


| Basic Information | |
|---|---|
| Family ID | F031468 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV |
| Number of Associated Samples | 124 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.73 % |
| % of genes near scaffold ends (potentially truncated) | 28.57 % |
| % of genes from short scaffolds (< 2000 bps) | 74.18 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.945 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.132 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.473 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF11753 | DUF3310 | 49.45 |
| PF07486 | Hydrolase_2 | 12.09 |
| PF00565 | SNase | 4.95 |
| PF04545 | Sigma70_r4 | 2.20 |
| PF00271 | Helicase_C | 2.20 |
| PF00476 | DNA_pol_A | 2.20 |
| PF01612 | DNA_pol_A_exo1 | 1.65 |
| PF12705 | PDDEXK_1 | 1.65 |
| PF01870 | Hjc | 0.55 |
| PF10991 | DUF2815 | 0.55 |
| PF00847 | AP2 | 0.55 |
| PF07728 | AAA_5 | 0.55 |
| PF03237 | Terminase_6N | 0.55 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.55 |
| PF06048 | DUF927 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 12.09 |
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 2.20 |
| COG1591 | Holliday junction resolvase Hjc, archaeal type | Replication, recombination and repair [L] | 0.55 |
| COG5519 | Predicted ATPase domain of Cch-like helicases, DUF927 family | General function prediction only [R] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.95 % |
| All Organisms | root | All Organisms | 45.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10001111 | Not Available | 22141 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10011654 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 5602 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10043186 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10051733 | All Organisms → Viruses → Predicted Viral | 2046 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10100880 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10250760 | Not Available | 557 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10005809 | Not Available | 6781 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10026574 | All Organisms → Viruses → Predicted Viral | 2749 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10118928 | Not Available | 957 | Open in IMG/M |
| 3300001351|JGI20153J14318_10001086 | Not Available | 21750 | Open in IMG/M |
| 3300001351|JGI20153J14318_10074150 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300001938|GOS2221_1016880 | All Organisms → Viruses → Predicted Viral | 1676 | Open in IMG/M |
| 3300002134|M2t6FKB2_1165681 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300003216|JGI26079J46598_1032812 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300003617|JGI26082J51739_10124692 | Not Available | 618 | Open in IMG/M |
| 3300004448|Ga0065861_1042311 | All Organisms → Viruses → Predicted Viral | 2421 | Open in IMG/M |
| 3300004448|Ga0065861_1142202 | Not Available | 902 | Open in IMG/M |
| 3300004448|Ga0065861_1150566 | Not Available | 666 | Open in IMG/M |
| 3300004457|Ga0066224_1037937 | Not Available | 780 | Open in IMG/M |
| 3300004457|Ga0066224_1037938 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 709 | Open in IMG/M |
| 3300004457|Ga0066224_1037939 | Not Available | 553 | Open in IMG/M |
| 3300004457|Ga0066224_1212605 | Not Available | 620 | Open in IMG/M |
| 3300004461|Ga0066223_1152808 | Not Available | 718 | Open in IMG/M |
| 3300005086|Ga0072334_10388159 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1102 | Open in IMG/M |
| 3300005512|Ga0074648_1102552 | Not Available | 999 | Open in IMG/M |
| 3300005823|Ga0078745_1119900 | Not Available | 743 | Open in IMG/M |
| 3300006025|Ga0075474_10088363 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1010 | Open in IMG/M |
| 3300006025|Ga0075474_10102601 | Not Available | 923 | Open in IMG/M |
| 3300006026|Ga0075478_10046914 | All Organisms → Viruses → Predicted Viral | 1420 | Open in IMG/M |
| 3300006029|Ga0075466_1114081 | Not Available | 722 | Open in IMG/M |
| 3300006637|Ga0075461_10026494 | All Organisms → Viruses → Predicted Viral | 1912 | Open in IMG/M |
| 3300006752|Ga0098048_1000565 | Not Available | 17486 | Open in IMG/M |
| 3300006752|Ga0098048_1045727 | All Organisms → Viruses → Predicted Viral | 1386 | Open in IMG/M |
| 3300006802|Ga0070749_10121675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1532 | Open in IMG/M |
| 3300006802|Ga0070749_10205042 | All Organisms → Viruses → Predicted Viral | 1129 | Open in IMG/M |
| 3300006802|Ga0070749_10224613 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300006802|Ga0070749_10348890 | Not Available | 823 | Open in IMG/M |
| 3300006802|Ga0070749_10743839 | Not Available | 522 | Open in IMG/M |
| 3300006810|Ga0070754_10022743 | All Organisms → Viruses → Predicted Viral | 3619 | Open in IMG/M |
| 3300006810|Ga0070754_10497031 | Not Available | 525 | Open in IMG/M |
| 3300006867|Ga0075476_10139086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 912 | Open in IMG/M |
| 3300006916|Ga0070750_10409113 | Not Available | 565 | Open in IMG/M |
| 3300006919|Ga0070746_10522320 | Not Available | 518 | Open in IMG/M |
| 3300006920|Ga0070748_1093899 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300006920|Ga0070748_1230907 | Not Available | 669 | Open in IMG/M |
| 3300006947|Ga0075444_10404563 | Not Available | 512 | Open in IMG/M |
| 3300007231|Ga0075469_10016896 | All Organisms → Viruses → Predicted Viral | 2542 | Open in IMG/M |
| 3300007276|Ga0070747_1189393 | Not Available | 728 | Open in IMG/M |
| 3300007276|Ga0070747_1237080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
| 3300007344|Ga0070745_1042765 | All Organisms → Viruses → Predicted Viral | 1895 | Open in IMG/M |
| 3300007344|Ga0070745_1204848 | Not Available | 727 | Open in IMG/M |
| 3300007345|Ga0070752_1174719 | Not Available | 870 | Open in IMG/M |
| 3300007538|Ga0099851_1036107 | All Organisms → Viruses → Predicted Viral | 1969 | Open in IMG/M |
| 3300007538|Ga0099851_1238113 | Not Available | 654 | Open in IMG/M |
| 3300007538|Ga0099851_1243528 | Not Available | 645 | Open in IMG/M |
| 3300007540|Ga0099847_1075281 | All Organisms → Viruses → Predicted Viral | 1042 | Open in IMG/M |
| 3300007541|Ga0099848_1110534 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300007541|Ga0099848_1288781 | Not Available | 565 | Open in IMG/M |
| 3300007541|Ga0099848_1330242 | Not Available | 518 | Open in IMG/M |
| 3300007609|Ga0102945_1023936 | Not Available | 1323 | Open in IMG/M |
| 3300007609|Ga0102945_1057938 | Not Available | 743 | Open in IMG/M |
| 3300007960|Ga0099850_1097282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1217 | Open in IMG/M |
| 3300009027|Ga0102957_1276994 | Not Available | 611 | Open in IMG/M |
| 3300009071|Ga0115566_10711691 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 556 | Open in IMG/M |
| 3300009076|Ga0115550_1037734 | All Organisms → Viruses → Predicted Viral | 2082 | Open in IMG/M |
| 3300009076|Ga0115550_1088330 | All Organisms → Viruses → Predicted Viral | 1168 | Open in IMG/M |
| 3300009077|Ga0115552_1132867 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1055 | Open in IMG/M |
| 3300009124|Ga0118687_10031361 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300009172|Ga0114995_10035342 | Not Available | 2910 | Open in IMG/M |
| 3300009428|Ga0114915_1000581 | Not Available | 16553 | Open in IMG/M |
| 3300009428|Ga0114915_1006872 | All Organisms → Viruses → Predicted Viral | 4518 | Open in IMG/M |
| 3300009433|Ga0115545_1316049 | Not Available | 518 | Open in IMG/M |
| 3300009435|Ga0115546_1147639 | Not Available | 831 | Open in IMG/M |
| 3300009472|Ga0115554_1067525 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1574 | Open in IMG/M |
| 3300009507|Ga0115572_10438487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 728 | Open in IMG/M |
| 3300009509|Ga0123573_10543687 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300009529|Ga0114919_10990406 | Not Available | 566 | Open in IMG/M |
| 3300009606|Ga0115102_10633019 | Not Available | 907 | Open in IMG/M |
| 3300010368|Ga0129324_10029663 | All Organisms → Viruses → Predicted Viral | 2624 | Open in IMG/M |
| 3300010413|Ga0136851_10479367 | Not Available | 1243 | Open in IMG/M |
| 3300010430|Ga0118733_107414112 | Not Available | 569 | Open in IMG/M |
| 3300010883|Ga0133547_11494315 | All Organisms → Viruses → Predicted Viral | 1269 | Open in IMG/M |
| 3300011118|Ga0114922_10104819 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2419 | Open in IMG/M |
| 3300011118|Ga0114922_11395568 | Not Available | 564 | Open in IMG/M |
| 3300011128|Ga0151669_129774 | Not Available | 731 | Open in IMG/M |
| 3300017719|Ga0181390_1056696 | All Organisms → Viruses → Predicted Viral | 1135 | Open in IMG/M |
| 3300017719|Ga0181390_1110397 | Not Available | 726 | Open in IMG/M |
| 3300017719|Ga0181390_1171669 | Not Available | 535 | Open in IMG/M |
| 3300017746|Ga0181389_1019781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2121 | Open in IMG/M |
| 3300017748|Ga0181393_1093651 | Not Available | 779 | Open in IMG/M |
| 3300017749|Ga0181392_1033337 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
| 3300017751|Ga0187219_1033884 | All Organisms → Viruses → Predicted Viral | 1772 | Open in IMG/M |
| 3300017762|Ga0181422_1159778 | Not Available | 689 | Open in IMG/M |
| 3300017767|Ga0181406_1186667 | Not Available | 618 | Open in IMG/M |
| 3300017776|Ga0181394_1123365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 816 | Open in IMG/M |
| 3300017776|Ga0181394_1204720 | Not Available | 600 | Open in IMG/M |
| 3300017781|Ga0181423_1125783 | Not Available | 995 | Open in IMG/M |
| 3300017824|Ga0181552_10504595 | Not Available | 569 | Open in IMG/M |
| 3300017950|Ga0181607_10003010 | Not Available | 14786 | Open in IMG/M |
| 3300017963|Ga0180437_10329663 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1155 | Open in IMG/M |
| 3300017967|Ga0181590_10780010 | Not Available | 637 | Open in IMG/M |
| 3300018036|Ga0181600_10108627 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1617 | Open in IMG/M |
| 3300018048|Ga0181606_10157114 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
| 3300018424|Ga0181591_11109324 | Not Available | 532 | Open in IMG/M |
| 3300018682|Ga0188851_1000766 | Not Available | 6036 | Open in IMG/M |
| 3300018682|Ga0188851_1002000 | All Organisms → Viruses → Predicted Viral | 3326 | Open in IMG/M |
| 3300018682|Ga0188851_1003833 | All Organisms → Viruses → Predicted Viral | 2256 | Open in IMG/M |
| 3300018775|Ga0188848_1011338 | Not Available | 974 | Open in IMG/M |
| 3300019098|Ga0188859_1001640 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
| 3300019459|Ga0181562_10537370 | Not Available | 552 | Open in IMG/M |
| 3300020053|Ga0181595_10018413 | All Organisms → Viruses → Predicted Viral | 4726 | Open in IMG/M |
| 3300020166|Ga0206128_1001656 | Not Available | 21466 | Open in IMG/M |
| 3300020166|Ga0206128_1004099 | Not Available | 11570 | Open in IMG/M |
| 3300020166|Ga0206128_1045552 | Not Available | 2175 | Open in IMG/M |
| 3300020169|Ga0206127_1086058 | All Organisms → Viruses → Predicted Viral | 1385 | Open in IMG/M |
| 3300020438|Ga0211576_10277117 | Not Available | 876 | Open in IMG/M |
| 3300020438|Ga0211576_10325117 | Not Available | 796 | Open in IMG/M |
| 3300020595|Ga0206126_10065808 | All Organisms → Viruses → Predicted Viral | 1892 | Open in IMG/M |
| 3300021085|Ga0206677_10001366 | Not Available | 22622 | Open in IMG/M |
| 3300021085|Ga0206677_10162819 | Not Available | 986 | Open in IMG/M |
| 3300021185|Ga0206682_10090247 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
| 3300021347|Ga0213862_10127565 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 894 | Open in IMG/M |
| 3300021365|Ga0206123_10070506 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1737 | Open in IMG/M |
| 3300021957|Ga0222717_10174312 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300021958|Ga0222718_10134439 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1414 | Open in IMG/M |
| 3300021958|Ga0222718_10494698 | Not Available | 592 | Open in IMG/M |
| 3300021959|Ga0222716_10233545 | All Organisms → Viruses → Predicted Viral | 1145 | Open in IMG/M |
| 3300021960|Ga0222715_10018083 | Not Available | 5338 | Open in IMG/M |
| 3300021960|Ga0222715_10448521 | Not Available | 695 | Open in IMG/M |
| 3300022050|Ga0196883_1001123 | All Organisms → Viruses → Predicted Viral | 2918 | Open in IMG/M |
| 3300022050|Ga0196883_1023450 | Not Available | 746 | Open in IMG/M |
| 3300022057|Ga0212025_1018635 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
| 3300022169|Ga0196903_1002806 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2369 | Open in IMG/M |
| 3300022178|Ga0196887_1056787 | Not Available | 979 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10252720 | Not Available | 587 | Open in IMG/M |
| (restricted) 3300023112|Ga0233411_10268323 | Not Available | 570 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10000357 | Not Available | 26719 | Open in IMG/M |
| 3300024433|Ga0209986_10099669 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1581 | Open in IMG/M |
| 3300024433|Ga0209986_10197605 | All Organisms → Viruses → Predicted Viral | 1006 | Open in IMG/M |
| 3300025070|Ga0208667_1007140 | All Organisms → Viruses → Predicted Viral | 2814 | Open in IMG/M |
| 3300025276|Ga0208814_1000405 | Not Available | 28150 | Open in IMG/M |
| 3300025276|Ga0208814_1000541 | Not Available | 22510 | Open in IMG/M |
| 3300025508|Ga0208148_1051149 | Not Available | 1021 | Open in IMG/M |
| 3300025543|Ga0208303_1009261 | All Organisms → Viruses → Predicted Viral | 3106 | Open in IMG/M |
| 3300025543|Ga0208303_1124986 | Not Available | 514 | Open in IMG/M |
| 3300025594|Ga0209094_1021043 | All Organisms → Viruses → Predicted Viral | 2052 | Open in IMG/M |
| 3300025617|Ga0209138_1129445 | Not Available | 683 | Open in IMG/M |
| 3300025621|Ga0209504_1012575 | All Organisms → Viruses → Predicted Viral | 3701 | Open in IMG/M |
| 3300025652|Ga0208134_1105954 | Not Available | 769 | Open in IMG/M |
| 3300025655|Ga0208795_1045867 | All Organisms → Viruses → Predicted Viral | 1311 | Open in IMG/M |
| 3300025671|Ga0208898_1032815 | Not Available | 2092 | Open in IMG/M |
| 3300025671|Ga0208898_1162943 | Not Available | 586 | Open in IMG/M |
| 3300025751|Ga0208150_1038680 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1652 | Open in IMG/M |
| 3300025759|Ga0208899_1060948 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1562 | Open in IMG/M |
| 3300025769|Ga0208767_1048570 | All Organisms → Viruses → Predicted Viral | 2003 | Open in IMG/M |
| 3300025818|Ga0208542_1014868 | All Organisms → Viruses → Predicted Viral | 2671 | Open in IMG/M |
| 3300025853|Ga0208645_1126984 | Not Available | 1007 | Open in IMG/M |
| 3300025889|Ga0208644_1363052 | Not Available | 547 | Open in IMG/M |
| 3300027752|Ga0209192_10107153 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10416782 | Not Available | 588 | Open in IMG/M |
| 3300028125|Ga0256368_1001027 | All Organisms → Viruses → Predicted Viral | 3317 | Open in IMG/M |
| 3300028125|Ga0256368_1071593 | Not Available | 595 | Open in IMG/M |
| 3300031519|Ga0307488_10215795 | All Organisms → Viruses → Predicted Viral | 1288 | Open in IMG/M |
| 3300031519|Ga0307488_10448218 | Not Available | 784 | Open in IMG/M |
| 3300031519|Ga0307488_10468708 | Not Available | 760 | Open in IMG/M |
| 3300031519|Ga0307488_10688543 | Not Available | 580 | Open in IMG/M |
| 3300031539|Ga0307380_10060120 | All Organisms → Viruses → Predicted Viral | 4115 | Open in IMG/M |
| 3300031539|Ga0307380_10667070 | Not Available | 882 | Open in IMG/M |
| 3300031565|Ga0307379_10046940 | Not Available | 5004 | Open in IMG/M |
| 3300031565|Ga0307379_11410423 | Not Available | 561 | Open in IMG/M |
| 3300031578|Ga0307376_10188188 | Not Available | 1413 | Open in IMG/M |
| 3300031578|Ga0307376_10299994 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300031578|Ga0307376_10408775 | Not Available | 891 | Open in IMG/M |
| 3300031578|Ga0307376_10634875 | Not Available | 676 | Open in IMG/M |
| 3300031669|Ga0307375_10524887 | Not Available | 709 | Open in IMG/M |
| 3300031669|Ga0307375_10690553 | Not Available | 589 | Open in IMG/M |
| 3300031851|Ga0315320_10024000 | All Organisms → Viruses → Predicted Viral | 4847 | Open in IMG/M |
| 3300032088|Ga0315321_10523060 | Not Available | 715 | Open in IMG/M |
| 3300032251|Ga0316198_10744270 | Not Available | 523 | Open in IMG/M |
| 3300034374|Ga0348335_003491 | Not Available | 10415 | Open in IMG/M |
| 3300034375|Ga0348336_204992 | Not Available | 522 | Open in IMG/M |
| 3300034418|Ga0348337_018143 | All Organisms → Viruses → Predicted Viral | 3662 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 28.57% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.49% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 5.49% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.95% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.40% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.40% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.30% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.30% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 3.30% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.75% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.75% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.75% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.20% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.20% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 2.20% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.20% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.20% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.65% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 1.10% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.10% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.10% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.10% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 0.55% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.55% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.55% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.55% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.55% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.55% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.55% |
| Water | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001351 | Pelagic Microbial community sample from North Sea - COGITO 998_met_03 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300002134 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6FKB2 (101f) | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300005086 | Microbial Community from Halfdan Field MHDA3 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005823 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, MM2 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009606 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018682 | Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1 | Environmental | Open in IMG/M |
| 3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
| 3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020166 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025594 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes) | Environmental | Open in IMG/M |
| 3300025617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025621 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| 3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100011112 | 3300000101 | Marine | MKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV* |
| DelMOSum2010_1001165410 | 3300000101 | Marine | MKITIEVDGTDAEELIALIQRVTDAVEKLEDILKEFEDE* |
| DelMOSum2010_100431862 | 3300000101 | Marine | MKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV* |
| DelMOSum2010_100517334 | 3300000101 | Marine | MKITIEVDGTDAEELVAMIQRATEAVEKLEAILKEFEDAD* |
| DelMOSum2010_101008801 | 3300000101 | Marine | MKITIEVDGADAEELIALIQRVTDAVEKLEDILQEFEDADKV* |
| DelMOSum2010_102507601 | 3300000101 | Marine | DTQRQMKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV* |
| DelMOSpr2010_1000580912 | 3300000116 | Marine | MKITIEVDGADAEEFVAMIQRATEAVEKLEAILQEFEDADKV* |
| DelMOSpr2010_100265741 | 3300000116 | Marine | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| DelMOSpr2010_101189284 | 3300000116 | Marine | IEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| JGI20153J14318_1000108621 | 3300001351 | Pelagic Marine | IEVDGADAEELVAMIQRATEAVEKLEAILEEFEAEELH* |
| JGI20153J14318_100741504 | 3300001351 | Pelagic Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEF |
| GOS2221_10168805 | 3300001938 | Marine | MKITIEVDGADAEKIMAMLQRASEAVEKLEAILQEFEDADKV* |
| M2t6FKB2_11656812 | 3300002134 | Marine | MKITIEVDGADAEELVALVQRAAEAVEKLEAILKEFEDAD* |
| JGI26079J46598_10328123 | 3300003216 | Marine | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDADKV* |
| JGI26082J51739_101246922 | 3300003617 | Marine | HRPANRDTQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDADKV* |
| Ga0065861_10423114 | 3300004448 | Marine | MKITIEGDGADAEELMAMLQRATEAVEKLEAILEEFEDAD* |
| Ga0065861_11422022 | 3300004448 | Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILKEFEDAD* |
| Ga0065861_11505662 | 3300004448 | Marine | MKITIEVDGEDAEELFALLDRAVEAVERLETILEEFEDEPLH* |
| Ga0066224_10379373 | 3300004457 | Marine | MKIIIEVDGEDAQDIFAMLERAVEAVEKLEAILKEFEDAD* |
| Ga0066224_10379382 | 3300004457 | Marine | MKIIIEVDGEDAQDIFAMLERAVEAVEKLEAILQEFEDE* |
| Ga0066224_10379392 | 3300004457 | Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILKEFEEEELN* |
| Ga0066224_12126052 | 3300004457 | Marine | MKITIEVDGEDAQDIFAMLERAVEAVEKLEAILQEFEDE* |
| Ga0066223_11528083 | 3300004461 | Marine | MKITIEVDGADAEELMAMLQRATEAVEKLEAILKEFEDAD* |
| Ga0072334_103881593 | 3300005086 | Water | MKITIEVEGTDAEELIALIQRVTDAVEKLEDLLKEFEDE* |
| Ga0074648_11025522 | 3300005512 | Saline Water And Sediment | MKITIEVDGTDAEEVMAMIQRATEAVEKLEAILQEFEDADKV* |
| Ga0078745_11199002 | 3300005823 | Marine Sediment | MKITIEVDGADAEELIALIQRVTDAVEKLEDILKEFEDE* |
| Ga0075474_100883632 | 3300006025 | Aqueous | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0075474_101026013 | 3300006025 | Aqueous | MKITIEVDGADAEKIMALLQRASEAVEKLEAILQEFEDADKV* |
| Ga0075478_100469143 | 3300006026 | Aqueous | MKITIEIDGADAEEIMAMLQRASEAVEKLEAMLQEFEDADKV* |
| Ga0075466_11140813 | 3300006029 | Aqueous | MKITIEVDGEDAEELIALIQRVTDAVEKLEDILKEFEDE* |
| Ga0075461_100264943 | 3300006637 | Aqueous | MKITIEIDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0098048_100056519 | 3300006752 | Marine | MKITIEVDGADAEEIMALLQRASEAVEKLEAILQEFEDADKV* |
| Ga0098048_10457272 | 3300006752 | Marine | MKITIEVDGADAEDIMALLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070749_101216754 | 3300006802 | Aqueous | MKIIIEVDGDDVEEIMAMLQRASEAVEKLEAILQELEDADKV* |
| Ga0070749_102050425 | 3300006802 | Aqueous | MKITIEVDGADAEEIMAILQRASEAVEKLEEILKEFEDESLH* |
| Ga0070749_102246132 | 3300006802 | Aqueous | MKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDAD* |
| Ga0070749_103488903 | 3300006802 | Aqueous | MKITIEVDGTDAEDIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070749_107438392 | 3300006802 | Aqueous | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEDGELH* |
| Ga0070754_100227433 | 3300006810 | Aqueous | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILEEFEDADKV* |
| Ga0070754_104970313 | 3300006810 | Aqueous | MKITIEVDGEDAEELIALIQRVTDAVEKLEDILKEFEDVG* |
| Ga0075476_101390861 | 3300006867 | Aqueous | DGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070750_104091132 | 3300006916 | Aqueous | ITIEVDGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070746_105223201 | 3300006919 | Aqueous | KITIEIDGADAEEIMAMLQRASEAVEKLEAMLQEFEDADKV* |
| Ga0070748_10938991 | 3300006920 | Aqueous | MKITIEVDGTDTEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070748_12309071 | 3300006920 | Aqueous | MIITIEVDGADAEEFVAMIQRATEAVEKLEAILKEFEYAD* |
| Ga0075444_104045631 | 3300006947 | Marine | DTRGRMKIIIEVDGKDAEELFALLDRVVEAVEKLETILEEFEDESLH* |
| Ga0075469_100168969 | 3300007231 | Aqueous | DTQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDAD* |
| Ga0070747_11893934 | 3300007276 | Aqueous | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFE |
| Ga0070747_12370801 | 3300007276 | Aqueous | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEAEELH* |
| Ga0070745_10427651 | 3300007344 | Aqueous | MKIIIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0070745_12048484 | 3300007344 | Aqueous | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADK |
| Ga0070752_11747193 | 3300007345 | Aqueous | PTNRDTQRQMKITIEVDGTDAEEIMAMLQRASEAVEKLEAILEEFEDADKV* |
| Ga0099851_10361071 | 3300007538 | Aqueous | GTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0099851_12381132 | 3300007538 | Aqueous | HRPANRDTQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV* |
| Ga0099851_12435282 | 3300007538 | Aqueous | MKITIEVDGADAEEIMAMLKRASEAVEKLEAILEEFEDADKV* |
| Ga0099847_10752813 | 3300007540 | Aqueous | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDAD* |
| Ga0099848_11105344 | 3300007541 | Aqueous | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILQEFE |
| Ga0099848_12887811 | 3300007541 | Aqueous | ITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0099848_13302421 | 3300007541 | Aqueous | VDGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0102945_10239363 | 3300007609 | Pond Water | MKITIEVDGADAEEMMAMLQRASEAVEKLEAILQEFEDAD* |
| Ga0102945_10579382 | 3300007609 | Pond Water | MKITIEVDGEDAEELVALVQRATEAIETLEAILKEFEDADKV* |
| Ga0099850_10972821 | 3300007960 | Aqueous | QMKITIEVDGADAEEIMAMLKRASEAVEKLEAILEEFEDADKV* |
| Ga0102957_12769941 | 3300009027 | Pond Water | IEVDGTDAEELIALIQRVTDAVEKLEDLLKEFEDE* |
| Ga0115566_107116913 | 3300009071 | Pelagic Marine | MKITIEVDGTDAEELIALIQRVTDAVEKLEDLLKEFEDE* |
| Ga0115550_10377346 | 3300009076 | Pelagic Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEAGELH* |
| Ga0115550_10883302 | 3300009076 | Pelagic Marine | MKITIEVDGADAEELVALVQRAAEAVEKLEAILQEFEDADKV* |
| Ga0115552_11328671 | 3300009077 | Pelagic Marine | GRMKITIEVDGTDAEELIALIQRVTDAVEKLEDILKEFEDE* |
| Ga0118687_100313613 | 3300009124 | Sediment | MKITIEVDGEDAEELIALIQRVTDAVEKLEDLLKEFEDE* |
| Ga0114995_100353429 | 3300009172 | Marine | MKITIEVDGEDAEELFALLDRAVEAVEKLEAILKEFEDAD* |
| Ga0114915_100058111 | 3300009428 | Deep Ocean | MKIIIEVDGKDAEELFALLDRVVEAVEKLETILEEFEDESLH* |
| Ga0114915_10068727 | 3300009428 | Deep Ocean | MKIIIEVDGTDAEELMAMLQRATEAVEKLEAILKEFEDAD* |
| Ga0115545_13160491 | 3300009433 | Pelagic Marine | NQMKITIEVDGTDAEELIALIQRVTDAVEKLEDILKEFEDVG* |
| Ga0115546_11476393 | 3300009435 | Pelagic Marine | MKITIEVDGTDAEELIALIQRVTDAVEKLEDILKEFEDVG* |
| Ga0115554_10675251 | 3300009472 | Pelagic Marine | IEVDGTDAEELIALIQRVTDAVEKLEDILKEFEDE* |
| Ga0115572_104384872 | 3300009507 | Pelagic Marine | MKITIEVDGTDAEELVAMIQRATEAVEKLEAILEEFEAEELH* |
| Ga0123573_105436872 | 3300009509 | Mangrove Sediment | MKITIEVDGADAEEIMALIQRASEAVEKLEAILEEFEDADKV* |
| Ga0114919_109904061 | 3300009529 | Deep Subsurface | MKITIEVDGADAEELIALIQRVTDAVEKLEAILKEFEDE* |
| Ga0115102_106330193 | 3300009606 | Marine | MKITIEVDGDDAEELVALIQRATEAVEKLEAILEEFEDGELH* |
| Ga0129324_100296638 | 3300010368 | Freshwater To Marine Saline Gradient | DGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV* |
| Ga0136851_104793673 | 3300010413 | Mangrove Sediment | MKITIEIDGEDVEELVALVQRATEAIETLEAILKEFEDAD* |
| Ga0118733_1074141121 | 3300010430 | Marine Sediment | MKITIEVDGEDAEDIFALLDRAVEAVEKLEVILEEFKDARFSED* |
| Ga0133547_114943153 | 3300010883 | Marine | MKITIEVDGADAEELVAMIQRATEAVEKLETILKEFEDAD* |
| Ga0114922_101048191 | 3300011118 | Deep Subsurface | MKITIEVDGADAEELIALIQRVTDAVEKLEDILKEFEDVG* |
| Ga0114922_113955682 | 3300011118 | Deep Subsurface | MKITIEVDGEDAEVIFALLDRAVEAVEKLEVILEEFKDARFSED |
| Ga0151669_1297742 | 3300011128 | Marine | MKITIEVDGADAEELVAMLQRATEAVEKLEAILEEFEDADKV* |
| Ga0181390_10566964 | 3300017719 | Seawater | MKITIEVDGDDAEELVALIRRATEAVEKLEAILQEFEDAD |
| Ga0181390_11103972 | 3300017719 | Seawater | MKITIEVDGTDAEELVAMIQRASEAVEKLEAILKEFEDAD |
| Ga0181390_11716693 | 3300017719 | Seawater | MKITIEVDGDDAEELVALIQRATEAVEKLEAILKEFEDAD |
| Ga0181389_10197816 | 3300017746 | Seawater | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFL |
| Ga0181393_10936512 | 3300017748 | Seawater | MKITIEVDGTDAEELVALIQRATEAVEKLEAILQEFEDAD |
| Ga0181392_10333372 | 3300017749 | Seawater | LKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDAD |
| Ga0187219_10338847 | 3300017751 | Seawater | DTQRQMKITIEVEGEDAEELFALLDRAVEAVEKLETILEEFEDEPLH |
| Ga0181422_11597782 | 3300017762 | Seawater | MKITIEVDGADAEELVAMLQRATEAVEKLEAILEEFEDADKV |
| Ga0181406_11866671 | 3300017767 | Seawater | MKITIEVDGDDAEELVALIQRATEAVEKLEAILEEFED |
| Ga0181394_11233654 | 3300017776 | Seawater | MKITIEVEGEDAEELFALLDRAVEAVEKLETILEEFEDEPLH |
| Ga0181394_12047203 | 3300017776 | Seawater | MKITIEVDGDDAEELVALIQRATEAVEKLEAILQEFEDA |
| Ga0181423_11257832 | 3300017781 | Seawater | MKITIEVDGADAEELMAMLQRASEAVEKLEAILQEFEDAD |
| Ga0181552_105045952 | 3300017824 | Salt Marsh | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0181607_1000301016 | 3300017950 | Salt Marsh | MKITIEIDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0180437_103296634 | 3300017963 | Hypersaline Lake Sediment | MKITIEVDGDDAEEIMAMLQRASEAVEKLEAILQGFEDADKV |
| Ga0181590_107800101 | 3300017967 | Salt Marsh | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0181600_101086271 | 3300018036 | Salt Marsh | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQE |
| Ga0181606_101571142 | 3300018048 | Salt Marsh | MKITIEVDGADAEEIMAMLKRASEAVEKLEAILQEFEDAD |
| Ga0181591_111093241 | 3300018424 | Salt Marsh | MKITIEVDGADAEEIMAMLQRASEAVEKLEEILKEFE |
| Ga0188851_10007664 | 3300018682 | Freshwater Lake | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILEEFEDADKV |
| Ga0188851_10020008 | 3300018682 | Freshwater Lake | MKITIEVDGADAEEIMAMLQRASEAVEKLEEILKEFEDESLH |
| Ga0188851_10038332 | 3300018682 | Freshwater Lake | MKITIEVDGADAEELVALVQRAAEAVEKLEAILKEFEDAD |
| Ga0188848_10113382 | 3300018775 | Freshwater Lake | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDADKV |
| Ga0188859_10016404 | 3300019098 | Freshwater Lake | MKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV |
| Ga0181562_105373702 | 3300019459 | Salt Marsh | MKITIEVDGADAEEIMAMLKRASEAVEKLEAILEEFEDADKV |
| Ga0181595_1001841310 | 3300020053 | Salt Marsh | VDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0206128_100165636 | 3300020166 | Seawater | MKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0206128_100409919 | 3300020166 | Seawater | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEAEELH |
| Ga0206128_10455528 | 3300020166 | Seawater | KITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0206127_10860581 | 3300020169 | Seawater | EVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0211576_102771173 | 3300020438 | Marine | MKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDAD |
| Ga0211576_103251173 | 3300020438 | Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEDGELH |
| Ga0206126_100658081 | 3300020595 | Seawater | IEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0206677_1000136616 | 3300021085 | Seawater | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDAD |
| Ga0206677_101628192 | 3300021085 | Seawater | MKITIEVDGADAEELVAMIQRATEAVEKLEAILKEFEDAD |
| Ga0206682_100902474 | 3300021185 | Seawater | MKITIEVDGDDAEELVALIQRATEAVEKLEAILQEFEDAD |
| Ga0213862_101275653 | 3300021347 | Seawater | MKITIEVDGADAEEIMALLQRASEAVEKLEAILQEFEDADKV |
| Ga0206123_100705066 | 3300021365 | Seawater | MKITIEVDGTDAEELIALIQRVTDAVEKLEDLLKEFEDE |
| Ga0222717_101743124 | 3300021957 | Estuarine Water | MKITIEVDGEDVEEIMAMLQRASEAVEKLEAILQEFEDAD |
| Ga0222718_101344393 | 3300021958 | Estuarine Water | MKITIEVDGADAEELIALIQRVTDAVEKLEDILKEFEDVG |
| Ga0222718_104946982 | 3300021958 | Estuarine Water | MKITIEVDGADAEELIVLIQRVTDAVEKLEDILKEFEDE |
| Ga0222716_102335452 | 3300021959 | Estuarine Water | MKITIEVDGDDAEELMAMLQRATEAVEKLEAILQEFEDAD |
| Ga0222715_1001808311 | 3300021960 | Estuarine Water | MKITIEVDGADAEELMAMIQRATEAVEKLEAILEEFEDADKV |
| Ga0222715_104485211 | 3300021960 | Estuarine Water | MKITIEVDGADAEEIMAILQRASEAVEKLEEILKEFEDESLH |
| Ga0196883_10011237 | 3300022050 | Aqueous | MKITIEIDGADAEEIMAMLQRASEAVEKLEAMLQEFEDADKV |
| Ga0196883_10234501 | 3300022050 | Aqueous | MKITIEVDGADAEEFVAMIQRATEAVEKLEAILQEFEDADKV |
| Ga0212025_10186355 | 3300022057 | Aqueous | RLVNRDTQRQMKITIEVDGADAEEIMAILQRASEAVEKLEEILKEFEDESLH |
| Ga0196903_10028065 | 3300022169 | Aqueous | MKITIEVDGEDAEELIALIQRVTDAVEKLEDILKESEDE |
| Ga0196887_10567873 | 3300022178 | Aqueous | MKIIIEVDGEDAQDIFAMLERAVEAVEKLEAILQEFEDE |
| (restricted) Ga0233411_102527202 | 3300023112 | Seawater | MKITIEVDGADAEELMAMLQRATEAVEKLEAILKEFEDAD |
| (restricted) Ga0233411_102683231 | 3300023112 | Seawater | TQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV |
| (restricted) Ga0233412_1000035712 | 3300023210 | Seawater | MKITIEVDGADAEELMAMIQRAAEAVEKLEAILEEFEDADKV |
| Ga0209986_100996694 | 3300024433 | Deep Subsurface | MKITIEVDGADAEELIALIQRVTDAVEKLEAILKEFEDE |
| Ga0209986_101976052 | 3300024433 | Deep Subsurface | MKITIEVDGADAEKIMALLQRASEAVEKLEAILQEFEDADKV |
| Ga0208667_10071406 | 3300025070 | Marine | MKITIEVDGADAEDIMALLQRASEAVEKLEAILQEFEDADKV |
| Ga0208814_100040516 | 3300025276 | Deep Ocean | MKIIIEVDGKDAEELFALLDRVVEAVEKLETILEEFEDESLH |
| Ga0208814_100054114 | 3300025276 | Deep Ocean | MKIIIEVDGTDAEELMAMLQRATEAVEKLEAILKEFEDAD |
| Ga0208148_10511494 | 3300025508 | Aqueous | MKITIEVDGEDAEELIALIQRVTDAVEKLEDILKEFEDE |
| Ga0208303_10092619 | 3300025543 | Aqueous | MKITIEVDGTDAEELVAMIQRATEAVEKLEAILKEFEDAD |
| Ga0208303_11249862 | 3300025543 | Aqueous | MKITIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDAD |
| Ga0209094_10210432 | 3300025594 | Pelagic Marine | MKITIEVDGADAEELVAMIQRATEAVEKLEAILEEFEAGELH |
| Ga0209138_11294452 | 3300025617 | Marine | RPTNRDTQRQMKITIEVDGADAEELVALVQRAAEAVEKLEAILKEFEDAD |
| Ga0209504_10125754 | 3300025621 | Pelagic Marine | MKITIEVDGADAEELVALVQRAAEAVEKLEAILQEFEDADKV |
| Ga0208134_11059544 | 3300025652 | Aqueous | MKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFENAD |
| Ga0208795_10458671 | 3300025655 | Aqueous | DGTDAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0208898_10328154 | 3300025671 | Aqueous | MKIIIEVDGADAEEIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0208898_11629433 | 3300025671 | Aqueous | MKITIEVDGADAEEIMAMLQRASEAVEKLEEILKEFED |
| Ga0208150_10386801 | 3300025751 | Aqueous | DGADAEKIMALLQRASEAVEKLEAILQEFEDADKV |
| Ga0208899_10609484 | 3300025759 | Aqueous | MKITIEVDGADAEELIALIQRVTDAVEKLEDILQEFEDADK |
| Ga0208767_10485704 | 3300025769 | Aqueous | MKITIEVDGVDAEKIMALLQRASEAVEKLEAILQEFEDADKV |
| Ga0208542_10148684 | 3300025818 | Aqueous | MKITLTIEVDGADAEEIVAMLQRASEAVAKLEAILQEFEDADKV |
| Ga0208645_11269843 | 3300025853 | Aqueous | MKITIEVDGEDAEELIALIQRVTDAVEKLEDILKEFEDVG |
| Ga0208644_13630522 | 3300025889 | Aqueous | MKITIEVDGADAEELMATLQRATEAVEKLEAILQEFEDADKV |
| Ga0209192_101071534 | 3300027752 | Marine | MKITIEVDGEDAEELFALLDRAVEAVEKLEAILKEFEDAD |
| (restricted) Ga0233413_104167822 | 3300027996 | Seawater | EVDGADAEELMAMLQRATEAVEKLEAILEEFEDADKV |
| Ga0256368_10010273 | 3300028125 | Sea-Ice Brine | MKITIEVDGEDAEELFALLDRAVEAVERLETILEEFEDEPLH |
| Ga0256368_10715932 | 3300028125 | Sea-Ice Brine | MKITIEVDGADAEELVAIIQRATEAVEKLETILKEFEDAD |
| Ga0307488_102157952 | 3300031519 | Sackhole Brine | MKIIIEVDGEDAQDIFAMLERATEAVEKLEAILKEFEDAD |
| Ga0307488_104482183 | 3300031519 | Sackhole Brine | MKITIEVDGTDAEELVAMIQRATEAVEKLEAILKEFEAEEFH |
| Ga0307488_104687083 | 3300031519 | Sackhole Brine | MKIIIEVDGEDAQDIFALLDRAVEAVEKLEAILQEFEDE |
| Ga0307488_106885433 | 3300031519 | Sackhole Brine | MKITLEVDGTDAEELVALLQRATEAVEKLEAILEEFEEEELH |
| Ga0307380_100601202 | 3300031539 | Soil | MKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDGELH |
| Ga0307380_106670701 | 3300031539 | Soil | ANRDTQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILQEFEDADKV |
| Ga0307379_100469407 | 3300031565 | Soil | MKIIIEVDGEDAEELFALLDRAVEAVEKLETILEEFEDGPLH |
| Ga0307379_114104232 | 3300031565 | Soil | TQRQMKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDADKV |
| Ga0307376_101881881 | 3300031578 | Soil | RDTQRQMKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0307376_102999942 | 3300031578 | Soil | MKITIEVDGADAEKIMAMLQRASEAVEKLEAILQEFEDADKV |
| Ga0307376_104087753 | 3300031578 | Soil | MKITIEVDGEDAEELFALLDRAVEAVERLETILEEFEDGPLH |
| Ga0307376_106348752 | 3300031578 | Soil | TNRDTQRQMKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0307375_105248873 | 3300031669 | Soil | MKITIEVDGTDAEEIMAMLQRASEAVEKLEAILEEFEDADK |
| Ga0307375_106905532 | 3300031669 | Soil | QMKITIEVDGADAEELVALVQRAAEAVEKLEAILEEFEDADKV |
| Ga0315320_100240005 | 3300031851 | Seawater | MKITIEVDGADAEELVAMIQRATEAVEKLEAILQEFEDEELH |
| Ga0315321_105230603 | 3300032088 | Seawater | KRKPNEENQMKITIEVDGADAEELMAMLQRATEAVEKLEAILEEFEDAD |
| Ga0316198_107442702 | 3300032251 | Sediment | MKITIEVDGADAEELIALIQRVTDAVEKLEDILKEFEDESLH |
| Ga0348335_003491_3_128 | 3300034374 | Aqueous | KITIEVDGTDAEEIMAMLQRASEAVEKLEAILEEFEDADKV |
| Ga0348336_204992_72_200 | 3300034375 | Aqueous | MKIIIEVDGADAEEIMAMLQRASEAVEKLEAILQEFGDADKV |
| Ga0348337_018143_3383_3511 | 3300034418 | Aqueous | MKIIIEVDGDDVEEIMAMLQRASEAVEKLEAILQELEDADKV |
| ⦗Top⦘ |