


| Basic Information | |
|---|---|
| Family ID | F031454 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MNESTLDLFCQHEDEMYADEYAMELERKAAELEITVDYYMMEFI |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 182 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 18.99 % |
| % of genes near scaffold ends (potentially truncated) | 20.33 % |
| % of genes from short scaffolds (< 2000 bps) | 62.09 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.154 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient (10.989 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.560 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (41.209 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.61% β-sheet: 0.00% Coil/Unstructured: 51.39% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 182 Family Scaffolds |
|---|---|---|
| PF04851 | ResIII | 14.84 |
| PF12705 | PDDEXK_1 | 11.54 |
| PF07453 | NUMOD1 | 3.30 |
| PF05996 | Fe_bilin_red | 3.30 |
| PF04965 | GPW_gp25 | 2.75 |
| PF14279 | HNH_5 | 1.65 |
| PF07275 | ArdA | 1.10 |
| PF02086 | MethyltransfD12 | 1.10 |
| PF04984 | Phage_sheath_1 | 1.10 |
| PF13392 | HNH_3 | 1.10 |
| PF07460 | NUMOD3 | 1.10 |
| PF01541 | GIY-YIG | 0.55 |
| PF02562 | PhoH | 0.55 |
| PF14240 | YHYH | 0.55 |
| PF09834 | DUF2061 | 0.55 |
| PF03767 | Acid_phosphat_B | 0.55 |
| PF00004 | AAA | 0.55 |
| PF13469 | Sulfotransfer_3 | 0.55 |
| PF09568 | RE_MjaI | 0.55 |
| PF10979 | DUF2786 | 0.55 |
| PF01844 | HNH | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 182 Family Scaffolds |
|---|---|---|---|
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 1.10 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 1.10 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 1.10 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 1.10 |
| COG1702 | Phosphate starvation-inducible protein PhoH, predicted ATPase | Signal transduction mechanisms [T] | 0.55 |
| COG1875 | Predicted ribonuclease YlaK, contains NYN-type RNase and PhoH-family ATPase domains | General function prediction only [R] | 0.55 |
| COG2503 | Predicted secreted acid phosphatase | General function prediction only [R] | 0.55 |
| COG3700 | Acid phosphatase, class B | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.85 % |
| Unclassified | root | N/A | 46.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199808404 | Not Available | 6618 | Open in IMG/M |
| 3300001274|B570J13895_1001425 | All Organisms → Viruses → Predicted Viral | 3391 | Open in IMG/M |
| 3300001968|GOS2236_1084295 | All Organisms → Viruses → Predicted Viral | 1669 | Open in IMG/M |
| 3300002408|B570J29032_109779831 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300003430|JGI25921J50272_10000110 | Not Available | 25353 | Open in IMG/M |
| 3300004792|Ga0007761_11374428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 568 | Open in IMG/M |
| 3300005077|Ga0071116_1025248 | Not Available | 4361 | Open in IMG/M |
| 3300005512|Ga0074648_1002528 | Not Available | 16470 | Open in IMG/M |
| 3300005512|Ga0074648_1012603 | Not Available | 5380 | Open in IMG/M |
| 3300005527|Ga0068876_10106408 | All Organisms → Viruses → Predicted Viral | 1670 | Open in IMG/M |
| 3300005805|Ga0079957_1006655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9199 | Open in IMG/M |
| 3300005805|Ga0079957_1017644 | Not Available | 5093 | Open in IMG/M |
| 3300006641|Ga0075471_10173716 | Not Available | 1131 | Open in IMG/M |
| 3300007538|Ga0099851_1000013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 60000 | Open in IMG/M |
| 3300007538|Ga0099851_1042805 | All Organisms → Viruses → Predicted Viral | 1790 | Open in IMG/M |
| 3300007539|Ga0099849_1018968 | All Organisms → Viruses → Predicted Viral | 2998 | Open in IMG/M |
| 3300007539|Ga0099849_1024902 | All Organisms → Viruses → Predicted Viral | 2588 | Open in IMG/M |
| 3300007541|Ga0099848_1020266 | All Organisms → Viruses → Predicted Viral | 2842 | Open in IMG/M |
| 3300007541|Ga0099848_1088358 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
| 3300007541|Ga0099848_1310363 | Not Available | 540 | Open in IMG/M |
| 3300007542|Ga0099846_1075767 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300007622|Ga0102863_1106789 | Not Available | 823 | Open in IMG/M |
| 3300007639|Ga0102865_1235295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Neptunevirus → Synechococcus virus SRIM50 | 546 | Open in IMG/M |
| 3300007974|Ga0105747_1203951 | Not Available | 653 | Open in IMG/M |
| 3300007992|Ga0105748_10111862 | All Organisms → Viruses → Predicted Viral | 1098 | Open in IMG/M |
| 3300008012|Ga0075480_10029334 | All Organisms → Viruses → Predicted Viral | 3336 | Open in IMG/M |
| 3300008055|Ga0108970_10099031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21741 | Open in IMG/M |
| 3300008107|Ga0114340_1000245 | Not Available | 44577 | Open in IMG/M |
| 3300008107|Ga0114340_1197648 | Not Available | 679 | Open in IMG/M |
| 3300008108|Ga0114341_10298359 | Not Available | 839 | Open in IMG/M |
| 3300008113|Ga0114346_1007418 | Not Available | 10709 | Open in IMG/M |
| 3300008113|Ga0114346_1059368 | All Organisms → Viruses → Predicted Viral | 1871 | Open in IMG/M |
| 3300008113|Ga0114346_1219957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 738 | Open in IMG/M |
| 3300008116|Ga0114350_1000066 | Not Available | 58460 | Open in IMG/M |
| 3300008116|Ga0114350_1018771 | All Organisms → Viruses → Predicted Viral | 2902 | Open in IMG/M |
| 3300008116|Ga0114350_1045117 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
| 3300008120|Ga0114355_1002182 | Not Available | 12568 | Open in IMG/M |
| 3300008261|Ga0114336_1036163 | All Organisms → Viruses → Predicted Viral | 2682 | Open in IMG/M |
| 3300008261|Ga0114336_1130667 | All Organisms → Viruses → Predicted Viral | 2570 | Open in IMG/M |
| 3300009009|Ga0105105_10018365 | All Organisms → Viruses → Predicted Viral | 2905 | Open in IMG/M |
| 3300009009|Ga0105105_10755330 | Not Available | 583 | Open in IMG/M |
| 3300009009|Ga0105105_11059876 | Not Available | 507 | Open in IMG/M |
| 3300009051|Ga0102864_1117125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 727 | Open in IMG/M |
| 3300009051|Ga0102864_1129497 | Not Available | 690 | Open in IMG/M |
| 3300009085|Ga0105103_10494873 | Not Available | 686 | Open in IMG/M |
| 3300009152|Ga0114980_10057076 | All Organisms → Viruses → Predicted Viral | 2359 | Open in IMG/M |
| 3300009154|Ga0114963_10063357 | All Organisms → Viruses → Predicted Viral | 2329 | Open in IMG/M |
| 3300009155|Ga0114968_10173701 | Not Available | 1264 | Open in IMG/M |
| 3300009155|Ga0114968_10587898 | Not Available | 590 | Open in IMG/M |
| 3300009159|Ga0114978_10008683 | Not Available | 7954 | Open in IMG/M |
| 3300009159|Ga0114978_10049522 | All Organisms → Viruses → Predicted Viral | 2908 | Open in IMG/M |
| 3300009159|Ga0114978_10108007 | All Organisms → Viruses → Predicted Viral | 1830 | Open in IMG/M |
| 3300009159|Ga0114978_10539616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 680 | Open in IMG/M |
| 3300009159|Ga0114978_10577410 | Not Available | 652 | Open in IMG/M |
| 3300009165|Ga0105102_10660124 | Not Available | 583 | Open in IMG/M |
| 3300009182|Ga0114959_10184328 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
| 3300009183|Ga0114974_10217665 | All Organisms → Viruses → Predicted Viral | 1158 | Open in IMG/M |
| 3300009385|Ga0103852_1018278 | Not Available | 666 | Open in IMG/M |
| 3300009466|Ga0126448_1001349 | Not Available | 7113 | Open in IMG/M |
| 3300010297|Ga0129345_1086642 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300010299|Ga0129342_1014140 | All Organisms → Viruses → Predicted Viral | 3330 | Open in IMG/M |
| 3300010354|Ga0129333_10005683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11741 | Open in IMG/M |
| 3300010354|Ga0129333_10014175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 7575 | Open in IMG/M |
| 3300010354|Ga0129333_10033172 | All Organisms → Viruses → Predicted Viral | 4876 | Open in IMG/M |
| 3300010354|Ga0129333_10074029 | All Organisms → Viruses → Predicted Viral | 3163 | Open in IMG/M |
| 3300010354|Ga0129333_10108259 | All Organisms → Viruses → Predicted Viral | 2565 | Open in IMG/M |
| 3300010354|Ga0129333_10112826 | All Organisms → Viruses → Predicted Viral | 2507 | Open in IMG/M |
| 3300010354|Ga0129333_10138244 | All Organisms → Viruses → Predicted Viral | 2238 | Open in IMG/M |
| 3300010354|Ga0129333_10150380 | All Organisms → Viruses → Predicted Viral | 2136 | Open in IMG/M |
| 3300010354|Ga0129333_10268428 | All Organisms → Viruses → Predicted Viral | 1534 | Open in IMG/M |
| 3300010354|Ga0129333_10331152 | All Organisms → Viruses → Predicted Viral | 1357 | Open in IMG/M |
| 3300010354|Ga0129333_10390647 | Not Available | 1233 | Open in IMG/M |
| 3300010354|Ga0129333_10406728 | All Organisms → Viruses → Predicted Viral | 1204 | Open in IMG/M |
| 3300010354|Ga0129333_10483009 | All Organisms → Viruses → Predicted Viral | 1088 | Open in IMG/M |
| 3300010354|Ga0129333_10858026 | Not Available | 771 | Open in IMG/M |
| 3300010354|Ga0129333_10911012 | Not Available | 743 | Open in IMG/M |
| 3300010354|Ga0129333_10958159 | Not Available | 721 | Open in IMG/M |
| 3300010370|Ga0129336_10131925 | All Organisms → Viruses → Predicted Viral | 1451 | Open in IMG/M |
| 3300010370|Ga0129336_10171648 | Not Available | 1245 | Open in IMG/M |
| 3300010389|Ga0136549_10001225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19188 | Open in IMG/M |
| 3300011268|Ga0151620_1001820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8137 | Open in IMG/M |
| 3300011268|Ga0151620_1052906 | All Organisms → Viruses → Predicted Viral | 1335 | Open in IMG/M |
| 3300011268|Ga0151620_1089449 | Not Available | 979 | Open in IMG/M |
| 3300012000|Ga0119951_1143915 | Not Available | 520 | Open in IMG/M |
| 3300012920|Ga0160423_10032099 | All Organisms → Viruses → Predicted Viral | 3880 | Open in IMG/M |
| 3300012936|Ga0163109_10046910 | All Organisms → Viruses → Predicted Viral | 3174 | Open in IMG/M |
| 3300012954|Ga0163111_10136510 | All Organisms → Viruses → Predicted Viral | 2059 | Open in IMG/M |
| 3300013087|Ga0163212_1018553 | All Organisms → Viruses → Predicted Viral | 2536 | Open in IMG/M |
| 3300013181|Ga0116836_1009662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 875 | Open in IMG/M |
| 3300013253|Ga0116813_1034717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 832 | Open in IMG/M |
| 3300017761|Ga0181356_1104067 | Not Available | 921 | Open in IMG/M |
| 3300017761|Ga0181356_1104887 | Not Available | 917 | Open in IMG/M |
| 3300017952|Ga0181583_10845589 | Not Available | 536 | Open in IMG/M |
| 3300017956|Ga0181580_10680702 | Not Available | 656 | Open in IMG/M |
| 3300019784|Ga0181359_1059216 | All Organisms → Viruses → Predicted Viral | 1468 | Open in IMG/M |
| 3300020074|Ga0194113_10031272 | Not Available | 5539 | Open in IMG/M |
| 3300020074|Ga0194113_10119442 | All Organisms → Viruses → Predicted Viral | 2257 | Open in IMG/M |
| 3300020074|Ga0194113_10288646 | All Organisms → Viruses → Predicted Viral | 1251 | Open in IMG/M |
| 3300020083|Ga0194111_10000308 | Not Available | 60018 | Open in IMG/M |
| 3300020109|Ga0194112_10032877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 5531 | Open in IMG/M |
| 3300020109|Ga0194112_10899081 | Not Available | 569 | Open in IMG/M |
| 3300020141|Ga0211732_1127243 | All Organisms → Viruses → Predicted Viral | 1312 | Open in IMG/M |
| 3300020141|Ga0211732_1172746 | All Organisms → Viruses → Predicted Viral | 1608 | Open in IMG/M |
| 3300020141|Ga0211732_1439783 | Not Available | 856 | Open in IMG/M |
| 3300020141|Ga0211732_1440135 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300020151|Ga0211736_10137773 | Not Available | 10078 | Open in IMG/M |
| 3300020151|Ga0211736_10220774 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
| 3300020151|Ga0211736_10527277 | Not Available | 581 | Open in IMG/M |
| 3300020151|Ga0211736_10778876 | Not Available | 633 | Open in IMG/M |
| 3300020151|Ga0211736_10959057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 720 | Open in IMG/M |
| 3300020159|Ga0211734_10652185 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300020159|Ga0211734_11342347 | Not Available | 826 | Open in IMG/M |
| 3300020160|Ga0211733_10435792 | All Organisms → Viruses → Predicted Viral | 2748 | Open in IMG/M |
| 3300020162|Ga0211735_11568439 | Not Available | 674 | Open in IMG/M |
| 3300020162|Ga0211735_11568581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 701 | Open in IMG/M |
| 3300020172|Ga0211729_10835499 | All Organisms → Viruses → Predicted Viral | 1519 | Open in IMG/M |
| 3300020193|Ga0194131_10038406 | All Organisms → Viruses → Predicted Viral | 3611 | Open in IMG/M |
| 3300020193|Ga0194131_10485599 | Not Available | 552 | Open in IMG/M |
| 3300020205|Ga0211731_11480997 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
| 3300020239|Ga0211501_1000300 | Not Available | 10312 | Open in IMG/M |
| 3300020258|Ga0211529_1001550 | All Organisms → Viruses → Predicted Viral | 3845 | Open in IMG/M |
| 3300020264|Ga0211526_1007927 | All Organisms → Viruses → Predicted Viral | 1748 | Open in IMG/M |
| 3300020403|Ga0211532_10167958 | Not Available | 891 | Open in IMG/M |
| 3300020403|Ga0211532_10217467 | Not Available | 757 | Open in IMG/M |
| 3300020519|Ga0208223_1000134 | Not Available | 18746 | Open in IMG/M |
| 3300021356|Ga0213858_10099077 | All Organisms → Viruses → Predicted Viral | 1423 | Open in IMG/M |
| 3300021368|Ga0213860_10197456 | Not Available | 886 | Open in IMG/M |
| 3300021425|Ga0213866_10028740 | All Organisms → Viruses → Predicted Viral | 3252 | Open in IMG/M |
| 3300021956|Ga0213922_1004129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4576 | Open in IMG/M |
| 3300021960|Ga0222715_10106107 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
| 3300021963|Ga0222712_10494517 | Not Available | 725 | Open in IMG/M |
| 3300022149|Ga0196907_100568 | All Organisms → Viruses → Predicted Viral | 1616 | Open in IMG/M |
| 3300022179|Ga0181353_1140541 | Not Available | 563 | Open in IMG/M |
| 3300022198|Ga0196905_1041229 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300022200|Ga0196901_1123861 | Not Available | 882 | Open in IMG/M |
| 3300022223|Ga0224501_10201088 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300022746|Ga0228701_1087210 | Not Available | 664 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10404933 | Not Available | 596 | Open in IMG/M |
| 3300023170|Ga0255761_10469848 | Not Available | 603 | Open in IMG/M |
| 3300023179|Ga0214923_10245617 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300024239|Ga0247724_1007987 | All Organisms → Viruses → Predicted Viral | 1590 | Open in IMG/M |
| 3300024503|Ga0255152_1012100 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300025653|Ga0208428_1028912 | All Organisms → Viruses → Predicted Viral | 1780 | Open in IMG/M |
| 3300025732|Ga0208784_1007643 | All Organisms → Viruses → Predicted Viral | 3765 | Open in IMG/M |
| 3300025848|Ga0208005_1002173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 6304 | Open in IMG/M |
| 3300025870|Ga0209666_1397926 | Not Available | 513 | Open in IMG/M |
| 3300025872|Ga0208783_10019005 | All Organisms → Viruses → Predicted Viral | 3399 | Open in IMG/M |
| 3300025889|Ga0208644_1228578 | Not Available | 786 | Open in IMG/M |
| 3300027213|Ga0208555_1050867 | Not Available | 642 | Open in IMG/M |
| 3300027631|Ga0208133_1165585 | Not Available | 509 | Open in IMG/M |
| 3300027693|Ga0209704_1000045 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20119 | Open in IMG/M |
| 3300027734|Ga0209087_1355692 | Not Available | 504 | Open in IMG/M |
| 3300027754|Ga0209596_1000342 | Not Available | 43330 | Open in IMG/M |
| 3300027762|Ga0209288_10134902 | Not Available | 788 | Open in IMG/M |
| 3300027763|Ga0209088_10052457 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300027763|Ga0209088_10070714 | All Organisms → Viruses → Predicted Viral | 1651 | Open in IMG/M |
| 3300027797|Ga0209107_10041164 | All Organisms → Viruses → Predicted Viral | 2631 | Open in IMG/M |
| 3300027940|Ga0209893_1004695 | Not Available | 985 | Open in IMG/M |
| 3300029930|Ga0119944_1007116 | All Organisms → Viruses → Predicted Viral | 1758 | Open in IMG/M |
| 3300031539|Ga0307380_10142292 | All Organisms → Viruses → Predicted Viral | 2396 | Open in IMG/M |
| 3300031758|Ga0315907_10024209 | Not Available | 5568 | Open in IMG/M |
| 3300031857|Ga0315909_10812547 | Not Available | 589 | Open in IMG/M |
| 3300031951|Ga0315904_10004061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 21134 | Open in IMG/M |
| 3300031951|Ga0315904_10336922 | Not Available | 1395 | Open in IMG/M |
| 3300032053|Ga0315284_11986668 | Not Available | 590 | Open in IMG/M |
| 3300033816|Ga0334980_0316856 | Not Available | 603 | Open in IMG/M |
| 3300033979|Ga0334978_0000014 | Not Available | 91420 | Open in IMG/M |
| 3300033981|Ga0334982_0004228 | Not Available | 8833 | Open in IMG/M |
| 3300034019|Ga0334998_0278630 | All Organisms → Viruses → Predicted Viral | 1002 | Open in IMG/M |
| 3300034021|Ga0335004_0696148 | Not Available | 525 | Open in IMG/M |
| 3300034061|Ga0334987_0558615 | Not Available | 684 | Open in IMG/M |
| 3300034062|Ga0334995_0071852 | All Organisms → Viruses → Predicted Viral | 2721 | Open in IMG/M |
| 3300034063|Ga0335000_0325597 | Not Available | 938 | Open in IMG/M |
| 3300034073|Ga0310130_0126783 | Not Available | 774 | Open in IMG/M |
| 3300034102|Ga0335029_0320050 | Not Available | 970 | Open in IMG/M |
| 3300034102|Ga0335029_0423626 | Not Available | 796 | Open in IMG/M |
| 3300034103|Ga0335030_0684566 | Not Available | 617 | Open in IMG/M |
| 3300034112|Ga0335066_0310648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 888 | Open in IMG/M |
| 3300034272|Ga0335049_0881547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Synechococcus phage S-CBM2 | 521 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.99% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.89% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.34% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.24% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 6.59% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.85% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 3.85% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.30% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.65% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.65% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.65% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.65% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.10% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.10% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.10% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.10% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.10% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.55% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.55% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.55% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.55% |
| Sinkhole | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Sinkhole | 0.55% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.55% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.55% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.55% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.55% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.55% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.55% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.55% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.55% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.55% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.55% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001274 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
| 3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005077 | Water filled karst sinkhole microbial communities from Little Salt Spring, North Port, Florida - Phototrophic mat 2014 | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009385 | Microbial communities of water from Amazon river, Brazil - RCM5 | Environmental | Open in IMG/M |
| 3300009466 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 2m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013181 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 9m_Station6_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013253 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 10m_Station4_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020200 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50m | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020239 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555909-ERR598959) | Environmental | Open in IMG/M |
| 3300020258 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949) | Environmental | Open in IMG/M |
| 3300020264 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158) | Environmental | Open in IMG/M |
| 3300020281 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025848 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2199978505 | 2199352004 | Freshwater | MHESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYMMEFMF |
| B570J13895_10014254 | 3300001274 | Freshwater | MHESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYMMEFMF* |
| GOS2236_10842953 | 3300001968 | Marine | MHESTLDLFCGDNSNEFADEYAMEIEQKAAELEVTVDYYMMEFM* |
| B570J29032_1097798315 | 3300002408 | Freshwater | MTFMNESTLDLFCQHEDETYADEYAMEFERKAAELEITVDYFLMEFV* |
| JGI25921J50272_1000011018 | 3300003430 | Freshwater Lake | MNESTLDLFCQHEDEMFAEEYVTELEMKAAYFEVSIDYYMMEFM* |
| Ga0007761_113744281 | 3300004792 | Freshwater Lake | MMFDSTLDLFCEHEDAEYADEFAMELEEKAAELEVTVDYYMAE |
| Ga0071116_10252485 | 3300005077 | Sinkhole | MNESTLDLFCQHEDEMYADEYAMELERKAAELEITVDYYMMEFI* |
| Ga0074648_100252819 | 3300005512 | Saline Water And Sediment | MHESTLDLFCDQDDDKFAEEFWLEIERKAAELEVTVDYYMMEFM* |
| Ga0074648_10126032 | 3300005512 | Saline Water And Sediment | MMHESTLDLFCQHADETIADEYAKEIELKAAELEVTVDYYMSEFM* |
| Ga0068876_101064083 | 3300005527 | Freshwater Lake | MEDKFMSESSLDLFCELPSEQMAEEYAMELEAKAAELEVTVDYYMAEFM* |
| Ga0079957_100665520 | 3300005805 | Lake | MHESTLDLFCEHAEPDEQAAEDWAFEIEKKAAELEVTCDYYMYEFL* |
| Ga0079957_101764417 | 3300005805 | Lake | MTFMNDSTLDLFCQHDDEMYADEYAMEIERKAAELEITVDYYMMEFI* |
| Ga0075471_101737164 | 3300006641 | Aqueous | MNDSTLDLFCQHEDETFADEYAMELERKASSLEITVDYLIQEFMISLY* |
| Ga0099851_100001316 | 3300007538 | Aqueous | MYESTLDLFCNEDDDKFAEEFWLEIERKAAELEVTVDYFMMEFM* |
| Ga0099851_10428051 | 3300007538 | Aqueous | MKDKMMHQSTLDLFCDHADKQMAEEYAMEIEAKAAELEVTVDYYMAEFL* |
| Ga0099849_101896812 | 3300007539 | Aqueous | MKDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEVTV |
| Ga0099849_10249028 | 3300007539 | Aqueous | KDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL* |
| Ga0099848_10202662 | 3300007541 | Aqueous | MKDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL* |
| Ga0099848_10883582 | 3300007541 | Aqueous | MKDKFMTDSTLDLFCDHADAQMAEEYTMELEAKAAELEITVDYYIAEFL* |
| Ga0099848_13103631 | 3300007541 | Aqueous | MHESTLDLFCGDESEEFADEYARELEMKAAELEITVDYYI |
| Ga0099846_10757673 | 3300007542 | Aqueous | MKDKMMHQSTLDLFCDHADAQMAEEYTMEIEAKAAELEVTVDYYMAEFL* |
| Ga0102863_11067891 | 3300007622 | Estuarine | MKDKFMHQSTLDLFCEHADAQIADEYAMELEAKAAELEITVDYYIAEFL* |
| Ga0102865_12352951 | 3300007639 | Estuarine | MKDKFMHQSTLDLFCEHADAQIADEYAMELEAKAAEL |
| Ga0105747_12039511 | 3300007974 | Estuary Water | MFNSTLDLFCEHEDAEYADEFAMELEEKAAELEVTVDYYM |
| Ga0105748_101118624 | 3300007992 | Estuary Water | MFDSTLDLFCEHDDAEYADEFAMEIEELASKYEVTCDYIIQEFILD* |
| Ga0075480_100293348 | 3300008012 | Aqueous | MKDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEITVDYYMAEFI* |
| Ga0108970_1009903137 | 3300008055 | Estuary | MHESTLDLFCNDNSDEFADEYAMEIERKAAELEVTVDYYLAEFI* |
| Ga0114340_100024530 | 3300008107 | Freshwater, Plankton | MKDKFMTDSTLDLFCDHADAQMADEYAMELESKAAELEITVDYYIAEFL* |
| Ga0114340_11976482 | 3300008107 | Freshwater, Plankton | MHDSTLDLFCNYDSDEFADEYAMEIERKAAELEVTVDYYLAEFV* |
| Ga0114341_102983591 | 3300008108 | Freshwater, Plankton | MHDSTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYIAEFM* |
| Ga0114346_100741810 | 3300008113 | Freshwater, Plankton | MHESTLDLFCNHDSDEFADEYAMELEQKAAELEVTVDYYIAEFL* |
| Ga0114346_10593681 | 3300008113 | Freshwater, Plankton | MKDKFMTDSTLDLFCDHADAQMADEYAMELEAKAAELEITVDYYMAEFL* |
| Ga0114346_12199571 | 3300008113 | Freshwater, Plankton | MTFMNESTLDLFCQHDDEMYADEYAMELERKAAELEITVDYYLMEFV* |
| Ga0114350_100006675 | 3300008116 | Freshwater, Plankton | MNDSTLDLFCQHEDENYADEYAMEIERKCAELEITVDYYLMEFI* |
| Ga0114350_10187712 | 3300008116 | Freshwater, Plankton | MTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITIDYYMMEFV* |
| Ga0114350_10451171 | 3300008116 | Freshwater, Plankton | MNDSTLDLFCQHEDEAFADEYAMELERKAAELEITVDYYMMEFI* |
| Ga0114355_100218239 | 3300008120 | Freshwater, Plankton | MTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITVDYYMMEFV* |
| Ga0114336_10361632 | 3300008261 | Freshwater, Plankton | MHESTLDLFCGDDSNEFADEYAMEIEQKAAELEVTVDYYIAEFL* |
| Ga0114336_11306677 | 3300008261 | Freshwater, Plankton | MHESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYIAEFM* |
| Ga0105105_100183658 | 3300009009 | Freshwater Sediment | MTFMNDSTLDLFCQHEDEMYADEYAMELERKAAELEITVDYYMMEFV* |
| Ga0105105_107553302 | 3300009009 | Freshwater Sediment | MNNRTLDLFCENEDERYADEYAMRIEYLASKYEVTCDYIIQEFILD* |
| Ga0105105_110598761 | 3300009009 | Freshwater Sediment | LTMNNSTLDLFCENEDESNEAEQFSMEIEMKAAILEITVDYYMMEFM* |
| Ga0102864_11171252 | 3300009051 | Estuarine | MMHESTLDLFCEYADEIMADEYAKEIELKAAELEVTVDYYMSEFM* |
| Ga0102864_11294972 | 3300009051 | Estuarine | KDKFMHQSTLDLFCEHADAQIADEYAMELEAKAAELEITVDYYIAEFL* |
| Ga0105103_104948732 | 3300009085 | Freshwater Sediment | MTFMNDSTLDLFCQHDDEMYADEYAMEIERKCAELEITVDYYMMEFV* |
| Ga0114980_100570766 | 3300009152 | Freshwater Lake | MKEKFMTESSLDLFCDHIDAQLADEYAMDLEAKAAELEITVDYYIAEFL* |
| Ga0114963_100633576 | 3300009154 | Freshwater Lake | MMFESTLDLFCEHEDAEYADEFAMEIEQKAAEFEVTVDYYMMEFM* |
| Ga0114968_101737013 | 3300009155 | Freshwater Lake | MMFNSTLDLFCEHEDAEYADEFAMELEELASKYEVTCDYIIQEFILD* |
| Ga0114968_105878983 | 3300009155 | Freshwater Lake | MFDSTLDLFCQHDDAEYADEFAMELEEKAAAFEITVDYYMMEFL* |
| Ga0114978_1000868315 | 3300009159 | Freshwater Lake | MFDSTLDLFCQHDDAEYADEFAMELEEKAAELEVTVDYYMMEFM* |
| Ga0114978_100495223 | 3300009159 | Freshwater Lake | MFDSTLDLFCQHDDAEYADEFAMEIEELASKYEVTCDYIIQEFILD* |
| Ga0114978_101080074 | 3300009159 | Freshwater Lake | MFNSTLDLFCEHEDAEYADEFAMELEEKAAAFEITVDYLLMEFM* |
| Ga0114978_105396161 | 3300009159 | Freshwater Lake | MFDSTLDLFCQHDDAEYADEFAMEIEELASKYEVT |
| Ga0114978_105774102 | 3300009159 | Freshwater Lake | MMFDSTLDLFCEHDDAEYADEFAMELEEKAAALEVTVDYYMAEFM* |
| Ga0105102_106601242 | 3300009165 | Freshwater Sediment | MMHESTLDLFCNDDSDDIADEYAMEIERKAAELEVTVDYYLAEFI* |
| Ga0114979_101059945 | 3300009180 | Freshwater Lake | EHDDAEYADEFAMELEEKAAELEVTVDYYMMEFM* |
| Ga0114959_101843283 | 3300009182 | Freshwater Lake | MFESTLDLFCEHEDAEYADEFAMEIEQKAAEFEVTVDYYMMEFM* |
| Ga0114974_102176651 | 3300009183 | Freshwater Lake | MKEKFMTKSSLDLFCDHIDAQLADEYAIDLEAAAAELEITVDYYIAEFL* |
| Ga0103852_10182782 | 3300009385 | River Water | MKDKFMHNSTLDLFCQHSDAQMAEEYAMELEAKAAELEITVDYYIAEFL* |
| Ga0126448_100134912 | 3300009466 | Meromictic Pond | MNESTLDLFCQHEDEMYADEYAMELERKASELEITVDYYMMEFV* |
| Ga0129345_10866424 | 3300010297 | Freshwater To Marine Saline Gradient | MNESTLDLFCNRDDDEQYWKELEDRAAELEVTLDYYLAEFCA* |
| Ga0129342_101414010 | 3300010299 | Freshwater To Marine Saline Gradient | MKDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEITVDYYMAEFL* |
| Ga0129333_1000568326 | 3300010354 | Freshwater To Marine Saline Gradient | MHDSTLDLFCDHDSDEFADEYAMEIERKAAELEVTVDYYIAEFL* |
| Ga0129333_1001417518 | 3300010354 | Freshwater To Marine Saline Gradient | MMTTLFTQTMHESTLDLFCDHDDEQMAHEFAIELETKAAELEVTVDYYLMEFM* |
| Ga0129333_1003317214 | 3300010354 | Freshwater To Marine Saline Gradient | MHESTLDLFCNDNSDEIADEYAMEIERKAAELEVTVDYYLAEFV* |
| Ga0129333_100740292 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDENYADEYAMDIERKCAELEITVDYYMMEFV* |
| Ga0129333_101082593 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDENYADEYAMELERKASSLEITVDYYMMEFI* |
| Ga0129333_101128263 | 3300010354 | Freshwater To Marine Saline Gradient | MKPEKHLSESTLDLFCDHADEQLADEYALEIESKAAALEVTVDYYMAEFM* |
| Ga0129333_101382441 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDERFADEYAMEMEQKAAQLEVTVDYLIQEFM* |
| Ga0129333_101503802 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDENYADEYAMEIERKCAELEITVDYYMMEFV* |
| Ga0129333_102684284 | 3300010354 | Freshwater To Marine Saline Gradient | MKDKFMTDSTLDLFCQHADAQMAEEYAMELEAKAAELEITVDYYIAEFL* |
| Ga0129333_103311521 | 3300010354 | Freshwater To Marine Saline Gradient | MKDKFMHQSTLDLFCDHADAQMAEEYTMELEAKAAELEITVDYYIAEFL* |
| Ga0129333_103906472 | 3300010354 | Freshwater To Marine Saline Gradient | SKRTHQPEQMTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITVDYYMMEFV* |
| Ga0129333_104067285 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHDDEMFADEYAMEIEAKAAELEITVDYYMMEFI* |
| Ga0129333_104830093 | 3300010354 | Freshwater To Marine Saline Gradient | MHDSTLDLFCDSDSEEYADEYAMEIEKKASELEITVDYYIAEFL* |
| Ga0129333_108580264 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDENYADEYAMEIERKCAELEITVDYYMMEFI* |
| Ga0129333_109110122 | 3300010354 | Freshwater To Marine Saline Gradient | MNDSTLDLFCQHEDENYADEYAMEIERKCAEMEITVDYYMMEFV* |
| Ga0129333_109581592 | 3300010354 | Freshwater To Marine Saline Gradient | MKDKFMTDSTLDLFCQHADAQMAEEYAMELEAKAAELQITVDYFIAEFL* |
| Ga0129336_101319255 | 3300010370 | Freshwater To Marine Saline Gradient | MHDSTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYI |
| Ga0129336_101716481 | 3300010370 | Freshwater To Marine Saline Gradient | KRTHQPEQMTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITVDYYMMEFV* |
| Ga0136549_1000122542 | 3300010389 | Marine Methane Seep Sediment | MHDSTLDLFCNSDDEIFADEYAQEFEEKANSLEITVDYYLMEFV* |
| Ga0151620_100182013 | 3300011268 | Freshwater | MHESTLDLFCNDNSDEIADEYALEIERKATELEVTVDYYLAEFV* |
| Ga0151620_10529061 | 3300011268 | Freshwater | MMHQSTLDLFCDHADAQMAEEYTMELEAKAAELEITVDYYIAEFL* |
| Ga0151620_10894492 | 3300011268 | Freshwater | MHDSTLDLFCNHDSDEFADEYAMELEQKAAELEVTVDYYIAEFL* |
| Ga0119951_11439152 | 3300012000 | Freshwater | MFDSTLDLFCQHEDDKYADEYAMELEQKAAELEITVDYYMMEFL* |
| Ga0160423_100320994 | 3300012920 | Surface Seawater | MHDSTLDLFCQDGDDTFADEYAKEIELKAAELEVTVDYYMQEFL* |
| Ga0163109_100469104 | 3300012936 | Surface Seawater | MMHESTLDLFCQHADETIADEYAKEIELKAAELEVTVDYYMEEFL* |
| Ga0163111_101365104 | 3300012954 | Surface Seawater | MHDSTLDLFCQDADETFADEYAKEIEQRAAELEVTVDYYMQEFL* |
| Ga0163212_10185535 | 3300013087 | Freshwater | MKDKFMHQSTLDLFCDHADAQMAEEYTMELEAKAAELEVTVDYYIAEFL* |
| Ga0116836_10096621 | 3300013181 | Marine | MKNQFMHESTLDLFCDQADAQMAEEYTLELEAKAAELEVTVDYYMSEFL* |
| Ga0116813_10347172 | 3300013253 | Marine | MMHESTLDLFCQHADETIADEYAKEIELKATELEVTVDYYMSEFL* |
| Ga0181356_11040671 | 3300017761 | Freshwater Lake | MFNSTLDLFCQHEDAEYADEFAMELEEKAAELEVTVDYY |
| Ga0181356_11048871 | 3300017761 | Freshwater Lake | STLDLFCEHEDAEYADEFAMELEEKAAKLEVTVDYYMMEFL |
| Ga0181583_108455891 | 3300017952 | Salt Marsh | MKDKMMHQSTLDLFCDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL |
| Ga0181580_106807023 | 3300017956 | Salt Marsh | MHESTLDLFCSVESDTFAQEYAMEIEQKAAELELTVDYYMAEFL |
| Ga0181359_10592162 | 3300019784 | Freshwater Lake | MFNSTLDLFCQHEDAEYADEFAMELEEKAAELEVTVDYYMAEFM |
| Ga0194113_100312721 | 3300020074 | Freshwater Lake | MHKSTLDLFCAHEDEQLAHEFAIELESKAAELEVTVDYYLMEFVE |
| Ga0194113_101194425 | 3300020074 | Freshwater Lake | MHESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYLAEFV |
| Ga0194113_102886461 | 3300020074 | Freshwater Lake | MHESTLDLFCDHDDEQLAHEFAIELESKAAELEVTVDYYLMEFVE |
| Ga0194111_1000030815 | 3300020083 | Freshwater Lake | MHKSTLDLFCAHEDEQLAHEFAMELESKAAELEVTVDYYLMEFVE |
| Ga0194112_1003287716 | 3300020109 | Freshwater Lake | MHQSTLDLFCDHADAQMAEEYTMELEAKAAELEVTVDYYIAEFL |
| Ga0194112_108990812 | 3300020109 | Freshwater Lake | MHNSTLDLFCNHADAQMADEYAMELEAKAAELEITVDYYIAEFL |
| Ga0211732_11272431 | 3300020141 | Freshwater | MNDSTLDLFCQHEDEAFADEYAMELERKAAELEITVDYYIAEFM |
| Ga0211732_11727462 | 3300020141 | Freshwater | MMFDSTLDLFCQHDDAEYADEFAMELEEKAAELEVTVDYYMMEFM |
| Ga0211732_14397833 | 3300020141 | Freshwater | MFDSTLDLFCQHDDAQYADEFAMELEEKAAELEVTVDYYMMEFM |
| Ga0211732_14401353 | 3300020141 | Freshwater | MMFDSTLDLFCQHEDAQYADEFAMELEEKAAALEVTVDYYMAEFM |
| Ga0211736_101377733 | 3300020151 | Freshwater | MNDSTLDLFCQHEDGDDADQFAMEIEMKAALLEVTVDYYMMEFM |
| Ga0211736_102207742 | 3300020151 | Freshwater | MFDSTLDLFCQHDDAEYADEFAMELEEKAAELEVTVDYYMMEFM |
| Ga0211736_105272771 | 3300020151 | Freshwater | MNDSTLDLFCQHEDGEYADEYAMEIERKCAELEITVDYYMMEFI |
| Ga0211736_107788762 | 3300020151 | Freshwater | MYDSTLDLFCNHEDDQLADEYAMEIEMKAAILEVTVDYYMMEFM |
| Ga0211736_109590572 | 3300020151 | Freshwater | MHESTFDLFCDHEDERMAHEFAMELESKAAELEVTVDYYLMEFVE |
| Ga0211734_106521853 | 3300020159 | Freshwater | MFDSTLDLFCQHEDAQYADEFAMELEEKAAALEVTVDYYMAEFM |
| Ga0211734_113423472 | 3300020159 | Freshwater | MFDSTLDLFCQHDDAEYADEFAMELEEKAAALEVTVDYYMMEFM |
| Ga0211733_104357923 | 3300020160 | Freshwater | MNDSTLDLFCQHEDENYADEYAMEIERKCAELEITVDYYMMEFV |
| Ga0211735_115684393 | 3300020162 | Freshwater | LDLFCQHEDAQYADEFAMELEEKAAALEVTVDYYMAEFM |
| Ga0211735_115685811 | 3300020162 | Freshwater | MMFDSTLDLFCQHEDAQYADEFAMELEEKAAALEVTVDY |
| Ga0211729_108354993 | 3300020172 | Freshwater | MHQSTLDLFCEHADAQIADEYAMELEAKAAELEITVDYYIAEFL |
| Ga0194131_100384067 | 3300020193 | Freshwater Lake | HESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYLAEFI |
| Ga0194131_104855991 | 3300020193 | Freshwater Lake | KFMHQSTLDLFCDHADAQMAEEYTMELEAKAAELEVTVDYYIAEFL |
| Ga0194121_104907411 | 3300020200 | Freshwater Lake | HLIRKINTMHESTLDLFCNHDSDEFADEYAMEIERKAAELEVTVDYYLAEFV |
| Ga0211731_114809972 | 3300020205 | Freshwater | MTDSTLDLFCDHADTQMAEEYAMELESKAAELEVTVDYYMAEFL |
| Ga0211501_100030012 | 3300020239 | Marine | MHESTLDLFCQHADETIADEYAKEIELKAAELELPVDYYMQEFM |
| Ga0211529_10015506 | 3300020258 | Marine | MHDSTLDLFCQDGDDTFADEYAKEIELKAAELEVTVDYYMQEFL |
| Ga0211526_10079274 | 3300020264 | Marine | MHESTLDLFCQHADEIIADEYAKEIELKAAELELPVDYYMQEFM |
| Ga0211483_101880423 | 3300020281 | Marine | TNCDDTKLAEEFASEIEQKAAHLEVTVDYYMQEFM |
| Ga0211532_101679581 | 3300020403 | Marine | MHESTLDLFCQYADETIADEYAKEIELKATELEVTVDYYMQEFL |
| Ga0211532_102174673 | 3300020403 | Marine | MNESTLDLFCNRDDDEQYWKELEEKAAEYEVTLDYYLAEFCD |
| Ga0208223_100013425 | 3300020519 | Freshwater | MTFMNESTLDLFCQHEDETYADEYAMEFERKAAELEITVDYFLMEFV |
| Ga0213858_100990772 | 3300021356 | Seawater | MYESTLDLFCNEDDDKFAEEFWLEIERKAAELEVTVDYFMMEFM |
| Ga0213860_101974561 | 3300021368 | Seawater | FCDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL |
| Ga0213866_100287401 | 3300021425 | Seawater | CDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL |
| Ga0213922_10041295 | 3300021956 | Freshwater | MNDITLDLFCEHEDESNEAELFSMEIEMKAAILEVTVDYFMLEFM |
| Ga0222715_101061071 | 3300021960 | Estuarine Water | ERFIVMHDSTLDLFCQHEDENYADEYAMELERKAAELEVTVDYYVMEFI |
| Ga0222712_104945172 | 3300021963 | Estuarine Water | MFDSTLDLFCEHDDAEYADEFAMELEEKSAAFEITVDYYMAEFM |
| Ga0196907_1005683 | 3300022149 | Aqueous | MYESTLDLFCNEDNDKFAEEFWLEIERKAAELEVTVDYFMMEFM |
| Ga0181353_11405411 | 3300022179 | Freshwater Lake | MNESTLDLFCQHEDEMFAEEYVTELEMKAAYFEVSIDYYMMEFM |
| Ga0196905_10412292 | 3300022198 | Aqueous | MTDSTLDLFCQHADAQMAEEYAMELEAKAAELEITVDYYIAEFL |
| Ga0196901_11238611 | 3300022200 | Aqueous | MKDKMMHQSTLDLFCDHADKQMAEEYAMEIEAKAAELEVTVDYYMAEFLX |
| Ga0224501_102010884 | 3300022223 | Sediment | MEDKFMSESSLDLFCELPSEQMAEEYAMELEAKAAALEVTVDYYMAEFM |
| Ga0228701_10872102 | 3300022746 | Freshwater | LDLFCQHADAQMAEEYAMELEAKAAELEITVDYYMAEFL |
| (restricted) Ga0233432_104049332 | 3300023109 | Seawater | MMHESTLDLFCKYADEIMADEYAKEIELKAAELEVTVDYYMSEFM |
| Ga0255761_104698481 | 3300023170 | Salt Marsh | TLDLFCDHADEQMAEEYTLELEAKAAELEVTVDYYMAEFL |
| Ga0214923_102456172 | 3300023179 | Freshwater | MMFDSTLDLFCQHEDDKYADEYAMELEQLASKYEVTVDYILMEFL |
| Ga0247724_10079875 | 3300024239 | Deep Subsurface Sediment | MNESTLDLFCQHEDEMYADEYAMELERKASELEITIDYYMMEFV |
| Ga0255152_10121005 | 3300024503 | Freshwater | MHESTLDLFCNDNSDEIADEYALEIERKATELEVTVDYYLAEFV |
| Ga0208428_10289121 | 3300025653 | Aqueous | TLDLFCDHADEQMAEEYTLELEAKAAELEITVDYYMAEFL |
| Ga0208784_10076435 | 3300025732 | Aqueous | MNDSTLDLFCQHEDETFADEYAMELERKASSLEITVDYLIQEFMISLY |
| Ga0208005_100217311 | 3300025848 | Aqueous | NLQNQMNDSTLDLFCQHEDETFADEYAMELERKASSLEITVDYLIQEFMISLY |
| Ga0209666_13979261 | 3300025870 | Marine | MHESTLDLFFEYADEIIADEYAKEIELKAAELEVTVDYYMSEFM |
| Ga0208783_100190055 | 3300025872 | Aqueous | DDYSSSNLQNQMNDSTLDLFCQHEDETFADEYAMELERKASSLEITVDYLIQEFMISLY |
| Ga0208644_12285781 | 3300025889 | Aqueous | MNDSTLDLFCQHEDERFADEYAMEMEQKAAQLEVTVDYYM |
| Ga0208555_10508672 | 3300027213 | Estuarine | MMHESTLDLFCEYADEIMADEYAKEIELKAAELEVTVDYYMSEFM |
| Ga0208133_11655853 | 3300027631 | Estuarine | MMFDSTLDLFCQHDDAEYADEFAMELEEKAAELEVTVDYYM |
| Ga0209704_100004561 | 3300027693 | Freshwater Sediment | MTFMNESTLDLFCQHEDEMYADEYAMELERKAAELEITVDYYMMEFV |
| Ga0209087_13556921 | 3300027734 | Freshwater Lake | MFNSTLDLFCEHEDAEYADEFAMELEEKAAAFEITVDYLLMEFM |
| Ga0209596_1000342106 | 3300027754 | Freshwater Lake | MMFNSTLDLFCEHEDAEYADEFAMELEELASKYEVTCDYIIQEFILD |
| Ga0209288_101349023 | 3300027762 | Freshwater Sediment | LTMNNSTLDLFCENEDESNEAEQFSMEIEMKAAILEITVDYYMMEFM |
| Ga0209088_100524572 | 3300027763 | Freshwater Lake | MFDSTLDLFCQHDDAEYADEFAMEIEELASKYEVTCDYIIQEFILD |
| Ga0209088_100707143 | 3300027763 | Freshwater Lake | MMFDSTLDLFCEHDDAEYADEFAMELEEKAAALEVTVDYYMAEFM |
| Ga0209107_100411644 | 3300027797 | Freshwater And Sediment | MMFDSTLDLFCQHDDAEYADEFAMELEELASKYEVTCDYYSMEFM |
| Ga0209893_10046951 | 3300027940 | Sand | FCEHDDAEYADEFAMELEEKAAELEVTVDYYMAEFM |
| Ga0119944_10071163 | 3300029930 | Aquatic | TLDLFCQHEDERFADEYAMEMEQKAAELEVTVDYYMMEFM |
| Ga0307380_101422925 | 3300031539 | Soil | MKPENFLSDSTLDLFCDHADEQLADEYALEIEQKAAALEVTVDYYMAEFM |
| Ga0315907_1002420912 | 3300031758 | Freshwater | MNDSTLDLFCQHEDENYADEYAMEIERKCAELEITVDYYLMEFI |
| Ga0315909_108125472 | 3300031857 | Freshwater | MTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITVDYYMMEFV |
| Ga0315904_100040612 | 3300031951 | Freshwater | MTFMNDSTLDLFCQHDDEMYADEYAMEIERKCAELEITVDYYMMEFV |
| Ga0315904_103369222 | 3300031951 | Freshwater | MTFMNDSTLDLFCQHDDEMYADEYAMELERKAAELEITIDYYMMEFV |
| Ga0315284_119866682 | 3300032053 | Sediment | MTESSLDLFCDHIDDEYDMDLETKAAELEITVDYYIAEFL |
| Ga0334980_0316856_232_366 | 3300033816 | Freshwater | MHESTLDLFCGDESEEFADEYAMELEKKAAELEITVDYYIAEFL |
| Ga0334978_0000014_29384_29533 | 3300033979 | Freshwater | MKDKFMTDSTLDLFCDHADTQMAEEYAMELEAKAAELEITVDYYIAEFL |
| Ga0334982_0004228_5545_5694 | 3300033981 | Freshwater | MKDKFMTDSTLDLFCQHADAQMAEEYAMELEAKAAELEITVDYYIAEFL |
| Ga0334998_0278630_3_116 | 3300034019 | Freshwater | LFCQHADAQMAEEYAMELEAKAAELEITVDYYIAEFL |
| Ga0335004_0696148_2_139 | 3300034021 | Freshwater | MKDKFMHNSTLDLFCDHADAQMADEYAMELEQKAAELEITVDYYIA |
| Ga0334987_0558615_430_579 | 3300034061 | Freshwater | MKDNFMTDSTLDLFCQHEDAQMAEEYAMELEAKAAELEITVDYYIAEFL |
| Ga0334995_0071852_718_846 | 3300034062 | Freshwater | MNESTLDLFCSHEDETYVDELERKAAELEITCDYLLMEFILE |
| Ga0335000_0325597_110_259 | 3300034063 | Freshwater | MKDKFMHQSTLDLFCQHADAQMAEEYAMELEAKAAELEITVDYYMAEFL |
| Ga0310130_0126783_647_772 | 3300034073 | Fracking Water | STLDLFCQHEDEMYADEYAMELERKASELEITIDYYMMEFI |
| Ga0335029_0320050_261_395 | 3300034102 | Freshwater | MHESTLDLFCGDDSNEFADEYAMEIERKAAELEVTVDYYIAEFL |
| Ga0335029_0423626_599_733 | 3300034102 | Freshwater | MHDSTLDLFCDHDSDEFADEYAMEIEKKAAELEVTVDYYIAEFL |
| Ga0335030_0684566_313_447 | 3300034103 | Freshwater | MHDSTLDLFCEHESAEYADEYAKEIEMLAAELEVTVDYYMAEFM |
| Ga0335066_0310648_306_455 | 3300034112 | Freshwater | MKDKFMHNSTLDLFCDHADAQMADEYAMELEQKAAELEITVDYYIAEFL |
| Ga0335049_0881547_386_520 | 3300034272 | Freshwater | MTFMNDSTLDLFCQHDDEMYADEYAMELERKASELEITCDYLLME |
| ⦗Top⦘ |