


| Basic Information | |
|---|---|
| Family ID | F032006 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 181 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ADRTAHKVAKAGVLAKRELADISKQVDALKRQLQKTTKRLKRALT |
| Number of Associated Samples | 144 |
| Number of Associated Scaffolds | 181 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 8.43 % |
| % of genes near scaffold ends (potentially truncated) | 87.85 % |
| % of genes from short scaffolds (< 2000 bps) | 81.22 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.718 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.072 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.829 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.90% β-sheet: 0.00% Coil/Unstructured: 41.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 181 Family Scaffolds |
|---|---|---|
| PF16338 | AGL_N | 4.97 |
| PF02735 | Ku | 4.42 |
| PF00857 | Isochorismatase | 3.87 |
| PF14255 | Cys_rich_CPXG | 2.76 |
| PF01381 | HTH_3 | 2.76 |
| PF12704 | MacB_PCD | 1.66 |
| PF02687 | FtsX | 1.66 |
| PF01266 | DAO | 1.66 |
| PF07690 | MFS_1 | 1.66 |
| PF00072 | Response_reg | 1.10 |
| PF00912 | Transgly | 1.10 |
| PF00578 | AhpC-TSA | 1.10 |
| PF14559 | TPR_19 | 1.10 |
| PF03631 | Virul_fac_BrkB | 1.10 |
| PF02517 | Rce1-like | 1.10 |
| PF08592 | Anthrone_oxy | 1.10 |
| PF10263 | SprT-like | 1.10 |
| PF13802 | Gal_mutarotas_2 | 0.55 |
| PF00873 | ACR_tran | 0.55 |
| PF00196 | GerE | 0.55 |
| PF00149 | Metallophos | 0.55 |
| PF01979 | Amidohydro_1 | 0.55 |
| PF00475 | IGPD | 0.55 |
| PF08281 | Sigma70_r4_2 | 0.55 |
| PF01569 | PAP2 | 0.55 |
| PF13602 | ADH_zinc_N_2 | 0.55 |
| PF16576 | HlyD_D23 | 0.55 |
| PF06684 | AA_synth | 0.55 |
| PF01402 | RHH_1 | 0.55 |
| PF07992 | Pyr_redox_2 | 0.55 |
| PF02633 | Creatininase | 0.55 |
| PF00011 | HSP20 | 0.55 |
| PF08818 | DUF1801 | 0.55 |
| PF13429 | TPR_15 | 0.55 |
| PF00392 | GntR | 0.55 |
| PF02073 | Peptidase_M29 | 0.55 |
| PF01435 | Peptidase_M48 | 0.55 |
| PF02583 | Trns_repr_metal | 0.55 |
| PF01850 | PIN | 0.55 |
| PF10067 | DUF2306 | 0.55 |
| PF00464 | SHMT | 0.55 |
| PF03934 | T2SSK | 0.55 |
| PF06751 | EutB | 0.55 |
| PF03713 | DUF305 | 0.55 |
| PF11345 | DUF3147 | 0.55 |
| PF09723 | Zn-ribbon_8 | 0.55 |
| PF14534 | DUF4440 | 0.55 |
| PF03100 | CcmE | 0.55 |
| PF02881 | SRP54_N | 0.55 |
| PF02738 | MoCoBD_1 | 0.55 |
| PF07274 | DUF1440 | 0.55 |
| PF00202 | Aminotran_3 | 0.55 |
| PF12697 | Abhydrolase_6 | 0.55 |
| PF08570 | DUF1761 | 0.55 |
| PF02702 | KdpD | 0.55 |
| PF07730 | HisKA_3 | 0.55 |
| PF04014 | MazE_antitoxin | 0.55 |
| PF07366 | SnoaL | 0.55 |
| PF01464 | SLT | 0.55 |
| PF13335 | Mg_chelatase_C | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 181 Family Scaffolds |
|---|---|---|---|
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 4.42 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 3.87 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 3.87 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 1.10 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 1.10 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 1.10 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.10 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.55 |
| COG2332 | Cytochrome c biogenesis protein CcmE | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG3156 | Type II secretory pathway, component PulK | Intracellular trafficking, secretion, and vesicular transport [U] | 0.55 |
| COG3477 | Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 family | Function unknown [S] | 0.55 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.55 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.55 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.55 |
| COG4303 | Ethanolamine ammonia-lyase, large subunit | Amino acid transport and metabolism [E] | 0.55 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.55 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.55 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.55 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.55 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.55 |
| COG0131 | Imidazoleglycerol phosphate dehydratase HisB | Amino acid transport and metabolism [E] | 0.55 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.55 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.55 |
| COG1937 | DNA-binding transcriptional regulator, FrmR family | Transcription [K] | 0.55 |
| COG2205 | K+-sensing histidine kinase KdpD | Signal transduction mechanisms [T] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.72 % |
| Unclassified | root | N/A | 29.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10014298 | All Organisms → cellular organisms → Bacteria | 6613 | Open in IMG/M |
| 3300004091|Ga0062387_101531768 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300004091|Ga0062387_101778096 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300004092|Ga0062389_101906729 | Not Available | 772 | Open in IMG/M |
| 3300004152|Ga0062386_101303541 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300004631|Ga0058899_11872146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300004631|Ga0058899_12240572 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | 1460 | Open in IMG/M |
| 3300004635|Ga0062388_100926100 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300004635|Ga0062388_101797747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300005093|Ga0062594_103356254 | Not Available | 503 | Open in IMG/M |
| 3300005186|Ga0066676_11131866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005444|Ga0070694_100276390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1279 | Open in IMG/M |
| 3300005537|Ga0070730_10458472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300005555|Ga0066692_10525228 | Not Available | 751 | Open in IMG/M |
| 3300005557|Ga0066704_10058141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2460 | Open in IMG/M |
| 3300005557|Ga0066704_10228959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1260 | Open in IMG/M |
| 3300005566|Ga0066693_10419815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300005591|Ga0070761_10268198 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300005610|Ga0070763_10971680 | Not Available | 508 | Open in IMG/M |
| 3300005938|Ga0066795_10143060 | Not Available | 713 | Open in IMG/M |
| 3300006052|Ga0075029_100179222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1315 | Open in IMG/M |
| 3300006059|Ga0075017_101325159 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006172|Ga0075018_10814807 | Not Available | 513 | Open in IMG/M |
| 3300006173|Ga0070716_100772063 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300006175|Ga0070712_101622229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300006176|Ga0070765_100688385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300006804|Ga0079221_11638356 | Not Available | 522 | Open in IMG/M |
| 3300006804|Ga0079221_11738455 | Not Available | 509 | Open in IMG/M |
| 3300007255|Ga0099791_10147292 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300007265|Ga0099794_10619690 | Not Available | 573 | Open in IMG/M |
| 3300009038|Ga0099829_10138477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1932 | Open in IMG/M |
| 3300009038|Ga0099829_10320108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
| 3300009088|Ga0099830_11111727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300009090|Ga0099827_10047369 | All Organisms → cellular organisms → Bacteria | 3216 | Open in IMG/M |
| 3300009090|Ga0099827_10637006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300009090|Ga0099827_11153848 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300010046|Ga0126384_11876730 | Not Available | 570 | Open in IMG/M |
| 3300010304|Ga0134088_10429390 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010358|Ga0126370_11208116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300010359|Ga0126376_10993807 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300010360|Ga0126372_11057511 | Not Available | 827 | Open in IMG/M |
| 3300010379|Ga0136449_100877323 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300010401|Ga0134121_11031268 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300011120|Ga0150983_12652603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium rubrum | 941 | Open in IMG/M |
| 3300011270|Ga0137391_10125258 | All Organisms → cellular organisms → Bacteria | 2231 | Open in IMG/M |
| 3300011270|Ga0137391_10164653 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300011270|Ga0137391_10419571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300011270|Ga0137391_11458223 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300012096|Ga0137389_10128823 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300012096|Ga0137389_11371042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300012189|Ga0137388_11571267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300012189|Ga0137388_11767176 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012202|Ga0137363_11675315 | Not Available | 528 | Open in IMG/M |
| 3300012203|Ga0137399_10082576 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300012203|Ga0137399_10271742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 1394 | Open in IMG/M |
| 3300012203|Ga0137399_10736915 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012205|Ga0137362_11007111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia → Nocardia asteroides | 709 | Open in IMG/M |
| 3300012351|Ga0137386_10052408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2822 | Open in IMG/M |
| 3300012351|Ga0137386_10956586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300012354|Ga0137366_10038268 | All Organisms → cellular organisms → Bacteria | 3715 | Open in IMG/M |
| 3300012357|Ga0137384_10293863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1352 | Open in IMG/M |
| 3300012359|Ga0137385_10297602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1389 | Open in IMG/M |
| 3300012359|Ga0137385_10337208 | All Organisms → cellular organisms → Bacteria | 1292 | Open in IMG/M |
| 3300012361|Ga0137360_10646765 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 906 | Open in IMG/M |
| 3300012362|Ga0137361_10026682 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4505 | Open in IMG/M |
| 3300012363|Ga0137390_11687850 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012683|Ga0137398_10011228 | All Organisms → cellular organisms → Bacteria | 4541 | Open in IMG/M |
| 3300012917|Ga0137395_10021138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3788 | Open in IMG/M |
| 3300012918|Ga0137396_10040468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3146 | Open in IMG/M |
| 3300012922|Ga0137394_10675836 | Not Available | 870 | Open in IMG/M |
| 3300012923|Ga0137359_10623767 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300012925|Ga0137419_10785979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 778 | Open in IMG/M |
| 3300012927|Ga0137416_11222703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 677 | Open in IMG/M |
| 3300012929|Ga0137404_10129493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2074 | Open in IMG/M |
| 3300012929|Ga0137404_12282057 | Not Available | 506 | Open in IMG/M |
| 3300012930|Ga0137407_12227733 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300014150|Ga0134081_10035589 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1455 | Open in IMG/M |
| 3300014156|Ga0181518_10543877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300014158|Ga0181521_10390200 | Not Available | 688 | Open in IMG/M |
| 3300014501|Ga0182024_12170892 | Not Available | 609 | Open in IMG/M |
| 3300015052|Ga0137411_1238003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium rubrum | 813 | Open in IMG/M |
| 3300015264|Ga0137403_10442825 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300016357|Ga0182032_10990118 | Not Available | 718 | Open in IMG/M |
| 3300017932|Ga0187814_10209739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300017936|Ga0187821_10153919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300017973|Ga0187780_10078813 | All Organisms → cellular organisms → Bacteria | 2264 | Open in IMG/M |
| 3300017974|Ga0187777_11426984 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300017975|Ga0187782_11498013 | Not Available | 531 | Open in IMG/M |
| 3300018002|Ga0187868_1263662 | Not Available | 577 | Open in IMG/M |
| 3300018006|Ga0187804_10213346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300018006|Ga0187804_10522831 | Not Available | 534 | Open in IMG/M |
| 3300018019|Ga0187874_10257944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300018058|Ga0187766_10625372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300018060|Ga0187765_10267179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1014 | Open in IMG/M |
| 3300018062|Ga0187784_11037482 | Not Available | 651 | Open in IMG/M |
| 3300020579|Ga0210407_10507266 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300020579|Ga0210407_10788421 | Not Available | 733 | Open in IMG/M |
| 3300020580|Ga0210403_10005894 | All Organisms → cellular organisms → Bacteria | 10329 | Open in IMG/M |
| 3300020580|Ga0210403_10504961 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300020582|Ga0210395_10740310 | Not Available | 734 | Open in IMG/M |
| 3300020582|Ga0210395_11169917 | Not Available | 566 | Open in IMG/M |
| 3300020583|Ga0210401_10261997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1588 | Open in IMG/M |
| 3300021088|Ga0210404_10014704 | All Organisms → cellular organisms → Bacteria | 3262 | Open in IMG/M |
| 3300021088|Ga0210404_10669098 | Not Available | 591 | Open in IMG/M |
| 3300021170|Ga0210400_10067769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2790 | Open in IMG/M |
| 3300021171|Ga0210405_10088925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2435 | Open in IMG/M |
| 3300021171|Ga0210405_10405270 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300021180|Ga0210396_11608184 | Not Available | 531 | Open in IMG/M |
| 3300021181|Ga0210388_11110559 | Not Available | 674 | Open in IMG/M |
| 3300021181|Ga0210388_11189127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021406|Ga0210386_10621487 | Not Available | 933 | Open in IMG/M |
| 3300021420|Ga0210394_10021828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5905 | Open in IMG/M |
| 3300021420|Ga0210394_11550766 | Not Available | 559 | Open in IMG/M |
| 3300021433|Ga0210391_10566114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300021433|Ga0210391_11276330 | Not Available | 567 | Open in IMG/M |
| 3300021475|Ga0210392_10189865 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300021477|Ga0210398_10648613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300021478|Ga0210402_10047980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3730 | Open in IMG/M |
| 3300021478|Ga0210402_10814323 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 859 | Open in IMG/M |
| 3300021478|Ga0210402_11647260 | Not Available | 568 | Open in IMG/M |
| 3300021559|Ga0210409_11619904 | Not Available | 523 | Open in IMG/M |
| 3300022532|Ga0242655_10271830 | Not Available | 543 | Open in IMG/M |
| 3300022533|Ga0242662_10055627 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300022713|Ga0242677_1051082 | Not Available | 607 | Open in IMG/M |
| 3300022726|Ga0242654_10246165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300022840|Ga0224549_1044203 | Not Available | 605 | Open in IMG/M |
| 3300024323|Ga0247666_1101738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300024330|Ga0137417_1381769 | Not Available | 3718 | Open in IMG/M |
| 3300025412|Ga0208194_1011984 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300025928|Ga0207700_11629828 | Not Available | 570 | Open in IMG/M |
| 3300025939|Ga0207665_10678616 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300026297|Ga0209237_1041393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2406 | Open in IMG/M |
| 3300026298|Ga0209236_1033590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2714 | Open in IMG/M |
| 3300026548|Ga0209161_10453902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300026551|Ga0209648_10544503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300027173|Ga0208097_1039881 | Not Available | 545 | Open in IMG/M |
| 3300027671|Ga0209588_1036457 | Not Available | 1583 | Open in IMG/M |
| 3300027729|Ga0209248_10017200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2264 | Open in IMG/M |
| 3300027745|Ga0209908_10086116 | Not Available | 757 | Open in IMG/M |
| 3300027768|Ga0209772_10241575 | Not Available | 573 | Open in IMG/M |
| 3300027853|Ga0209274_10061153 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300027867|Ga0209167_10400965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300027875|Ga0209283_10285559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1091 | Open in IMG/M |
| 3300027884|Ga0209275_10477352 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300027905|Ga0209415_10505391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 929 | Open in IMG/M |
| 3300028536|Ga0137415_10021619 | All Organisms → cellular organisms → Bacteria | 6368 | Open in IMG/M |
| 3300028800|Ga0265338_10382886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1006 | Open in IMG/M |
| 3300028906|Ga0308309_10006490 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7120 | Open in IMG/M |
| 3300028906|Ga0308309_10166953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1786 | Open in IMG/M |
| 3300029889|Ga0246001_1079884 | Not Available | 615 | Open in IMG/M |
| 3300030007|Ga0311338_10322172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1695 | Open in IMG/M |
| 3300030057|Ga0302176_10238479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300030707|Ga0310038_10042054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2635 | Open in IMG/M |
| 3300030737|Ga0302310_10089964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1917 | Open in IMG/M |
| 3300030737|Ga0302310_10399628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300030743|Ga0265461_11642631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300031241|Ga0265325_10248671 | Not Available | 806 | Open in IMG/M |
| 3300031708|Ga0310686_112277806 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300031708|Ga0310686_113317962 | Not Available | 582 | Open in IMG/M |
| 3300031720|Ga0307469_10779514 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031720|Ga0307469_11016058 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031720|Ga0307469_12141174 | Not Available | 544 | Open in IMG/M |
| 3300031753|Ga0307477_10751304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031753|Ga0307477_11012828 | Not Available | 544 | Open in IMG/M |
| 3300031754|Ga0307475_10378974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300031837|Ga0302315_10624947 | Not Available | 572 | Open in IMG/M |
| 3300031962|Ga0307479_11889652 | Not Available | 547 | Open in IMG/M |
| 3300032076|Ga0306924_10060827 | All Organisms → cellular organisms → Bacteria | 4194 | Open in IMG/M |
| 3300032160|Ga0311301_10331533 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
| 3300032174|Ga0307470_11714393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300032180|Ga0307471_100612553 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1248 | Open in IMG/M |
| 3300032205|Ga0307472_101708023 | Not Available | 622 | Open in IMG/M |
| 3300032770|Ga0335085_10661984 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300032805|Ga0335078_11981378 | Not Available | 624 | Open in IMG/M |
| 3300032828|Ga0335080_11614350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300032895|Ga0335074_10149704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2955 | Open in IMG/M |
| 3300032895|Ga0335074_10169246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2726 | Open in IMG/M |
| 3300032898|Ga0335072_10318229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1728 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.42% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.31% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.31% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.21% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.66% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.66% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.10% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.10% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.10% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.10% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.10% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.10% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.55% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.55% |
| Peat | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022713 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029889 | Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cm | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031837 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_100142988 | 3300001593 | Forest Soil | TARKVAKAGLVAREELVQLSKQVDSLKRQLQKTTKRLRSALS* |
| Ga0062387_1015317682 | 3300004091 | Bog Forest Soil | RAHKMVKAGSVAKKELAAISKQIDALKKQLQTTTKRMKKALS* |
| Ga0062387_1017780961 | 3300004091 | Bog Forest Soil | ANRSAHEAMGKMDRTAHKVAKAGVVAKHELEQIQKQVESLKKQLQKTTKRLRKALA* |
| Ga0062389_1019067291 | 3300004092 | Bog Forest Soil | HKVAKAGVVAKKELEAISKQVDALKRQLQKTAKRLKVALR* |
| Ga0062386_1013035412 | 3300004152 | Bog Forest Soil | ALGKADRKAHKIVKAGALAKEELHALAKQVEELKRQLEKTTKRLKKAIS* |
| Ga0058899_118721463 | 3300004631 | Forest Soil | AMGKADRTAHKVAKAGLVAKEELVQLSKQVESLKRQLQKTTKRLRSALS* |
| Ga0058899_122405721 | 3300004631 | Forest Soil | MGKADRTAHVTAKKVAKASVVAKSELEHVAKQVEALKKQLAKSTKKLKKALA* |
| Ga0062388_1009261001 | 3300004635 | Bog Forest Soil | MGKANRTAHKVAKAGVMAKKELEQISKQVESLKKQLQKTTKRLRKALA* |
| Ga0062388_1017977471 | 3300004635 | Bog Forest Soil | GAIGKADRTAHKVAKAGVLAKKELEALSKEVDGLKKRLQKTTKRLKNALS* |
| Ga0062594_1033562541 | 3300005093 | Soil | AIGKADRKAHKVVEAGALAKEELLAISKQVGALKRQLEQTTKRLKRALT* |
| Ga0066676_111318661 | 3300005186 | Soil | AMGRADRKAHQIARAGVLAKKELADISKQVDALKRQLQKTTKRLRRALV* |
| Ga0070694_1002763902 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | ADRAAHKVAKAGGAAKKELQEISKQVDALKKQLQKTTKRLRAALS* |
| Ga0070730_104584721 | 3300005537 | Surface Soil | AHKVVAAGALAKKELQAISKQVDALKRQLEKTTKHLKRALT* |
| Ga0066692_105252281 | 3300005555 | Soil | HQVAKAGVLAKKELKEIGKQVDALKRQLRKTTKRLKSALS* |
| Ga0066704_100581412 | 3300005557 | Soil | KAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0066704_102289591 | 3300005557 | Soil | MGRADRKAHQIARAGVLAKKELADISKQVDALKRQLQKTTKRLRRALV* |
| Ga0066693_104198151 | 3300005566 | Soil | KADRAAHKVAKAGSLAKKELQEISKQVDALKKQLQKTTKRLRAALS* |
| Ga0070761_102681983 | 3300005591 | Soil | VAKAGVLAKKELEALSKEVDSLKKRLQKTTKRLRNALS* |
| Ga0070763_109716802 | 3300005610 | Soil | AFGKADRKAHKVVEAGALAKEELLAISKQVGALKRQLEKTTKRLKRALN* |
| Ga0066795_101430601 | 3300005938 | Soil | AGVVAKKELAAISKQVEALKQQLQKATKRLKHALR* |
| Ga0075029_1001792221 | 3300006052 | Watersheds | RADRTAHKVARAGVVAKKDLAAISKQVEALKKQLQKTTKRLKHALR* |
| Ga0075017_1013251591 | 3300006059 | Watersheds | AGVVAKHELEQIQKQVESLKKQLQKTTKRLRKALA* |
| Ga0075018_108148071 | 3300006172 | Watersheds | GVLAKKELRAISKQVDALKRQLRKTTKRLKNALS* |
| Ga0070716_1007720631 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VAKAGGVAKKELQEISKQVDALKKQLQKTTKRLRAALS* |
| Ga0070712_1016222291 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KAGSVAKKELQEISKQVDALKKQLQKTTKRLRAALS* |
| Ga0070765_1006883851 | 3300006176 | Soil | GKADRKAHKVVEAGALAKEELLAISKQVGALKRQLEKTTKRLKRALN* |
| Ga0079221_116383561 | 3300006804 | Agricultural Soil | RADRKAHKVVAAGAVAKKELQAIAKQVGALKRQLDKTTKRLKHALS* |
| Ga0079221_117384551 | 3300006804 | Agricultural Soil | GRADRKAHQVAKAGVVAKKELEAIGKQVDALKKQLQKTTKRLKAALR* |
| Ga0099791_101472921 | 3300007255 | Vadose Zone Soil | RKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0099794_106196901 | 3300007265 | Vadose Zone Soil | GKADRKAHQVAKAGLVAKEELEDIGKQVEALKRQLQKTTKRVRKALS* |
| Ga0099829_101384771 | 3300009038 | Vadose Zone Soil | KAGVLAKRELEDISKKVEALKRQLQKNTRRLKRDLA* |
| Ga0099829_103201083 | 3300009038 | Vadose Zone Soil | IGKADRKAHQVAKAGLVAKEELEDIGKQVEALKRQLQKTTKRLRKALS* |
| Ga0099830_111117271 | 3300009088 | Vadose Zone Soil | DRKAHQIAKAGVLAKKELADISKQVEALKRQLQKTTKRLRRALA* |
| Ga0099827_100473693 | 3300009090 | Vadose Zone Soil | MGKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALA* |
| Ga0099827_106370061 | 3300009090 | Vadose Zone Soil | MGKADRKAHQIVKAGKLAKKELADISKQVDALKRQLQAATT |
| Ga0099827_111538482 | 3300009090 | Vadose Zone Soil | DRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALA* |
| Ga0126384_118767301 | 3300010046 | Tropical Forest Soil | RKAHQVAKAGPLAKKELKQIGNQIELPKRQLEQSAKRVQRDIG* |
| Ga0134088_104293902 | 3300010304 | Grasslands Soil | MGKADRKAHQIVKAGKLAKKELADISKQVDALKRQLQAATKRLKRALS* |
| Ga0126370_112081161 | 3300010358 | Tropical Forest Soil | DRTAHKVAKAGAVAKEELAAIAKQVDALKKQLQKTTKRLKRALG* |
| Ga0126376_109938072 | 3300010359 | Tropical Forest Soil | HKFAKAGALAKSELADISKQVESLKKQLAKTTKKLRLALR* |
| Ga0126372_110575112 | 3300010360 | Tropical Forest Soil | IGAAMGRADRTAHKVAKAGAVAKEELAAIAKQVDALKKQLQKTTKRLKRALG* |
| Ga0136449_1008773234 | 3300010379 | Peatlands Soil | ARAGVLAKSELEDISKQVDALRKQLVKTTKKLKKALA* |
| Ga0134121_110312681 | 3300010401 | Terrestrial Soil | KAGGVAKKELQEISKQVDALKKQLQKTTKRLRAALS* |
| Ga0150983_126526032 | 3300011120 | Forest Soil | MGKADRKAHQIVKAGKLAKEELADISKQVDALKRQLQTTTKRLRRALS* |
| Ga0137391_101252583 | 3300011270 | Vadose Zone Soil | MGKADRKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQ |
| Ga0137391_101646531 | 3300011270 | Vadose Zone Soil | MGKADRRAHKVAKAGALAKKELEGLAKQVDVLKRQLQKSTKRLKRALA* |
| Ga0137391_104195711 | 3300011270 | Vadose Zone Soil | KAHQVVKAGKLAKKELADISKQVDALKRQMQTTTKRLKRALT* |
| Ga0137391_114582231 | 3300011270 | Vadose Zone Soil | GKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALT* |
| Ga0137389_101288235 | 3300012096 | Vadose Zone Soil | AKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137389_113710421 | 3300012096 | Vadose Zone Soil | MGKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLLRSTKRLKRALV* |
| Ga0137388_115712671 | 3300012189 | Vadose Zone Soil | KAGVLAKRELEDISKQVDALKRQLQKTTKRLRRALI* |
| Ga0137388_117671762 | 3300012189 | Vadose Zone Soil | RRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALA* |
| Ga0137363_116753152 | 3300012202 | Vadose Zone Soil | KAHQVAKAGLVAKEELEEVAKQVEALKRQLQKTTKRLKKALK* |
| Ga0137399_100825761 | 3300012203 | Vadose Zone Soil | MGRADRKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQTSKRLRKALS* |
| Ga0137399_102717423 | 3300012203 | Vadose Zone Soil | MGKADRKAHQIVKAGKLAKEELADISKQVEALKRQLQTTTKRLRRALS* |
| Ga0137399_107369151 | 3300012203 | Vadose Zone Soil | MGRADRKAHQVAAAGLVAKQELEEIAKQVEVLKRQLQKTTKRLKVALR* |
| Ga0137362_110071112 | 3300012205 | Vadose Zone Soil | GRADRKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137386_100524084 | 3300012351 | Vadose Zone Soil | MGKADRKAHQIVKAGKLAKKELADISKQVDALKRQLQTTTKRLRRALT* |
| Ga0137386_109565861 | 3300012351 | Vadose Zone Soil | RKAHQIAKAGVLAKKELADISKQVDALKRQLLKTTKRLKRALA* |
| Ga0137366_100382686 | 3300012354 | Vadose Zone Soil | MGKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKLLKRALA* |
| Ga0137384_102938631 | 3300012357 | Vadose Zone Soil | AAHKVAKAGVVAKKELAAISKQVAALKKQLQKTTKRLQRAPR* |
| Ga0137385_102976021 | 3300012359 | Vadose Zone Soil | IGAAMGRADRKAHQIARAGVLAKKELADISKQVDALKRQLQKTTKRLRRALV* |
| Ga0137385_103372081 | 3300012359 | Vadose Zone Soil | IGAAMGKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALA* |
| Ga0137360_106467651 | 3300012361 | Vadose Zone Soil | IGKADRKAHQVAKAGLIAKQELEDIAKQVEALKRQLQKTTKRLKAALS* |
| Ga0137361_100266823 | 3300012362 | Vadose Zone Soil | ADRKAQQVAKAGVLAKKELRAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137390_116878501 | 3300012363 | Vadose Zone Soil | ADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALT* |
| Ga0137398_100112287 | 3300012683 | Vadose Zone Soil | KADRKAHQVARAGVMAKAELEQIAKQVDTLKRQLQKTTKRLKKALS* |
| Ga0137395_100211382 | 3300012917 | Vadose Zone Soil | MGKADRKAHQIVKAGKLAKKELADISKQVDTLKRQLQAATKRLRRALG* |
| Ga0137396_100404681 | 3300012918 | Vadose Zone Soil | RADRKAHQVAKAGVLAKKELQAISKQVDVLKRQLLQTTRRLRKALS* |
| Ga0137394_106758362 | 3300012922 | Vadose Zone Soil | VAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137359_106237671 | 3300012923 | Vadose Zone Soil | KAHQVAAAGLVAKQELEEIAKQVEALKRQLQKTTKRLKAALR* |
| Ga0137419_107859792 | 3300012925 | Vadose Zone Soil | QVAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137416_112227032 | 3300012927 | Vadose Zone Soil | PESCKAGSLAKKELDAISKQVDALKRQLQKTAKRLKRALS* |
| Ga0137404_101294931 | 3300012929 | Vadose Zone Soil | AAMGRADRKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS* |
| Ga0137404_122820571 | 3300012929 | Vadose Zone Soil | QQVAKAGVLAKKELHAISKQVDGLKRQLLQTTKRLRKALS* |
| Ga0137407_122277331 | 3300012930 | Vadose Zone Soil | QVAKAGVLGKKELHAISRQVDVFRRQLLQTTKRLRKALS* |
| Ga0134081_100355891 | 3300014150 | Grasslands Soil | IGAAMGKADRAAHKVAKAGVVAKKELAAISKQVAALKKQLQKTTKRLQRALR* |
| Ga0181518_105438772 | 3300014156 | Bog | VAKAGVVAKKELAAISKQVEALKKQLQKTTKRLKYALR* |
| Ga0181521_103902004 | 3300014158 | Bog | GVVAKKELAAISKQVEALKKQLLKTTKRLQSALR* |
| Ga0182024_121708922 | 3300014501 | Permafrost | GKADRTAHKVAKAGVLAKKELAAISRQVEALKKQLQKTTNRLRNALS* |
| Ga0137411_12380033 | 3300015052 | Vadose Zone Soil | MGKADRKAHQIVKAGKLAKEELADISKQVEALKRQLQTTTKR |
| Ga0137403_104428251 | 3300015264 | Vadose Zone Soil | VGKADRKAHQVAAAGLVAKKELESIAKQVEGLKKQLLRTTKRLKAALR* |
| Ga0182032_109901181 | 3300016357 | Soil | KADRKAHQVAKAGVLAKKELKEIGKQVEALKRQLQKTTRRLTHALR |
| Ga0187814_102097391 | 3300017932 | Freshwater Sediment | VVGRAEGTAKKIAKAGVVAKKELEAISKQVEGLKKQLEKTTKRLKHALR |
| Ga0187801_100232811 | 3300017933 | Freshwater Sediment | KIGSVVGKADRTAHKVVKAGTVAKKELAAISKQVEALKKQLQKTTKKLQRALR |
| Ga0187821_101539191 | 3300017936 | Freshwater Sediment | ADRTAHKVAKAGVLAKRELADISKQVDALKRQLQKTTKRLKRALT |
| Ga0187780_100788131 | 3300017973 | Tropical Peatland | TAHKVAKAGAVAKKELEALTKEIDSLKKRLLKTTKRLQKALR |
| Ga0187777_114269841 | 3300017974 | Tropical Peatland | AVGKADRKAHQVAKAGALAKGELKEIAKQVDALKRQLQKTTKRLKRALS |
| Ga0187782_114980131 | 3300017975 | Tropical Peatland | AHKVAKAGVVAKKELAAISKQVEALKKQLQKTTKRLQHALR |
| Ga0187782_116032761 | 3300017975 | Tropical Peatland | TAHKVRKAGVVARKELDDLTKQIDVLKRQVVKTTKRLKRALA |
| Ga0187868_12636622 | 3300018002 | Peatland | HKVAKAGVLAKKELAAISKQVDALKKQLRTTTKRLKRALA |
| Ga0187804_102133462 | 3300018006 | Freshwater Sediment | AMGRADRKAHQIAKAGVVAKKELADISKQVDALKRQLQKTTKRLKRALA |
| Ga0187804_105228311 | 3300018006 | Freshwater Sediment | KADRKAHQIAQAGSLAKKELQALTKQVDSLKRQLEKTTARLKRALI |
| Ga0187874_102579441 | 3300018019 | Peatland | KAGVLAKKELEALSKEVDGLKKRLQKTTKRLKNALS |
| Ga0187766_106253721 | 3300018058 | Tropical Peatland | KKAGVVAREELDDLTKQIEALKRQLQKTTKRLKRALA |
| Ga0187765_102671791 | 3300018060 | Tropical Peatland | MGKADRTAHKIAKAGGVAKAELDDISEQIDALKRQLQKTSKRLRAALR |
| Ga0187784_110374821 | 3300018062 | Tropical Peatland | RIGTAVGTADATAHKVAKASVVARKELEDISKQLESLKRQLQKTSKRIRKAMA |
| Ga0210407_105072662 | 3300020579 | Soil | GTAMGKANRTAHKVAKAGVMAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0210407_107884211 | 3300020579 | Soil | DRTAHKVAKAGVLAKQELEDISKQVEGLKRQLLKTTKRLQKALR |
| Ga0210403_100058948 | 3300020580 | Soil | MGKADRTAHKVAKAGVLAKKELEDISKQVDGLKKQLLKTTKRLQKALR |
| Ga0210403_105049611 | 3300020580 | Soil | KVAKAGVMAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0210395_107403101 | 3300020582 | Soil | IGTAMGKANRTAHKVAKAGVLAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0210395_111699171 | 3300020582 | Soil | RKGTAVDKADRKAHKFAKAGGVAKKELDEISKQVDALKKQLLKTTKRLKAALS |
| Ga0210401_102619971 | 3300020583 | Soil | ALGKADRKAHQVVRAGTLAKKELQDITKQVDALKRQLAKTSKRLRHALS |
| Ga0210404_100147045 | 3300021088 | Soil | IGSAVGRADRKAHQVAKAGVLAKKELQDISKQVDALKRQLLKTTKRLKKALS |
| Ga0210404_106690981 | 3300021088 | Soil | IGKAMGKADRKAHQVAKAGVMAKEELEEIAKQVEVLKRQLLKTTKRLKSALR |
| Ga0210400_100677695 | 3300021170 | Soil | IGTASGKADRKAHQVAKAGPVVKQELEDIGKQVEALKRQLLKTTKRLKRALR |
| Ga0210405_100889253 | 3300021171 | Soil | HKVAKAGVVAKQELVELSKQVESLKRQIQKTTKRLKHALS |
| Ga0210405_104052701 | 3300021171 | Soil | AKAGVLAKKELEALSKEVDSLKKRLQKTTKRLRNALS |
| Ga0210396_116081842 | 3300021180 | Soil | AHKVAKAGVVAKQELVELSKQVESLKRQIQKTTKRLKHALS |
| Ga0210388_111105592 | 3300021181 | Soil | KVAKAGVVAKQELVELSKQVESLKRQIQKTTKRLKHALS |
| Ga0210388_111891271 | 3300021181 | Soil | TAHKVAKAGVLAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0210386_106214873 | 3300021406 | Soil | GAAMGRADRKAHQVAKAGVMAKKELAAISGQVEALKKQLQKTTKKLKKALA |
| Ga0210394_100218282 | 3300021420 | Soil | MGRADRTAHKVAKAGVLAKSELKDISKQVEALKKQLMKTTKRLQKALS |
| Ga0210394_115507662 | 3300021420 | Soil | KADRKAHQVVQAGTLAKKELQDITKQVDALKRQLAKTSKRLKHALS |
| Ga0210391_105661141 | 3300021433 | Soil | AFGKADRKAHKVVEAGALAKEELLAISKQVGALKRQLEKTTKRLKRALN |
| Ga0210391_112763301 | 3300021433 | Soil | HKVAKAGRVAKKELDELSKEVESLKKRLQKATKRLQHALR |
| Ga0210392_101898653 | 3300021475 | Soil | GTAMGKANRTAHKVAKAGVLAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0210398_106486132 | 3300021477 | Soil | ALGKADRKAHQVVRAGTLAKKELHDISKQVDALKRQLAKTTKRLKNALS |
| Ga0210402_100479802 | 3300021478 | Soil | VTTDRKTHLIADAGVLAKKELADISEQVDALKRQLQKTTKPRKRALS |
| Ga0210402_108143231 | 3300021478 | Soil | LGKANKKAHQLSHAGQVAKEELLAISKQVEDLKRQLEKTTKRLKKAIS |
| Ga0210402_116472602 | 3300021478 | Soil | TLGKANKKAHQLSQAGQVAKEELYAISKQVEELKRQLEKTTKRLKKAIS |
| Ga0210409_116199041 | 3300021559 | Soil | YAKAGTLAKKELEDISKQVDALKRQLRKTAKRLKRALS |
| Ga0242655_102718301 | 3300022532 | Soil | MGKADRTAHKVAKAGLVAKEELVQLSKQVESLKRQLQKTTKRLRSALS |
| Ga0242662_100556272 | 3300022533 | Soil | MGKANRTAHKVAKAGVLAKRELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0242677_10510822 | 3300022713 | Soil | ANRTAHKVAKAGVMAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0242654_102461651 | 3300022726 | Soil | TAIGKADRKAHQVAKAGPVVKQELEDIGKQVEALKRQLLKTTKRLKRALR |
| Ga0224549_10442031 | 3300022840 | Soil | VKAGAVARKELDAISKQLDALKKQLLKTSKRIKTALA |
| Ga0247666_11017381 | 3300024323 | Soil | RADRKAHQVAKAGLVAKKELEDIAKQVEGLKKQLLRTTKRLKAALR |
| Ga0137417_13817696 | 3300024330 | Vadose Zone Soil | MGKADRKASNRKAGVLAKKELHTISKQVDVLKRQLLQTTKRLRKALS |
| Ga0208194_10119841 | 3300025412 | Peatland | DRTAHKVAKAGVLAKKELEALSKEVDGLKKRLQKTTKRLKNALS |
| Ga0207700_116298281 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GKADRKAHKLAQAGLIAKQELDDITKQADALKRQLQKTTKRLKRALL |
| Ga0207665_106786162 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | GKADRAAHKVAKAGGVAKKELEQISKQVDALKKQLQKTTKRLRAALS |
| Ga0209237_10413933 | 3300026297 | Grasslands Soil | MGRADRKAHQIVKAGKLAKKELADISKQVDALKRQLQAATKRLKRALS |
| Ga0209236_10335901 | 3300026298 | Grasslands Soil | AKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS |
| Ga0209161_104539021 | 3300026548 | Soil | KIGAAMGKADRAAHKVAKAGVVAKKELAAISKQVAALKKQLQKTTKRLQRAPR |
| Ga0209648_105445031 | 3300026551 | Grasslands Soil | AHQVVKAGKLAKKELADISKQVDALKRQLQTATKRLRRALT |
| Ga0208097_10398811 | 3300027173 | Forest Soil | HKVAKAGQVAKKELDELSKEVESLKKRLQKATKRLQHALR |
| Ga0209588_10364571 | 3300027671 | Vadose Zone Soil | AMGRADRKAQQVAKAGVLAKKELHAISKQVDVLKRQLLQTTKRLRKALS |
| Ga0209248_100172001 | 3300027729 | Bog Forest Soil | RTAHKVAKAGVLAKAELADISKQVDALKRQLQKTTKRLRRALS |
| Ga0209908_100861162 | 3300027745 | Thawing Permafrost | MCIRDSDRTAHKVAKAGVLAKKELEALSKEVDSLKKRLQKTTKRLRNALS |
| Ga0209772_102415751 | 3300027768 | Bog Forest Soil | DRKAHQFAKAGALAKNELEEISKQVDALKRQLQKTTKRLRSALR |
| Ga0209177_105059111 | 3300027775 | Agricultural Soil | KIGGAIGRADRKAHKVVAAGAVAKKELQAIAKQVGALKRQLDKTTKRLKHALS |
| Ga0209274_100611531 | 3300027853 | Soil | IGKADRTAHKVAKAGVLAKKELEALSKEVDSLKKRLQKTTKRLRNALS |
| Ga0209167_104009652 | 3300027867 | Surface Soil | IGKADRKAHKVVEAGALAKEELLEIAKQVGALKRQLEKTTKRLKRALT |
| Ga0209283_102855591 | 3300027875 | Vadose Zone Soil | KIGAAMGKADRRAHKVAKAGALAKKELEGLAKQVDALKRQLQKSTKRLKRALA |
| Ga0209275_104773521 | 3300027884 | Soil | GKANRTAHKVAKAGVMAKKELEDISKQVEALKKQLQKTTKRLRKALA |
| Ga0209415_105053913 | 3300027905 | Peatlands Soil | RTAHKVVKAGTVAKKELAAISKQVEALKKQLQKTTKKLQRALR |
| Ga0137415_100216194 | 3300028536 | Vadose Zone Soil | MGKADRKAHQVAAAGLVAKQELEEIAKQVEALKRQLQKTTKRLKAALQ |
| Ga0265338_103828863 | 3300028800 | Rhizosphere | RAHKVAKAGVLAKKELAAISKQVDALKKQLLKTSVRLKKALS |
| Ga0308309_1000649010 | 3300028906 | Soil | HKVAKAGVLAKKELEALSKEVDSLKKRLQKTTKRLRNALS |
| Ga0308309_101669531 | 3300028906 | Soil | KVAKAGVVAKHELEQIQKQVESLKKQLQKTTKRLRKALA |
| Ga0246001_10798841 | 3300029889 | Peat | KADRTAHKVAKAGVVAKEELEAISKQVEVLKKQLLKTTKRLKQALR |
| Ga0311338_103221723 | 3300030007 | Palsa | SIGAAMGKADRTAHKVAKAGVVAKQELVQLSKQVESLKRQLQKTTKRLRKALS |
| Ga0302176_102384792 | 3300030057 | Palsa | RTAHKVARAGVMAKSELEDISKQVDALKQQLMKTTKRLKKALS |
| Ga0310038_100420541 | 3300030707 | Peatlands Soil | GAAIGKADRTAHKVAKAGVVAKNELEDISKRIDALKRQLLKTTKRLKKALA |
| Ga0302310_100899641 | 3300030737 | Palsa | AGAMAKEELEEISKQVDGLKRQLQKTTKRLQRALR |
| Ga0302310_103996281 | 3300030737 | Palsa | DRTAHKVAKAGVVAREELIQLSKQVELLKRQLQKTTKRLKNALT |
| Ga0265461_116426311 | 3300030743 | Soil | RADRTAHKVAKAGMVAREELIQLSKQVESLKRQLQKTTKRLKNALT |
| Ga0265325_102486711 | 3300031241 | Rhizosphere | KVARAGVVAKKELAAISKQVEALKKQLLKTTKRLQSALR |
| Ga0310686_1122778063 | 3300031708 | Soil | AHKVAKAGVLAKKELEALSKEVDSLKKRLQKTTKRLKNALS |
| Ga0310686_1133179621 | 3300031708 | Soil | AGAVAKKELAVISKQVEALKKQLQKTTERLKRALS |
| Ga0307469_107795141 | 3300031720 | Hardwood Forest Soil | IGGSLGKADRAAHKVAKAGSVAKKELQEISKQVDALKKQLQKTTKRLRAALS |
| Ga0307469_110160582 | 3300031720 | Hardwood Forest Soil | RKAQQVAKAGVLAKKELHAISKQVDGLKRQLLQTTKRLRKALS |
| Ga0307469_121411741 | 3300031720 | Hardwood Forest Soil | ADRKAQQVAKAGVLAKKELRAISKQVDGLKRQLLQTTKRLRKALS |
| Ga0307477_107513042 | 3300031753 | Hardwood Forest Soil | GKANRTAHKVAKAGVLAKKELEQISKQVESLKKQLQKTTKRLRKALA |
| Ga0307477_110128281 | 3300031753 | Hardwood Forest Soil | QIANAGVLAKKELADISRQVDALKRQLQKTTKRLKRALS |
| Ga0307475_103789741 | 3300031754 | Hardwood Forest Soil | IGRADRKAHQVAKAGGVAKKELEAIGKQVDALKKQLQKTTKRMKAALR |
| Ga0302315_106249471 | 3300031837 | Palsa | AKAGVVAREELIQLSKQVELLKRQLQKTTKRLKNALT |
| Ga0307479_118896522 | 3300031962 | Hardwood Forest Soil | AHQVAKAGGVAKKELEAIGKQVDALKKQLQKTTKRLKAALR |
| Ga0306924_100608273 | 3300032076 | Soil | KADRTAHKVAKAGVAAREELEEIAKQIDALKRQLVKTTKRLKRALA |
| Ga0311301_103315333 | 3300032160 | Peatlands Soil | AHKVAKAGVCAKKELAAISKQVEALKKQLQKTTKRLKYALR |
| Ga0307470_117143932 | 3300032174 | Hardwood Forest Soil | DRKAHQVAKAGVLAKKELQDISKQVDALKRQLLKTTKRLKNALS |
| Ga0307471_1006125531 | 3300032180 | Hardwood Forest Soil | RKAHQVAKAGLVAKEELEEVAKQVEALKRQLQKTTKRLKKALK |
| Ga0307472_1017080231 | 3300032205 | Hardwood Forest Soil | IGSAMGRANRTAQKVAKAGVMAKKELEQISKQVESLKKQLQKTTKRLRKALA |
| Ga0335085_106619841 | 3300032770 | Soil | AAIGKADRTAHKVAKAGVIAKGELDDIAKQVEALKKQLVKTTRKLKKALA |
| Ga0335078_119813781 | 3300032805 | Soil | KVARAGVVAKKELAAISKQVEALKKQLQKTTKRLKAALR |
| Ga0335080_116143501 | 3300032828 | Soil | KADRKAHQVVRAGALAKEELKEIAKQVDALKRQLEKTTKRLKKALT |
| Ga0335074_101497041 | 3300032895 | Soil | KVVKAGAVAKKELAAISKQVEALKKQLQRTTKKLQKALR |
| Ga0335074_101692464 | 3300032895 | Soil | RTAHKVAKAGVVAKKELAAISKQVEALKKQLQKTTKKLQKALR |
| Ga0335072_103182293 | 3300032898 | Soil | TIGSVMGRADRTAHKVAKAGVVAKKELAAISKQVEALKKQLQTTTKKLQKALS |
| ⦗Top⦘ |