0.55 |
| PF00476 | DNA_pol_A | 0.55 |
| PF03407 | Nucleotid_trans | 0.55 |
| PF05118 | Asp_Arg_Hydrox | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.76 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 2.76 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 1.66 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 1.66 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 1.66 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 1.66 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 1.66 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 1.66 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 1.66 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 1.10 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.10 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.55 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.55 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.55 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.55 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.55 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.49 % |
| Unclassified | root | N/A | 47.51 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10005295 | Not Available | 9108 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10006475 | All Organisms → cellular organisms → Bacteria | 6665 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10001907 | Not Available | 12444 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10000009 | Not Available | 91491 | Open in IMG/M |
| 3300001450|JGI24006J15134_10011794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 4264 | Open in IMG/M |
| 3300001450|JGI24006J15134_10208632 | Not Available | 589 | Open in IMG/M |
| 3300001460|JGI24003J15210_10001853 | All Organisms → cellular organisms → Bacteria | 9285 | Open in IMG/M |
| 3300001472|JGI24004J15324_10064972 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300001472|JGI24004J15324_10164392 | Not Available | 500 | Open in IMG/M |
| 3300001589|JGI24005J15628_10004738 | Not Available | 6723 | Open in IMG/M |
| 3300002511|JGI25131J35506_1006510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 1642 | Open in IMG/M |
| 3300004097|Ga0055584_100047520 | All Organisms → Viruses → Predicted Viral | 4233 | Open in IMG/M |
| 3300004097|Ga0055584_100296217 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300004448|Ga0065861_1106697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300005512|Ga0074648_1188450 | Not Available | 585 | Open in IMG/M |
| 3300006013|Ga0066382_10238299 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006025|Ga0075474_10007396 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4328 | Open in IMG/M |
| 3300006025|Ga0075474_10016905 | All Organisms → Viruses → Predicted Viral | 2692 | Open in IMG/M |
| 3300006025|Ga0075474_10019264 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
| 3300006025|Ga0075474_10042471 | Not Available | 1560 | Open in IMG/M |
| 3300006025|Ga0075474_10078964 | Not Available | 1080 | Open in IMG/M |
| 3300006026|Ga0075478_10010058 | All Organisms → Viruses → Predicted Viral | 3226 | Open in IMG/M |
| 3300006026|Ga0075478_10055943 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300006026|Ga0075478_10116993 | Not Available | 844 | Open in IMG/M |
| 3300006027|Ga0075462_10092188 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 944 | Open in IMG/M |
| 3300006029|Ga0075466_1097558 | Not Available | 800 | Open in IMG/M |
| 3300006164|Ga0075441_10058172 | All Organisms → Viruses → Predicted Viral | 1522 | Open in IMG/M |
| 3300006164|Ga0075441_10097619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Maricaulales → Robiginitomaculaceae → Robiginitomaculum → unclassified Robiginitomaculum → Robiginitomaculum sp. | 1129 | Open in IMG/M |
| 3300006637|Ga0075461_10161528 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 683 | Open in IMG/M |
| 3300006637|Ga0075461_10184147 | Not Available | 629 | Open in IMG/M |
| 3300006754|Ga0098044_1032691 | All Organisms → Viruses → Predicted Viral | 2278 | Open in IMG/M |
| 3300006802|Ga0070749_10248515 | Not Available | 1008 | Open in IMG/M |
| 3300006802|Ga0070749_10529252 | Not Available | 640 | Open in IMG/M |
| 3300006803|Ga0075467_10056987 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2415 | Open in IMG/M |
| 3300006867|Ga0075476_10049545 | Not Available | 1703 | Open in IMG/M |
| 3300006919|Ga0070746_10435308 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 584 | Open in IMG/M |
| 3300006920|Ga0070748_1022570 | All Organisms → Viruses → Predicted Viral | 2626 | Open in IMG/M |
| 3300006920|Ga0070748_1050068 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1662 | Open in IMG/M |
| 3300006947|Ga0075444_10243857 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300007276|Ga0070747_1042385 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1766 | Open in IMG/M |
| 3300007540|Ga0099847_1104701 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 860 | Open in IMG/M |
| 3300007541|Ga0099848_1081754 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
| 3300007609|Ga0102945_1000057 | Not Available | 43922 | Open in IMG/M |
| 3300007609|Ga0102945_1003735 | All Organisms → Viruses → Predicted Viral | 4087 | Open in IMG/M |
| 3300007609|Ga0102945_1010165 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300007609|Ga0102945_1095233 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300007963|Ga0110931_1152109 | Not Available | 695 | Open in IMG/M |
| 3300008216|Ga0114898_1019110 | Not Available | 2416 | Open in IMG/M |
| 3300008217|Ga0114899_1002504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9740 | Open in IMG/M |
| 3300009000|Ga0102960_1036690 | Not Available | 1817 | Open in IMG/M |
| 3300009001|Ga0102963_1089876 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300009027|Ga0102957_1201655 | Not Available | 713 | Open in IMG/M |
| 3300009124|Ga0118687_10393554 | Not Available | 534 | Open in IMG/M |
| 3300009412|Ga0114903_1002330 | Not Available | 6922 | Open in IMG/M |
| 3300009428|Ga0114915_1034257 | All Organisms → Viruses → Predicted Viral | 1719 | Open in IMG/M |
| 3300009428|Ga0114915_1184817 | Not Available | 579 | Open in IMG/M |
| 3300009495|Ga0115571_1166702 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 915 | Open in IMG/M |
| 3300009507|Ga0115572_10374258 | Not Available | 799 | Open in IMG/M |
| 3300009599|Ga0115103_1385763 | All Organisms → Viruses → Predicted Viral | 2171 | Open in IMG/M |
| 3300010296|Ga0129348_1000320 | Not Available | 17092 | Open in IMG/M |
| 3300010300|Ga0129351_1070629 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
| 3300010316|Ga0136655_1123549 | Not Available | 776 | Open in IMG/M |
| 3300010883|Ga0133547_10233117 | Not Available | 3884 | Open in IMG/M |
| 3300012953|Ga0163179_10463728 | Not Available | 1041 | Open in IMG/M |
| 3300013010|Ga0129327_10079318 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1618 | Open in IMG/M |
| 3300017710|Ga0181403_1027901 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 1193 | Open in IMG/M |
| 3300017719|Ga0181390_1000159 | All Organisms → cellular organisms → Bacteria | 28139 | Open in IMG/M |
| 3300017719|Ga0181390_1106117 | Not Available | 746 | Open in IMG/M |
| 3300017720|Ga0181383_1001849 | Not Available | 6052 | Open in IMG/M |
| 3300017720|Ga0181383_1036615 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1320 | Open in IMG/M |
| 3300017752|Ga0181400_1001801 | Not Available | 8660 | Open in IMG/M |
| 3300017752|Ga0181400_1001854 | Not Available | 8473 | Open in IMG/M |
| 3300017752|Ga0181400_1009744 | Not Available | 3360 | Open in IMG/M |
| 3300017756|Ga0181382_1064483 | All Organisms → Viruses → Predicted Viral | 1034 | Open in IMG/M |
| 3300017768|Ga0187220_1003864 | All Organisms → cellular organisms → Bacteria | 4587 | Open in IMG/M |
| 3300017769|Ga0187221_1032432 | Not Available | 1754 | Open in IMG/M |
| 3300017773|Ga0181386_1035290 | Not Available | 1634 | Open in IMG/M |
| 3300017783|Ga0181379_1155505 | Not Available | 814 | Open in IMG/M |
| 3300017818|Ga0181565_10002232 | Not Available | 14788 | Open in IMG/M |
| 3300017824|Ga0181552_10001740 | Not Available | 16444 | Open in IMG/M |
| 3300017824|Ga0181552_10196623 | Not Available | 1044 | Open in IMG/M |
| 3300017952|Ga0181583_10941155 | Not Available | 501 | Open in IMG/M |
| 3300017956|Ga0181580_10901737 | Not Available | 552 | Open in IMG/M |
| 3300017957|Ga0181571_10005898 | Not Available | 9185 | Open in IMG/M |
| 3300018415|Ga0181559_10732781 | Not Available | 529 | Open in IMG/M |
| 3300018417|Ga0181558_10257832 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 969 | Open in IMG/M |
| 3300018421|Ga0181592_10261027 | All Organisms → Viruses → Predicted Viral | 1267 | Open in IMG/M |
| 3300018424|Ga0181591_10267001 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300018424|Ga0181591_11067685 | Not Available | 545 | Open in IMG/M |
| 3300018426|Ga0181566_10039058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3700 | Open in IMG/M |
| 3300019122|Ga0188839_1030086 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 537 | Open in IMG/M |
| 3300019276|Ga0182067_1301455 | Not Available | 798 | Open in IMG/M |
| 3300019765|Ga0194024_1166221 | Not Available | 522 | Open in IMG/M |
| 3300020054|Ga0181594_10293349 | Not Available | 745 | Open in IMG/M |
| 3300020185|Ga0206131_10307157 | Not Available | 706 | Open in IMG/M |
| 3300020250|Ga0211627_1077738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 518 | Open in IMG/M |
| 3300020348|Ga0211600_1024586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1611 | Open in IMG/M |
| 3300020381|Ga0211476_10311681 | Not Available | 532 | Open in IMG/M |
| 3300020408|Ga0211651_10189255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 806 | Open in IMG/M |
| 3300020436|Ga0211708_10043957 | Not Available | 1716 | Open in IMG/M |
| 3300020439|Ga0211558_10172572 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
| 3300020455|Ga0211664_10588605 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 503 | Open in IMG/M |
| 3300020458|Ga0211697_10168082 | Not Available | 907 | Open in IMG/M |
| 3300020469|Ga0211577_10244457 | All Organisms → Viruses → Predicted Viral | 1159 | Open in IMG/M |
| 3300020473|Ga0211625_10216915 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1009 | Open in IMG/M |
| 3300021085|Ga0206677_10007383 | Not Available | 8180 | Open in IMG/M |
| 3300021335|Ga0213867_1002817 | All Organisms → cellular organisms → Bacteria | 7605 | Open in IMG/M |
| 3300021335|Ga0213867_1049795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1606 | Open in IMG/M |
| 3300021347|Ga0213862_10039412 | All Organisms → Viruses → Predicted Viral | 1712 | Open in IMG/M |
| 3300021347|Ga0213862_10073055 | All Organisms → Viruses → Predicted Viral | 1213 | Open in IMG/M |
| 3300021356|Ga0213858_10013553 | All Organisms → Viruses → Predicted Viral | 3859 | Open in IMG/M |
| 3300021364|Ga0213859_10233961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Emdodecavirus | 844 | Open in IMG/M |
| 3300021368|Ga0213860_10123460 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300021791|Ga0226832_10025347 | Not Available | 1963 | Open in IMG/M |
| 3300021957|Ga0222717_10344152 | Not Available | 839 | Open in IMG/M |
| 3300021957|Ga0222717_10519308 | Not Available | 638 | Open in IMG/M |
| 3300021958|Ga0222718_10033756 | All Organisms → cellular organisms → Bacteria | 3395 | Open in IMG/M |
| 3300021964|Ga0222719_10000823 | Not Available | 30969 | Open in IMG/M |
| 3300021964|Ga0222719_10178258 | All Organisms → Viruses → Predicted Viral | 1474 | Open in IMG/M |
| 3300021964|Ga0222719_10704879 | Not Available | 569 | Open in IMG/M |
| 3300021964|Ga0222719_10743526 | Not Available | 547 | Open in IMG/M |
| 3300021964|Ga0222719_10768442 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 534 | Open in IMG/M |
| 3300022057|Ga0212025_1020450 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1070 | Open in IMG/M |
| 3300022065|Ga0212024_1084816 | Not Available | 564 | Open in IMG/M |
| 3300022071|Ga0212028_1058678 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 720 | Open in IMG/M |
| 3300022074|Ga0224906_1093284 | Not Available | 897 | Open in IMG/M |
| 3300022178|Ga0196887_1059286 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 950 | Open in IMG/M |
| 3300023108|Ga0255784_10069107 | All Organisms → Viruses → Predicted Viral | 2075 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10000121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 105514 | Open in IMG/M |
| (restricted) 3300024264|Ga0233444_10021186 | All Organisms → Viruses → Predicted Viral | 4602 | Open in IMG/M |
| 3300024297|Ga0228658_1125768 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 623 | Open in IMG/M |
| 3300025048|Ga0207905_1007959 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300025069|Ga0207887_1064785 | Not Available | 597 | Open in IMG/M |
| 3300025103|Ga0208013_1147457 | Not Available | 563 | Open in IMG/M |
| 3300025120|Ga0209535_1002979 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 10970 | Open in IMG/M |
| 3300025120|Ga0209535_1066087 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300025128|Ga0208919_1213199 | Not Available | 574 | Open in IMG/M |
| 3300025137|Ga0209336_10169214 | Not Available | 562 | Open in IMG/M |
| 3300025276|Ga0208814_1003826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 6108 | Open in IMG/M |
| 3300025282|Ga0208030_1060838 | Not Available | 1040 | Open in IMG/M |
| 3300025508|Ga0208148_1001578 | Not Available | 8427 | Open in IMG/M |
| 3300025508|Ga0208148_1006180 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3870 | Open in IMG/M |
| 3300025543|Ga0208303_1035647 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300025608|Ga0209654_1006990 | All Organisms → cellular organisms → Bacteria | 5548 | Open in IMG/M |
| 3300025610|Ga0208149_1042537 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300025610|Ga0208149_1056342 | All Organisms → Viruses → Predicted Viral | 1005 | Open in IMG/M |
| 3300025626|Ga0209716_1140877 | Not Available | 635 | Open in IMG/M |
| 3300025645|Ga0208643_1014658 | All Organisms → Viruses → Predicted Viral | 2883 | Open in IMG/M |
| 3300025645|Ga0208643_1030979 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1771 | Open in IMG/M |
| 3300025671|Ga0208898_1026438 | Not Available | 2446 | Open in IMG/M |
| 3300025751|Ga0208150_1006701 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 4238 | Open in IMG/M |
| 3300025890|Ga0209631_10202659 | All Organisms → Viruses → Predicted Viral | 1020 | Open in IMG/M |
| 3300025934|Ga0207686_10272874 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
| 3300026097|Ga0209953_1000006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 154976 | Open in IMG/M |
| 3300026097|Ga0209953_1000152 | Not Available | 26646 | Open in IMG/M |
| 3300026103|Ga0208451_1049434 | Not Available | 526 | Open in IMG/M |
| 3300026183|Ga0209932_1004958 | Not Available | 3735 | Open in IMG/M |
| 3300027612|Ga0209037_1050726 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
| 3300027714|Ga0209815_1090416 | Not Available | 1032 | Open in IMG/M |
| 3300027714|Ga0209815_1235704 | Not Available | 555 | Open in IMG/M |
| 3300027839|Ga0209403_10182033 | Not Available | 1262 | Open in IMG/M |
| 3300028018|Ga0256381_1057326 | Not Available | 589 | Open in IMG/M |
| 3300028022|Ga0256382_1034531 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300028022|Ga0256382_1166617 | Not Available | 527 | Open in IMG/M |
| 3300028125|Ga0256368_1016060 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300031141|Ga0308021_10019845 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 4572_77 | 2908 | Open in IMG/M |
| 3300031565|Ga0307379_10128247 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300031578|Ga0307376_10409862 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 889 | Open in IMG/M |
| 3300031605|Ga0302132_10079593 | Not Available | 1672 | Open in IMG/M |
| 3300031608|Ga0307999_1047736 | All Organisms → Viruses → Predicted Viral | 1019 | Open in IMG/M |
| 3300031644|Ga0308001_10198809 | Not Available | 797 | Open in IMG/M |
| 3300031669|Ga0307375_10611462 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 640 | Open in IMG/M |
| 3300031673|Ga0307377_11062083 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 539 | Open in IMG/M |
| 3300031800|Ga0310122_10169614 | Not Available | 1033 | Open in IMG/M |
| 3300031801|Ga0310121_10002343 | Not Available | 18090 | Open in IMG/M |
| 3300032820|Ga0310342_100892230 | Not Available | 1036 | Open in IMG/M |
| 3300032820|Ga0310342_101660280 | Not Available | 762 | Open in IMG/M |
| 3300034175|Ga0334939_0022078 | Not Available | 2106 | Open in IMG/M |
| 3300034654|Ga0326741_000994 | Not Available | 6605 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 19.89% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.05% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 8.84% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.84% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.73% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.52% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.42% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.42% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.87% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.21% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.21% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.21% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.21% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.66% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.66% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.10% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.10% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.10% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.10% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.55% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.55% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.55% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.55% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.55% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.55% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.55% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.55% |
| Biocrust | Environmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300006013 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_NADW_ad_2500m_LV_B | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009599 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017957 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019276 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020054 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413BT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020348 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161) | Environmental | Open in IMG/M |
| 3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
| 3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020458 | Marine microbial communities from Tara Oceans - TARA_B100000749 (ERX556123-ERR599000) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300023108 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025069 | Marine viral communities from the Pacific Ocean - LP-38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025608 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026097 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
| 3300028018 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600m | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
| 3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031800 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034175 | Biocrust microbial communities from Mojave Desert, California, United States - 35SMC | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100052952 | 3300000101 | Marine | MTKYNKKAVEKAIKKDPRIKPKEAKAIHALLKGWRK* |
| DelMOSum2011_100064754 | 3300000115 | Marine | MAEYNKEAVEKVICKDKRIKKAEASAIHRLLKGRAR* |
| DelMOSpr2010_1000190712 | 3300000116 | Marine | MSKYNKEAVEKQIRKEGIKGKEAKLIHALLKGRG* |
| DelMOWin2010_1000000964 | 3300000117 | Marine | MAKYNKEAVEKMIKKDRRIKGKEAKLIHALLKGRNR* |
| JGI24006J15134_100117949 | 3300001450 | Marine | VTKYNKKAVDKAIKKDPRIKGKEAKLIHALLRGRTAPKGA* |
| JGI24006J15134_102086321 | 3300001450 | Marine | MKKFVQYNKDAVEKAIKKNPTIKPKEAKLIHALLKG |
| JGI24003J15210_1000185317 | 3300001460 | Marine | MAKYNKEAVDKAIKRDPRIKGKESKAIHRLLKGRGK* |
| JGI24004J15324_100649721 | 3300001472 | Marine | MKKFVQYNKDAVEKAIKKNPTIKPKEAKLIHALLKGH |
| JGI24004J15324_101643922 | 3300001472 | Marine | MAKYNKXAVDKAIKRDPRIKGKESKAIHRLLKGRGK* |
| JGI24005J15628_100047383 | 3300001589 | Marine | MAKYNKEAVDKAIKKDPKIKGKEAKLIHRLLKGRS* |
| JGI25131J35506_10065104 | 3300002511 | Marine | VKRYNKEAVDKAIKRDPRIKGKEAKLIHRLLKGRKYRKVG* |
| Ga0055584_1000475205 | 3300004097 | Pelagic Marine | LKEFKMSKYNKEAVEEQIRKEGIKGKEAKLIHALLKGRGK* |
| Ga0055584_1002962174 | 3300004097 | Pelagic Marine | MCKATKMYNKDSIDKEIKKDPRISKKESKLIHALLKGRG* |
| Ga0065861_11066973 | 3300004448 | Marine | VTKYNKKAVDKAIKKDPKIKGKEAKLIHALLRGRTAPKGA* |
| Ga0074648_11884501 | 3300005512 | Saline Water And Sediment | MAKYNKEAVDKAIKRDPRIKGKEAKAIHRLLKGRGK* |
| Ga0066382_102382992 | 3300006013 | Marine | MKYNKKAVDKAIKKDPRIKPKEAKLIHSLLKGRTK* |
| Ga0075474_100073965 | 3300006025 | Aqueous | MAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK* |
| Ga0075474_100169055 | 3300006025 | Aqueous | MKYNKEAVQKQIDKDRRIKGKEAKAIHALLKGRTR* |
| Ga0075474_100192648 | 3300006025 | Aqueous | TTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK* |
| Ga0075474_100424714 | 3300006025 | Aqueous | MKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK* |
| Ga0075474_100789644 | 3300006025 | Aqueous | LGMKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK* |
| Ga0075478_100100586 | 3300006026 | Aqueous | MSNYNEKAVEREIKKDPRIKGKEAKLIKALLKGRK* |
| Ga0075478_100559432 | 3300006026 | Aqueous | MQKTKYNKEAVDKEIKRDPRIKGQEAKLIHRLLKGRTK* |
| Ga0075478_101169933 | 3300006026 | Aqueous | MAKYNKEAVDKAIKHDPRIKGKEAKAIHRLLKGRTKAA* |
| Ga0075462_100921883 | 3300006027 | Aqueous | LMAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK* |
| Ga0075466_10975581 | 3300006029 | Aqueous | MKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGR |
| Ga0075441_100581725 | 3300006164 | Marine | MIKYNKKAVDKAVKKDSRIKPKEAKLIHRLLKGRTSNVTLL* |
| Ga0075441_100976193 | 3300006164 | Marine | MVKYNKEAVDKAIWLATSKKDPKIKGKEAKLIHRLLKGRS* |
| Ga0075461_101615282 | 3300006637 | Aqueous | RLMAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK* |
| Ga0075461_101841472 | 3300006637 | Aqueous | VYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK* |
| Ga0098044_10326916 | 3300006754 | Marine | MKTVTYNKEAVDKAIKKDSRIKGKEAKLIHRLLKGRK* |
| Ga0070749_100951755 | 3300006802 | Aqueous | MSYNKEAVEKAIASSRKPISGKEAKLIHALLKGRK* |
| Ga0070749_102485152 | 3300006802 | Aqueous | MAKYNKAAVEKEIRKDKRIKAKEAKLIHALLKGRGK* |
| Ga0070749_105292522 | 3300006802 | Aqueous | MAKYNKAAVDKEIRKDKRIKAKEAKLIHALLKGRRK* |
| Ga0075467_100569875 | 3300006803 | Aqueous | MTKYNKEAVDKAVKKDPRIKAKEAQLIHRLLKGRSSKK* |
| Ga0075476_100495457 | 3300006867 | Aqueous | GMKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK* |
| Ga0070746_104353082 | 3300006919 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAQLIHRLLKGRSGKK* |
| Ga0070748_10225709 | 3300006920 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAQLIHRLLKGRSSKK* |
| Ga0070748_10500681 | 3300006920 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAQLIHRLLKGRS |
| Ga0075444_102438572 | 3300006947 | Marine | MIKYNKPAIDKEIKKDPRIKGKEAKLIHALLKGRGK* |
| Ga0070747_10423851 | 3300007276 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK* |
| Ga0099847_11047011 | 3300007540 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAKLINRLLKGRSSKK* |
| Ga0099848_10817542 | 3300007541 | Aqueous | MAKYSKEAVDKAIKRDPRIKGKEAKAIHRLLKGRSKAA* |
| Ga0102945_100005719 | 3300007609 | Pond Water | MREYNEKAVEREIRKDPRIKGKEAKLIKALLKGRK* |
| Ga0102945_10037355 | 3300007609 | Pond Water | MSNYNEKAVEREIRKDPRIKVKEAKLIKALLKGHAK* |
| Ga0102945_10101653 | 3300007609 | Pond Water | MTQYNEKAVDEAIKRDPRIKGKEAKLIKALLKGRKQ* |
| Ga0102945_10952332 | 3300007609 | Pond Water | MSKYNEKAVDREIKKDPRIKGREAKLIKALLKGNSK* |
| Ga0110931_11521092 | 3300007963 | Marine | MEAVKKQSVTYNKEAVDKAIKKDSRIKGNEAKLIHRLLKGRK* |
| Ga0114898_10191104 | 3300008216 | Deep Ocean | MIAYNQEAVDKAIAKDKRIKKKEARLIHALLKGRVK* |
| Ga0114899_10025043 | 3300008217 | Deep Ocean | MVAYNQEAVDKAIAKDKRIKKKEARLIHALLKGRVK* |
| Ga0102960_10366904 | 3300009000 | Pond Water | MPYNKEAVEKEIKKDSRIKGREAKLIHALLKGNRKSK* |
| Ga0102963_10898761 | 3300009001 | Pond Water | MTKVKYNKDAVEKEIRKDKRIKGKEAKLIHALLKGRS* |
| Ga0102957_12016553 | 3300009027 | Pond Water | MPKYNEQAVEKEIAKNPCIKGREAKLIKSLLMGRK* |
| Ga0118687_103935542 | 3300009124 | Sediment | MNYNEQAVAREIRKDPRIKGREAKLIKALLKGRK* |
| Ga0114903_100233012 | 3300009412 | Deep Ocean | LEDIMVAYNQEAVDKAIAKDKRIKKKEARLIHALLKGRVK* |
| Ga0114915_10342575 | 3300009428 | Deep Ocean | MAKYNKKAVDKAIKKDPKIKGKEAKLIHALLRGRTAPKGA* |
| Ga0114915_11848172 | 3300009428 | Deep Ocean | KYNKKAVDKAIKKDPKIKGKEAKLIHALLRGRTAPKGA* |
| Ga0115571_11667023 | 3300009495 | Pelagic Marine | MKKYNKEAVDKAIKQNPKIKGKEAKLIHRLLKGHGEVKHGRR* |
| Ga0115572_103742582 | 3300009507 | Pelagic Marine | MKKYNKEAVDKAIKTDPKIKGKEAKLIHRLLKGHGEVKHGRR* |
| Ga0115103_13857635 | 3300009599 | Marine | MKYNKSSVDKEIKKDPRIKGKEAKAIHALLKGRTK* |
| Ga0129348_100032035 | 3300010296 | Freshwater To Marine Saline Gradient | MSTKESSVKYNKEAVQKEINKDRRIKGKEAKAIHALLKGRAR* |
| Ga0129351_10706291 | 3300010300 | Freshwater To Marine Saline Gradient | MSTKESSVKYNKEAVQKEINKDRRIKGKEAKAIHALLK |
| Ga0136655_11235491 | 3300010316 | Freshwater To Marine Saline Gradient | MAKYNKEAVDKAIKRDPRIKGKEAKVIHRLLKGRTKAA* |
| Ga0133547_102331177 | 3300010883 | Marine | MSSKYNKAAVDKAIAKDPRIKPKEAKSIHRLLKGRH* |
| Ga0163179_104637282 | 3300012953 | Seawater | MTYNKEAVDKAIKQDKRIKPKEAKLIHALLKGWR* |
| Ga0129327_100793185 | 3300013010 | Freshwater To Marine Saline Gradient | MTKHNKEAENKAIKKDPRIKAKEAQLIHRLLKGRSSKK* |
| Ga0181403_10279011 | 3300017710 | Seawater | MSKYNKEAVEHQIRKEGIKGKEAKLIHALLKGHGK |
| Ga0181390_100015912 | 3300017719 | Seawater | MSRMKYNKSSVDKEIKKDPRIKGKEAKAIHALLKGRTK |
| Ga0181390_11061171 | 3300017719 | Seawater | MSKYNKEAVEHQIRKEGIKGKEAKLIHALLKGHRK |
| Ga0181383_100184919 | 3300017720 | Seawater | MKKPVYNKEAVDQAIKRDPRIKPKEAKLIHALLKGRKNA |
| Ga0181383_10366154 | 3300017720 | Seawater | MQKPKYNKEAVDKAIKRDPRIKGQEAKLIHRLLKGRTT |
| Ga0181400_100180115 | 3300017752 | Seawater | NVKYNKEAVDKEIKRDPRIKGKEAKAIHALLKGRSR |
| Ga0181400_10018549 | 3300017752 | Seawater | MKYNKEAVQKEINKDRRIKAKEAKAIHSLLRGRTR |
| Ga0181400_10097446 | 3300017752 | Seawater | MATYNKKAVDEAIKKDPRIKGKEAKLIHALLKGHK |
| Ga0181382_10644835 | 3300017756 | Seawater | FLEMKKPVYNKEAVDQAIKRDPRIKPKEAKLIHALLKGRKNA |
| Ga0187220_10038647 | 3300017768 | Seawater | MIKPVYNKEAVDQAIKRDPRIKPKEAKLIHALLKGRKNA |
| Ga0187221_10324329 | 3300017769 | Seawater | LEMKKPVYNKEAVDQAIKRDPRIKPKEAKLIHALLKGRRK |
| Ga0181386_10352907 | 3300017773 | Seawater | LEIEKPVYNKEAVDQAIKRDPRIKPKEAKLIHALLKGRKNA |
| Ga0181379_11555054 | 3300017783 | Seawater | MNKPVYNKEAVAKAIKRDPRIKPKEAKLIHALLKGRKNA |
| Ga0181565_1000223217 | 3300017818 | Salt Marsh | MNYNKDAVEKQIRKEGIKGKEAKLIHALLKGRSNG |
| Ga0181552_1000174015 | 3300017824 | Salt Marsh | MSKYNKEAVDKSIKKDPRIKGKEAKLIHALLKGRNR |
| Ga0181552_101966233 | 3300017824 | Salt Marsh | MQKPKYNKEAVDKAIKRDPRIKGQEAKLIHRLLKGRTK |
| Ga0181583_109411551 | 3300017952 | Salt Marsh | TMAKYNKAAVEKEIRKDKRIKAKEAKLIHALLKGRGK |
| Ga0181580_106087001 | 3300017956 | Salt Marsh | SIRKEKEMQKPKYNKEAVDKAIKRDPRIKGHEAKLIHRLLKGRTK |
| Ga0181580_109017371 | 3300017956 | Salt Marsh | MQKPKYNKEAVDKAIKRDPRIKGHEAKLIHRLLKGRAR |
| Ga0181571_1000589810 | 3300017957 | Salt Marsh | MQKPKYNKEAVDKAIKRDPRIKAKEAKLIHRLLKGRSS |
| Ga0181559_107327811 | 3300018415 | Salt Marsh | MATYNKQAVDREIKKDPRIKGKEAKLIHALLKGNRKLPK |
| Ga0181558_102578322 | 3300018417 | Salt Marsh | MKYNKEAVQKQIDKDRRIKGKEAKAIHALLKGRTR |
| Ga0181592_102610273 | 3300018421 | Salt Marsh | MTKYNKAAVEKEIRKDKRIKAKEAKLIHALLKGRGK |
| Ga0181591_102670012 | 3300018424 | Salt Marsh | MAKYNKAAVEKEIRKDKRIKAKEAKLIHALLKGRGK |
| Ga0181591_110676851 | 3300018424 | Salt Marsh | KPKYNKEAVDKAIKRDPRIKGHEAKLIHRLLKGRAR |
| Ga0181566_100390582 | 3300018426 | Salt Marsh | MQKTKYNKEAVDKAIKRDPRIKAKEAKLIHRLLKGRSS |
| Ga0188839_10300862 | 3300019122 | Freshwater Lake | MIKYNKPAIDKEIKKDPRIKGKEAKLIHALLKGRGK |
| Ga0182067_13014552 | 3300019276 | Salt Marsh | MERSSEESMNYNKDAVEKQIRKEGIKGKEAKLIHALLKGRSNG |
| Ga0194024_11662212 | 3300019765 | Freshwater | MAKYNKEAVDKAIKHDPRIKGKEAKAIHRLLKGRTKAA |
| Ga0181594_102933493 | 3300020054 | Salt Marsh | MQKPKYNKEAVDKAIKRDPRIKGHEAKLIHRLLKGRTK |
| Ga0206131_103071573 | 3300020185 | Seawater | MKKYNKEAVDKAIKTDPKIKGKEAKLIHRLLKGHGKV |
| Ga0211627_10777381 | 3300020250 | Marine | MLKGEKYNKKAVDRAIKKDPRIKGKEAKLIHRLLKGRKQ |
| Ga0211600_10245863 | 3300020348 | Marine | MTDQKLKGEKYNKKAVDREIKKDPRIKGKEAKLIHRLLKGRS |
| Ga0211476_103116812 | 3300020381 | Marine | MKTPTYNKQAVDKAIKRDPRIKPKEAKLIHALLKGRGND |
| Ga0211651_101892553 | 3300020408 | Marine | MLKGEKYNKKAVDREIKKDPRIKGKEAKLIHRLLKGRKQ |
| Ga0211708_100439574 | 3300020436 | Marine | MKTPTYNKQAVDKAIKRDPRIKPKEAKLIHALLKGRKR |
| Ga0211558_101725723 | 3300020439 | Marine | MKYNREAVNKEIRKDKRIKGKEAKVIHALLKGRSK |
| Ga0211664_105886051 | 3300020455 | Marine | MLKDEKYNKKAVDRAIKKDPRIKGKEAKLIHRLLK |
| Ga0211697_101680822 | 3300020458 | Marine | MATYNKEAVDKAIKKNPRIKPKEAKLIHRLLKGRKK |
| Ga0211577_102444575 | 3300020469 | Marine | MCKATKMYNKDSIDKEIKKDPRISKKESKLIHALLKGRG |
| Ga0211625_102169152 | 3300020473 | Marine | MLKDEKYNKKAVDRAIKKDPRIKGKEAKLIHRLLKGRKQ |
| Ga0206677_100073834 | 3300021085 | Seawater | MKYNKSSVDKEIKKDPRIKGKEAKAIHALLKGRTK |
| Ga0213867_10028172 | 3300021335 | Seawater | MNYNKNAVEKQIRKEGIKGKEAKLIHALLKGRSNG |
| Ga0213867_10497953 | 3300021335 | Seawater | MSYNKEAVEKEIKKDPRIKGREAKLIHALLKGNRKSK |
| Ga0213862_100394125 | 3300021347 | Seawater | MAKYNKESVEKEIKKDRRIKGKEAKLIHALLKGRNR |
| Ga0213862_100730554 | 3300021347 | Seawater | MSKYNKEAVEQQIRKEGIKGKEAKLIHALLKGRGK |
| Ga0213858_100135537 | 3300021356 | Seawater | MKYNKQAVQKQIDKDRRIKGKEAKAIHALLKGRTR |
| Ga0213859_102339614 | 3300021364 | Seawater | MAKYNKAAVEKEIRKDKRIKAKEAKLIHALLKGRGNRHGGN |
| Ga0213860_101234604 | 3300021368 | Seawater | MSKYNKEAVEEQIRKEGIKGKEAKLIHALLKGRGK |
| Ga0226832_100253476 | 3300021791 | Hydrothermal Vent Fluids | MATYNKKAVDKAIKKDPRIKPKEAKLIHRLLKGRKKCGGCMEGGGVR |
| Ga0222717_103441522 | 3300021957 | Estuarine Water | MQKPKYNKEAVDKAIKRDPRIKGQEAKLIHRLLKGRSK |
| Ga0222717_105193081 | 3300021957 | Estuarine Water | MSKYNKEAVEQQIRKEGIKGKEAKLIHALLKGHRK |
| Ga0222718_100337568 | 3300021958 | Estuarine Water | MAKYNKEAVDKAIKRDPRIKGKEAKAIHRLLKGRGK |
| Ga0222719_1000082321 | 3300021964 | Estuarine Water | MQKTKYNKEAVDKAIKRDPRIKGHEAKLIHRLLKGRTIK |
| Ga0222719_101782582 | 3300021964 | Estuarine Water | MVEYNEKAVAKEIAKDPRIKGKEAKLIKALLKGRK |
| Ga0222719_107048793 | 3300021964 | Estuarine Water | MPKYNEQAVEKEIAKDPRIKGREAKLIKALLKGRK |
| Ga0222719_107435263 | 3300021964 | Estuarine Water | MTKYNEKAVEREIRKDPRIKGKEAKLIKALLKGRSK |
| Ga0222719_107684422 | 3300021964 | Estuarine Water | MTKYNKEAVNKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0212025_10204503 | 3300022057 | Aqueous | MAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0212024_10848162 | 3300022065 | Aqueous | EMKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK |
| Ga0212028_10586783 | 3300022071 | Aqueous | SLMAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0224906_10932843 | 3300022074 | Seawater | MDSSNKTSYNKESVDKAIKQDKRIKAKEAKMIHSLLKGWRG |
| Ga0196887_10592863 | 3300022178 | Aqueous | MTKYNKEAVDKAVKKDPRIKAKEAQLIHRLLKGRSSKK |
| Ga0255784_100691071 | 3300023108 | Salt Marsh | MQKTKYNKEAVDKAIKRDPRIKAKEAKLIHRLLKGRS |
| (restricted) Ga0233438_1000012161 | 3300024255 | Seawater | MAKYNKEAVEKEIKKDRRIKGKEAKLIHALLKGRNR |
| (restricted) Ga0233444_1002118612 | 3300024264 | Seawater | MSKYNKEAVEKQIRKEGIKGKEAKLIHALLKGHGK |
| Ga0228658_11257682 | 3300024297 | Seawater | MATYNKKSVDDAIKRDPRIKPKEAKLIHALLKGNRKLPK |
| Ga0207905_10079592 | 3300025048 | Marine | VTKYNKKAVDKAIKKDPKIKGKEAKLIHALLRGRTAPKGA |
| Ga0207887_10647852 | 3300025069 | Marine | VKRYNKEAVDKAIKQDPRIKGKEAKLIHRLLKGRKYRKVG |
| Ga0208013_11474573 | 3300025103 | Marine | MKTVTYNKEAVDKAIKKDSRIKGKEAKLIHRLLKGRK |
| Ga0209535_10029797 | 3300025120 | Marine | MAKYNKEAVDKAIKRDPRIKGKESKAIHRLLKGRGK |
| Ga0209535_10660871 | 3300025120 | Marine | MAEYNKEAVERAIRKDKRIKKAEASAIHRLLKGRAR |
| Ga0208919_12131993 | 3300025128 | Marine | MEAVKKQSVTYNKEAVDKAIKKDSRIKGNEAKLIHRLLKGRK |
| Ga0209336_101692142 | 3300025137 | Marine | MAKYNKEAVDKAIKKDPKIKGKEAKLIHRLLKGRS |
| Ga0208814_10038269 | 3300025276 | Deep Ocean | MAKYNKKAVDKAIKKDPKIKGKEAKLIHALLRGRTAPKGA |
| Ga0208030_10608382 | 3300025282 | Deep Ocean | MKYNKKAVDKAIKKDPRIKPKEAKLIHSLLKGRTK |
| Ga0208148_10015782 | 3300025508 | Aqueous | MKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKGRGK |
| Ga0208148_10061805 | 3300025508 | Aqueous | MTKYNKKAVEKAIKKDPRIKPKEAKAIHALLKGWRK |
| Ga0208303_10356472 | 3300025543 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAKLINRLLKGRSSKK |
| Ga0209654_10069904 | 3300025608 | Marine | MTEYNEKAVEREIQKDPRIKGREARLIKSLLKGRKKG |
| Ga0208149_10425373 | 3300025610 | Aqueous | MSNYNEKAVEREIKKDPRIKGKEAKLIKALLKGRK |
| Ga0208149_10563424 | 3300025610 | Aqueous | MQKTKYNKEAVDKEIKRDPRIKGQEAKLIHRLLKGRTK |
| Ga0209716_11408773 | 3300025626 | Pelagic Marine | MKKYNKEAVDKAIKQNPKIKGKEAKLIHRLLKGHGEVKHGRR |
| Ga0208643_10146581 | 3300025645 | Aqueous | EECRLMTKYNKEAVDKAIKKDPRIKAKEAQLIHRLLKGRSSKK |
| Ga0208643_10309796 | 3300025645 | Aqueous | MTKYNKEAVDKAIKKDPRIKAKEAQLIHRLLKGRSSKK |
| Ga0208898_10264381 | 3300025671 | Aqueous | MKTTVYNKKAVDQAIKRDPRIKPKEAKLIHALLKG |
| Ga0208150_100670112 | 3300025751 | Aqueous | MAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSK |
| Ga0209631_102026591 | 3300025890 | Pelagic Marine | ILSCSGGEVMSKYNKEAVDKSIKKDPRIKGKEAKLIHALLKGRNR |
| Ga0207686_102728746 | 3300025934 | Miscanthus Rhizosphere | MNPRYSKAAVDQVIAQDKRIGKREAKLIHALLKGPTM |
| Ga0209953_100000624 | 3300026097 | Pond Water | MTQYNEKAVDEAIKRDPRIKGKEAKLIKALLKGRKQ |
| Ga0209953_100015223 | 3300026097 | Pond Water | MSNYNEKAVEREIRKDPRIKVKEAKLIKALLKGHAK |
| Ga0208451_10494342 | 3300026103 | Marine Oceanic | MRKYNKESVDKAIKKDPKIKPKEAKLIHKLLKGKVARRSSDSLL |
| Ga0209932_10049583 | 3300026183 | Pond Water | MPYNKEAVEKEIKKDSRIKGREAKLIHALLKGNRKSK |
| Ga0209037_10507263 | 3300027612 | Marine | MSKYNEKAVDREIKKDPRIKDREAKLIKALLKGNSK |
| Ga0209815_10904161 | 3300027714 | Marine | MIKYNKKAVDKAVKKDSRIKPKEAKLIHRLLKGRTSNVTLL |
| Ga0209815_12357041 | 3300027714 | Marine | HLDGSIIKMVKYNKEAVDKAIWLATSKKDPKIKGKEAKLIHRLLKGRS |
| Ga0209403_101820334 | 3300027839 | Marine | MNGYNKNAVTKEITKDPSISKKGAKLIHALLKGRG |
| Ga0256381_10573262 | 3300028018 | Seawater | MAKYNKQAVQKAIDQDKSIGDAEAKLIHALLKGRSKKGDSNDRNN |
| Ga0256382_10345312 | 3300028022 | Seawater | MVTYNKKAVDEAIKKNPKIKPKEAKLIHRLLKGRKK |
| Ga0256382_11666171 | 3300028022 | Seawater | MSKYNKEAVTKAIKRDPKIKGKEAKLIHRLLKGRRKEK |
| Ga0256368_10160601 | 3300028125 | Sea-Ice Brine | MAEYNKEAVEKAIRKDKRIKKSEASTIHRLLKGRAR |
| Ga0308021_1001984511 | 3300031141 | Marine | MVKYNKEAVDKAIWLATSKKDPKIKGKEAKLIHRLLKGRS |
| Ga0307379_101282474 | 3300031565 | Soil | MAEYNKEAVEKVICKDKRIKKAEASAIHRLLKGRAR |
| Ga0307376_104098621 | 3300031578 | Soil | QLRVEECSLMAKYNKEAVEKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0302132_100795935 | 3300031605 | Marine | MSSKYNKAAVDKAIAKDPRIKPKEAKSIHRLLKGRH |
| Ga0307999_10477364 | 3300031608 | Marine | MDGSIIKMVKYNKEAVDKAIWLATSKKDPKIKGKEAKLIHRL |
| Ga0308001_101988094 | 3300031644 | Marine | MDGSIIKMVKYNKEAVDKAIWLATSKKDPKIKGKEAKLIHRLLKGRS |
| Ga0307375_106114622 | 3300031669 | Soil | MAKYNKEAVEKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0307377_110620831 | 3300031673 | Soil | MEECRLMAKYNKEAVDKAIKKDPRIKAKEAKLIHRLLKGRSSKK |
| Ga0310122_101696142 | 3300031800 | Marine | MRNEMKYNKKAVDKAIKKDPRIKPKEKKLIHSLLKGRTK |
| Ga0310121_100023435 | 3300031801 | Marine | MATYNKKAVDEAIKKNPKIKPKEAKLIHRLLKGRK |
| Ga0310342_1008922302 | 3300032820 | Seawater | MPTYSKKAVEKEIKKDPRIKGKEAKLIHALLKGRY |
| Ga0310342_1016602802 | 3300032820 | Seawater | MATYNKEAVDKAIKKNRRIKPKEAKLIHRLLKGRK |
| Ga0334939_0022078_1333_1446 | 3300034175 | Biocrust | VAEYNKQAVDQAIKASRKKIGGKEAKLIHSLLKGRSC |
| Ga0326741_000994_860_979 | 3300034654 | Filtered Seawater | MTMPKYNKAAVNKAIKKNPKIKAREAKLIHRLLKGRITR |
| ⦗Top⦘ |