


| Basic Information | |
|---|---|
| Family ID | F031386 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 182 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MTPNVRDQRRRAVGAPLADRNLSAPGPVPASGVPTRDDRCIA |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 166 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 32.37 % |
| % of genes near scaffold ends (potentially truncated) | 43.41 % |
| % of genes from short scaffolds (< 2000 bps) | 69.23 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.341 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater (36.264 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.297 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.253 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 166 Family Scaffolds |
|---|---|---|
| PF04365 | BrnT_toxin | 5.42 |
| PF01381 | HTH_3 | 4.82 |
| PF05016 | ParE_toxin | 4.22 |
| PF05973 | Gp49 | 3.01 |
| PF09720 | Unstab_antitox | 2.41 |
| PF14384 | BrnA_antitoxin | 1.81 |
| PF00583 | Acetyltransf_1 | 1.20 |
| PF09413 | DUF2007 | 1.20 |
| PF04828 | GFA | 1.20 |
| PF13644 | DKNYY | 1.20 |
| PF01844 | HNH | 1.20 |
| PF03734 | YkuD | 1.20 |
| PF00929 | RNase_T | 0.60 |
| PF13432 | TPR_16 | 0.60 |
| PF00293 | NUDIX | 0.60 |
| PF14257 | DUF4349 | 0.60 |
| PF02397 | Bac_transf | 0.60 |
| PF00805 | Pentapeptide | 0.60 |
| PF00889 | EF_TS | 0.60 |
| PF07007 | LprI | 0.60 |
| PF03544 | TonB_C | 0.60 |
| PF01230 | HIT | 0.60 |
| PF14137 | DUF4304 | 0.60 |
| PF13744 | HTH_37 | 0.60 |
| PF07110 | EthD | 0.60 |
| PF13673 | Acetyltransf_10 | 0.60 |
| PF14534 | DUF4440 | 0.60 |
| PF13599 | Pentapeptide_4 | 0.60 |
| PF13711 | DUF4160 | 0.60 |
| PF02810 | SEC-C | 0.60 |
| PF11026 | DUF2721 | 0.60 |
| PF07883 | Cupin_2 | 0.60 |
| PF08734 | GYD | 0.60 |
| PF04402 | SIMPL | 0.60 |
| PF12973 | Cupin_7 | 0.60 |
| PF03807 | F420_oxidored | 0.60 |
| PF09832 | DUF2059 | 0.60 |
| PF08378 | NERD | 0.60 |
| COG ID | Name | Functional Category | % Frequency in 166 Family Scaffolds |
|---|---|---|---|
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 5.42 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 3.01 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 3.01 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 1.20 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.20 |
| COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.60 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.60 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.60 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.60 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.60 |
| COG3755 | Uncharacterized conserved protein YecT, DUF1311 family | Function unknown [S] | 0.60 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 59.34 % |
| Unclassified | root | N/A | 40.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_108637130 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300002121|C687J26615_10088850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 773 | Open in IMG/M |
| 3300003995|Ga0055438_10167061 | Not Available | 658 | Open in IMG/M |
| 3300003995|Ga0055438_10227232 | Not Available | 574 | Open in IMG/M |
| 3300004022|Ga0055432_10267660 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004050|Ga0055491_10234605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300004057|Ga0055496_10041535 | Not Available | 952 | Open in IMG/M |
| 3300004058|Ga0055498_10011179 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300004067|Ga0055485_10041867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300004463|Ga0063356_102760031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Halieaceae | 756 | Open in IMG/M |
| 3300004463|Ga0063356_103710206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Sphaerotilaceae → Inhella → Inhella inkyongensis | 658 | Open in IMG/M |
| 3300004782|Ga0062382_10416381 | Not Available | 635 | Open in IMG/M |
| 3300005830|Ga0074473_10503479 | Not Available | 885 | Open in IMG/M |
| 3300006871|Ga0075434_100330961 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300006876|Ga0079217_10212400 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300006876|Ga0079217_10675625 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300006918|Ga0079216_10932700 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300007004|Ga0079218_11937624 | Not Available | 669 | Open in IMG/M |
| 3300009053|Ga0105095_10346064 | All Organisms → cellular organisms → Bacteria → FCB group | 819 | Open in IMG/M |
| 3300009087|Ga0105107_11326790 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Poribacteria | 502 | Open in IMG/M |
| 3300009162|Ga0075423_10534683 | All Organisms → cellular organisms → Bacteria | 1234 | Open in IMG/M |
| 3300009430|Ga0114938_1023479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2492 | Open in IMG/M |
| 3300009430|Ga0114938_1027047 | All Organisms → cellular organisms → Bacteria | 2281 | Open in IMG/M |
| 3300009685|Ga0116142_10121627 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
| 3300009685|Ga0116142_10556119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin12 | 542 | Open in IMG/M |
| 3300009687|Ga0116144_10149776 | Not Available | 1281 | Open in IMG/M |
| 3300009690|Ga0116143_10220686 | Not Available | 1008 | Open in IMG/M |
| 3300009690|Ga0116143_10228470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin12 | 986 | Open in IMG/M |
| 3300009690|Ga0116143_10306687 | Not Available | 817 | Open in IMG/M |
| 3300009690|Ga0116143_10347697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 755 | Open in IMG/M |
| 3300009807|Ga0105061_1091068 | Not Available | 522 | Open in IMG/M |
| 3300009870|Ga0131092_11497217 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300009873|Ga0131077_10036534 | All Organisms → cellular organisms → Bacteria | 7422 | Open in IMG/M |
| 3300009873|Ga0131077_10038120 | All Organisms → cellular organisms → Bacteria | 7185 | Open in IMG/M |
| 3300009873|Ga0131077_10038120 | All Organisms → cellular organisms → Bacteria | 7185 | Open in IMG/M |
| 3300009873|Ga0131077_10043172 | All Organisms → cellular organisms → Bacteria | 6545 | Open in IMG/M |
| 3300009873|Ga0131077_10043172 | All Organisms → cellular organisms → Bacteria | 6545 | Open in IMG/M |
| 3300009873|Ga0131077_10043172 | All Organisms → cellular organisms → Bacteria | 6545 | Open in IMG/M |
| 3300009873|Ga0131077_10045656 | All Organisms → cellular organisms → Bacteria | 6285 | Open in IMG/M |
| 3300009873|Ga0131077_10045656 | All Organisms → cellular organisms → Bacteria | 6285 | Open in IMG/M |
| 3300009873|Ga0131077_10045656 | All Organisms → cellular organisms → Bacteria | 6285 | Open in IMG/M |
| 3300009873|Ga0131077_10049625 | All Organisms → cellular organisms → Bacteria | 5908 | Open in IMG/M |
| 3300009873|Ga0131077_10059362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7878 | Open in IMG/M |
| 3300009873|Ga0131077_10059362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7878 | Open in IMG/M |
| 3300009873|Ga0131077_10063401 | Not Available | 4921 | Open in IMG/M |
| 3300009873|Ga0131077_10079639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4154 | Open in IMG/M |
| 3300009873|Ga0131077_10079639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4154 | Open in IMG/M |
| 3300009873|Ga0131077_10079639 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4154 | Open in IMG/M |
| 3300009873|Ga0131077_10091218 | All Organisms → cellular organisms → Bacteria | 3760 | Open in IMG/M |
| 3300009873|Ga0131077_10091218 | All Organisms → cellular organisms → Bacteria | 3760 | Open in IMG/M |
| 3300009873|Ga0131077_10096572 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
| 3300009873|Ga0131077_10096572 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
| 3300009873|Ga0131077_10096572 | All Organisms → cellular organisms → Bacteria | 3607 | Open in IMG/M |
| 3300009873|Ga0131077_10100526 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300009873|Ga0131077_10100526 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300009873|Ga0131077_10120285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3848 | Open in IMG/M |
| 3300009873|Ga0131077_10121452 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300009873|Ga0131077_10126505 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300009873|Ga0131077_10136057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Oleiagrimonas → Oleiagrimonas soli | 2812 | Open in IMG/M |
| 3300009873|Ga0131077_10147628 | Not Available | 2651 | Open in IMG/M |
| 3300009873|Ga0131077_10166807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Propionivibrio → Candidatus Propionivibrio aalborgensis | 2423 | Open in IMG/M |
| 3300009873|Ga0131077_10171217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin12 | 2378 | Open in IMG/M |
| 3300009873|Ga0131077_10171217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin12 | 2378 | Open in IMG/M |
| 3300009873|Ga0131077_10181621 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2279 | Open in IMG/M |
| 3300009873|Ga0131077_10189694 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2209 | Open in IMG/M |
| 3300009873|Ga0131077_10213152 | Not Available | 2033 | Open in IMG/M |
| 3300009873|Ga0131077_10213152 | Not Available | 2033 | Open in IMG/M |
| 3300009873|Ga0131077_10221158 | All Organisms → cellular organisms → Bacteria | 1980 | Open in IMG/M |
| 3300009873|Ga0131077_10278125 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300009873|Ga0131077_10301927 | All Organisms → cellular organisms → Bacteria | 1591 | Open in IMG/M |
| 3300009873|Ga0131077_10312887 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300009873|Ga0131077_10393168 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → unclassified Lentisphaeria → Lentisphaeria bacterium | 1326 | Open in IMG/M |
| 3300009873|Ga0131077_10447992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. MKT | 1213 | Open in IMG/M |
| 3300009873|Ga0131077_10512645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300009873|Ga0131077_10547058 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300009873|Ga0131077_10584165 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
| 3300009873|Ga0131077_10606694 | Not Available | 989 | Open in IMG/M |
| 3300009873|Ga0131077_10606694 | Not Available | 989 | Open in IMG/M |
| 3300009873|Ga0131077_10613351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio → unclassified Thioalkalivibrio → Thioalkalivibrio sp. XN8 | 982 | Open in IMG/M |
| 3300009873|Ga0131077_10620468 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300009873|Ga0131077_10674786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300009873|Ga0131077_10679535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 918 | Open in IMG/M |
| 3300009873|Ga0131077_10901942 | Not Available | 762 | Open in IMG/M |
| 3300009873|Ga0131077_10908362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300009873|Ga0131077_11040656 | Not Available | 695 | Open in IMG/M |
| 3300009873|Ga0131077_11062869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae | 686 | Open in IMG/M |
| 3300009873|Ga0131077_11108401 | Not Available | 668 | Open in IMG/M |
| 3300009873|Ga0131077_11172669 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
| 3300009873|Ga0131077_11210934 | Not Available | 632 | Open in IMG/M |
| 3300009873|Ga0131077_11255572 | Not Available | 617 | Open in IMG/M |
| 3300009873|Ga0131077_11265648 | Not Available | 614 | Open in IMG/M |
| 3300009873|Ga0131077_11285820 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300009873|Ga0131077_11320975 | Not Available | 598 | Open in IMG/M |
| 3300009873|Ga0131077_11359830 | Not Available | 588 | Open in IMG/M |
| 3300009873|Ga0131077_11387194 | Not Available | 581 | Open in IMG/M |
| 3300009873|Ga0131077_11476930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli | 559 | Open in IMG/M |
| 3300009873|Ga0131077_11477780 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009873|Ga0131077_11682988 | Not Available | 516 | Open in IMG/M |
| 3300010356|Ga0116237_10126433 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300010356|Ga0116237_10728221 | Not Available | 849 | Open in IMG/M |
| 3300010356|Ga0116237_10890565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300010356|Ga0116237_11550229 | Not Available | 542 | Open in IMG/M |
| 3300010391|Ga0136847_10256949 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300010391|Ga0136847_12908292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Rhizobacter → unclassified Rhizobacter → Rhizobacter sp. AJA081-3 | 904 | Open in IMG/M |
| 3300011395|Ga0137315_1000792 | Not Available | 2486 | Open in IMG/M |
| 3300011402|Ga0137356_1004314 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
| 3300011410|Ga0137440_1069365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 696 | Open in IMG/M |
| 3300011415|Ga0137325_1045604 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300011416|Ga0137422_1050590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Caenimonas → Caenimonas koreensis → Caenimonas koreensis DSM 17982 | 995 | Open in IMG/M |
| 3300011417|Ga0137326_1097430 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300012122|Ga0137332_1007126 | Not Available | 1149 | Open in IMG/M |
| 3300014149|Ga0181613_1184013 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300014268|Ga0075309_1188313 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300014272|Ga0075327_1202593 | Not Available | 634 | Open in IMG/M |
| 3300014326|Ga0157380_13006539 | Not Available | 537 | Open in IMG/M |
| 3300014885|Ga0180063_1215248 | Not Available | 617 | Open in IMG/M |
| 3300015249|Ga0180071_1036024 | Not Available | 701 | Open in IMG/M |
| 3300015258|Ga0180093_1141006 | Not Available | 609 | Open in IMG/M |
| 3300015258|Ga0180093_1142829 | Not Available | 605 | Open in IMG/M |
| 3300015372|Ga0132256_102426173 | Not Available | 627 | Open in IMG/M |
| 3300018082|Ga0184639_10407308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium RIFCSPLOWO2_12_FULL_52_10 | 701 | Open in IMG/M |
| 3300018466|Ga0190268_10756157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 726 | Open in IMG/M |
| 3300019458|Ga0187892_10008033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14661 | Open in IMG/M |
| 3300019458|Ga0187892_10083971 | Not Available | 1966 | Open in IMG/M |
| 3300019458|Ga0187892_10124580 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300019458|Ga0187892_10143810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 1346 | Open in IMG/M |
| 3300019458|Ga0187892_10411127 | Not Available | 642 | Open in IMG/M |
| 3300019487|Ga0187893_10076564 | All Organisms → cellular organisms → Bacteria | 3118 | Open in IMG/M |
| 3300019487|Ga0187893_10222880 | Not Available | 1420 | Open in IMG/M |
| 3300019487|Ga0187893_10243508 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300019487|Ga0187893_10249181 | Not Available | 1310 | Open in IMG/M |
| 3300019487|Ga0187893_10266491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales | 1247 | Open in IMG/M |
| 3300019487|Ga0187893_10355509 | Not Available | 1013 | Open in IMG/M |
| 3300019487|Ga0187893_10382722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300019487|Ga0187893_10460786 | Not Available | 841 | Open in IMG/M |
| 3300019487|Ga0187893_10509582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 783 | Open in IMG/M |
| 3300019487|Ga0187893_10511453 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300019487|Ga0187893_10536014 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300019487|Ga0187893_10574987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300019487|Ga0187893_10582377 | Not Available | 713 | Open in IMG/M |
| 3300019487|Ga0187893_10583413 | Not Available | 712 | Open in IMG/M |
| 3300019487|Ga0187893_10587963 | Not Available | 708 | Open in IMG/M |
| 3300019487|Ga0187893_10593037 | Not Available | 704 | Open in IMG/M |
| 3300019487|Ga0187893_10648330 | Not Available | 661 | Open in IMG/M |
| 3300019487|Ga0187893_10736045 | Not Available | 606 | Open in IMG/M |
| 3300019487|Ga0187893_10794011 | Not Available | 575 | Open in IMG/M |
| 3300019487|Ga0187893_10807471 | Not Available | 569 | Open in IMG/M |
| 3300019487|Ga0187893_10819768 | Not Available | 563 | Open in IMG/M |
| 3300021332|Ga0210339_1644885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae | 642 | Open in IMG/M |
| 3300022213|Ga0224500_10267650 | Not Available | 621 | Open in IMG/M |
| 3300022309|Ga0224510_10279112 | Not Available | 1005 | Open in IMG/M |
| 3300025106|Ga0209398_1011462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2905 | Open in IMG/M |
| 3300025106|Ga0209398_1011462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2905 | Open in IMG/M |
| 3300025552|Ga0210142_1072182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
| 3300025784|Ga0209200_1231535 | Not Available | 630 | Open in IMG/M |
| 3300025859|Ga0209096_1320219 | Not Available | 552 | Open in IMG/M |
| 3300025971|Ga0210102_1053825 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026059|Ga0208540_1028436 | Not Available | 634 | Open in IMG/M |
| 3300026535|Ga0256867_10193217 | Not Available | 748 | Open in IMG/M |
| 3300027639|Ga0209387_1158939 | Not Available | 597 | Open in IMG/M |
| 3300027964|Ga0256864_1151428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 659 | Open in IMG/M |
| 3300028648|Ga0268299_1000001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2680031 | Open in IMG/M |
| 3300030606|Ga0299906_10376509 | Not Available | 1100 | Open in IMG/M |
| 3300030619|Ga0268386_10383870 | Not Available | 992 | Open in IMG/M |
| 3300030619|Ga0268386_11035702 | Not Available | 502 | Open in IMG/M |
| 3300031455|Ga0307505_10503599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300032053|Ga0315284_11439329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 736 | Open in IMG/M |
| 3300032164|Ga0315283_10863068 | Not Available | 966 | Open in IMG/M |
| 3300032275|Ga0315270_10763330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 635 | Open in IMG/M |
| 3300032516|Ga0315273_10027090 | Not Available | 7607 | Open in IMG/M |
| 3300033407|Ga0214472_10054033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4061 | Open in IMG/M |
| 3300033407|Ga0214472_10326607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1454 | Open in IMG/M |
| 3300033407|Ga0214472_11710874 | Not Available | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 36.26% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 11.54% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.14% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 7.14% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.95% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.75% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 2.75% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.20% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.10% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.10% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.10% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.10% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.10% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.10% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 1.10% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.55% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.55% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.55% |
| Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | 0.55% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300003995 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004050 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2 | Environmental | Open in IMG/M |
| 3300004057 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009430 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring | Environmental | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011395 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2 | Environmental | Open in IMG/M |
| 3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300011417 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2 | Environmental | Open in IMG/M |
| 3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
| 3300012122 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT200_2 | Environmental | Open in IMG/M |
| 3300014149 | In situ water column microbial community from the vent pool of Chocolate Pots hot spring, Yellowstone National Park, Wyoming, USA - CP Vent Pool | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015249 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10D | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025106 | Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025971 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026059 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028648 | Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor | Engineered | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1086371302 | 3300001213 | Wetland | SNVRDQRRRAVGAPLAGQNLRELLAVLASGVTTSADRCIA* |
| C687J26615_100888501 | 3300002121 | Soil | PNIRDQRRRAVGAPLADRNPREPLAVPAGGVTTSAECCIA* |
| Ga0055438_101670611 | 3300003995 | Natural And Restored Wetlands | SVTHNVTGYKTPNARDQRRRTVGAPLADRNLLEPFAVPASGVTTRDDRCIA* |
| Ga0055438_102272321 | 3300003995 | Natural And Restored Wetlands | NVRDQRRRAVGAPLAVRHPSAPVPVPASGVPTRADRCIA* |
| Ga0055432_102676602 | 3300004022 | Natural And Restored Wetlands | KKSKMPRMSDRAPSCMMSNARDQRRRAVGAPLALVASGVTTSADRCIA* |
| Ga0055491_102346052 | 3300004050 | Natural And Restored Wetlands | MIANVRDQRRRAVGAPLADQNSWELPADPASGVTTEADRCIA* |
| Ga0055496_100415354 | 3300004057 | Natural And Restored Wetlands | PNVRDQRRRAVGAPLAGQSLWKPLAVSASGVTTRDDRCIA* |
| Ga0055498_100111793 | 3300004058 | Natural And Restored Wetlands | MVTPNVRDQRRRAVAAPLAGQSLWGPLAGRASGVTTSADRCIA* |
| Ga0055485_100418672 | 3300004067 | Natural And Restored Wetlands | MRLPPNVRDQRRRAVGAPLADQDLWMPLANPASGVTTRADRCIA* |
| Ga0063356_1027600312 | 3300004463 | Arabidopsis Thaliana Rhizosphere | PNVRDQRRRAVGAPFAGANLCGSLAVPASGVPTSADRCIA* |
| Ga0063356_1037102061 | 3300004463 | Arabidopsis Thaliana Rhizosphere | SNVRDQRRRAVGAPLADQNLWELLAVPASGVTTEADRCIA* |
| Ga0062382_104163812 | 3300004782 | Wetland Sediment | MLLNVRDQRRRAVGAPLADHNLCQPLIVAASGVTTRDDRCIA* |
| Ga0074473_105034793 | 3300005830 | Sediment (Intertidal) | SLPSNVRDQRRRAVGAPLADRNPSALVHVPASGVPTRADRCIA* |
| Ga0075434_1003309615 | 3300006871 | Populus Rhizosphere | PNVRDQRRRTVGAPLAGRALGELLALCASGVTTRGDRCIA* |
| Ga0079217_102124001 | 3300006876 | Agricultural Soil | NVHDQRRRVVGAPLAARNFLDLLAVPASGVTTSAERCIA* |
| Ga0079217_106756252 | 3300006876 | Agricultural Soil | VPPNVRDQRRRAVGAPLAGRNLYALQPVAASSVPTEADRCIA* |
| Ga0079216_109327003 | 3300006918 | Agricultural Soil | ICFVMPNVRDQRRRAVGAPLADRNPSLPAPVAASGVPTRDDRCIA* |
| Ga0079218_119376242 | 3300007004 | Agricultural Soil | MMMSNVRDQRRRAVGAPLAGRNAWGMLAGLASGVTTREDR* |
| Ga0105095_103460641 | 3300009053 | Freshwater Sediment | LPTLRAVSKPRHKVTPYVRDQRRRAVGAPLAARNLSEPLAVPASGVTTSDDRCIA* |
| Ga0105107_113267903 | 3300009087 | Freshwater Sediment | NVRDQRRRAVGAPLAVRILWEPLAVPASGVTTRDDRCIA* |
| Ga0075423_105346832 | 3300009162 | Populus Rhizosphere | MGPSALAMRPNVRDQRRRTVGAPLAGRALGELLALCASGVTTRGDRCIA* |
| Ga0114938_10234797 | 3300009430 | Groundwater | VTPNVRDQRRRALGAPLADRRLSAPVLVPASGVPTRDDRCIA* |
| Ga0114938_10270475 | 3300009430 | Groundwater | MLLNVRDQRRRALGAPLADRRLSAPVLVPASGVPTRDDRCIA* |
| Ga0116142_101216273 | 3300009685 | Anaerobic Digestor Sludge | MPSNVRDQRRRALGAPLADRHLSAPGPVPASGVPTRDDRCIA* |
| Ga0116142_105561191 | 3300009685 | Anaerobic Digestor Sludge | VLPNARDQRRRALGAPLADRSLSKLGHVPASGVPTRDDRCIA* |
| Ga0116144_101497764 | 3300009687 | Anaerobic Digestor Sludge | MLPNVRDQRRRAVGAPLADRSLSAPVPVPASGVPTRDDRCIA* |
| Ga0116143_102206862 | 3300009690 | Anaerobic Digestor Sludge | MVSNVRDQRRRAVGAPLADRNLWEPLAVVASGVTTRDDRCIA* |
| Ga0116143_102284702 | 3300009690 | Anaerobic Digestor Sludge | LLLNVRDQRRRALGAPLADRNLSAPEPVPASGVPTRDDRC |
| Ga0116143_103066872 | 3300009690 | Anaerobic Digestor Sludge | MRPNVRDQRRRALGAPLADRNLSAPEPVPASGVPTRDDRCIA* |
| Ga0116143_103476972 | 3300009690 | Anaerobic Digestor Sludge | MVANARDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0105061_10910682 | 3300009807 | Groundwater Sand | GDTGEDGFLRMWPNVRDQRRRAVGAPLAEQNPWEPLAVLASGVTTRDDRCIA* |
| Ga0131092_114972171 | 3300009870 | Activated Sludge | PMTPNVRDQRRRALGAPLADRNLSAPGPVPASGVPTRADRCIA* |
| Ga0131077_100365349 | 3300009873 | Wastewater | VSKLLRKVTSNVRDQRRRALGAPLADRILSAPVSVPASGVPTRDDRCIA* |
| Ga0131077_1003812010 | 3300009873 | Wastewater | MTPNVRDQRRRAVGAPLADRNLSAPGPVPASGVPTRDDRCIA* |
| Ga0131077_1003812013 | 3300009873 | Wastewater | MVANVRDQRRRAVGAPLADRNLSAPGHVPASGVPTRDDRCIA* |
| Ga0131077_1004317211 | 3300009873 | Wastewater | MLLNVRDQRRRALGAPLADRNPSAPAPVPASGVPTRDDRCIA* |
| Ga0131077_100431727 | 3300009873 | Wastewater | MRPNVRDQRRRAVGAPLADRNLSAPGPVAASGVTTRDDRCIA* |
| Ga0131077_100431729 | 3300009873 | Wastewater | MATSNVRDQRRRALGAPLADRHLSAPWPVPASGVPTRDDRCIA* |
| Ga0131077_1004565611 | 3300009873 | Wastewater | MPPNVRDQRRRAVGAPLADRRLSEHPPVPASGVPTRDDRCIA* |
| Ga0131077_100456565 | 3300009873 | Wastewater | MTPNVRDQRRRAVGAPLADRILSAPGLVPASGVPTRDDRCIA* |
| Ga0131077_100456569 | 3300009873 | Wastewater | MTPNVRDQRRRAVGAPLADRNPSAPVSVPASGVPTRDDRCIA* |
| Ga0131077_100496252 | 3300009873 | Wastewater | LVDRCVRMMPNVRDQRRRAVGAPLADRNLSAPQPLPASGVPTRDDRCIA* |
| Ga0131077_1005936211 | 3300009873 | Wastewater | MTPNVRDQRRRALGAPLADRNPSAPVLVPASGVPTRADRCIA* |
| Ga0131077_100593629 | 3300009873 | Wastewater | MLPNVRDQRRRALGAPLADRNLSAPDPVPASGVPTRDDRCIA* |
| Ga0131077_100634011 | 3300009873 | Wastewater | NVRDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_100796391 | 3300009873 | Wastewater | LIHFKLFELMPNVRDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_100796394 | 3300009873 | Wastewater | MRPNVRDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_100796399 | 3300009873 | Wastewater | MMTSNVRDQRRRALGAPLADRVLSAPAPVPASGVPTRNDRCIA* |
| Ga0131077_100912186 | 3300009873 | Wastewater | MASNVRDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_100912188 | 3300009873 | Wastewater | LRSNVRDQRRRALGAPLADRHLSAPVPVPASGVPTRADRCIA* |
| Ga0131077_100965723 | 3300009873 | Wastewater | MLLNVRDQRRRAVGAPLADRNPSSLVRVPASGVPTRDDRCIA* |
| Ga0131077_100965724 | 3300009873 | Wastewater | MRHNASDQRRRALGAPLADRNLSAPEPVPASGVPTRDDRCIA* |
| Ga0131077_100965728 | 3300009873 | Wastewater | SNVRDQRRRALGAPLADRHLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_101005264 | 3300009873 | Wastewater | MLRELSRAQPNVRDQRRRAFGAPLADRNPSMPLPVPASGVPTRDDRCIA* |
| Ga0131077_101005267 | 3300009873 | Wastewater | MLSNVRDQRRRALGAPLADRNPSAPAPVPASGVPTRDDRCIA* |
| Ga0131077_101202857 | 3300009873 | Wastewater | LSDVRDQRRRAVGAPLADRNLSEPKSVAASGVPTRDDRCIA* |
| Ga0131077_101214522 | 3300009873 | Wastewater | MATSNVRDQRRRAVGAPLADRNLSAPAPVPASGVPTRDDRCIA* |
| Ga0131077_101265051 | 3300009873 | Wastewater | MLLNVRDQRRRAVGAPLADRNLSAPRPVLASGVPTRDDRCIA* |
| Ga0131077_101360575 | 3300009873 | Wastewater | MPNVRDQRRRALGAPLADRHLSTPGPVPASGVPTRDDRCIA* |
| Ga0131077_101476284 | 3300009873 | Wastewater | VLPNVRDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_101668076 | 3300009873 | Wastewater | LLLNARDQRRRALGAPLADRNLSAPAPVPASGVPTRDDRCIA* |
| Ga0131077_101712172 | 3300009873 | Wastewater | MLPNVRDQRRRALGAPLADRSLSAPAPVPASGVPTRDDRCIA* |
| Ga0131077_101712175 | 3300009873 | Wastewater | PNVRDQRRRAVGAPLADRNPSAPAPVSASDVPTRDDRCIA* |
| Ga0131077_101816212 | 3300009873 | Wastewater | LESITASNVRDQRRRALGAPLADRNPSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_101896947 | 3300009873 | Wastewater | MNKSARMPMTPNVRDQRRRAVGAPLADRNLWEPLAVVASGVTTRDDRCIA* |
| Ga0131077_102131521 | 3300009873 | Wastewater | LVDAMFLHLRSNVRDQRRRALGAPLADRHLSAPELVPASGVPTRDDRCIA* |
| Ga0131077_102131525 | 3300009873 | Wastewater | MLPNVRDQRRRALGAPLADRHLSVPVPVPASGVPTRDDRCIA* |
| Ga0131077_102211582 | 3300009873 | Wastewater | VDRNVIATSNVRDQRRRALGAPLANRRLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_102781252 | 3300009873 | Wastewater | MPPNVRDQRRRALGAPLADRNLSAPGPVPASGVPTRDDRCIA* |
| Ga0131077_103019273 | 3300009873 | Wastewater | MQSNVRDQRRRAVGAPLADRVLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_103128872 | 3300009873 | Wastewater | MTSNVRDQRRRALGAPLADPNLSAPEPVPASGVPTRDDRCIA* |
| Ga0131077_103931682 | 3300009873 | Wastewater | LLLNVRDQRRRALGAPLADRNLSKLGHVPASGVLTRADRCIA* |
| Ga0131077_104479923 | 3300009873 | Wastewater | MPPNVRDQRRRAVGAPLADPHLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_105126451 | 3300009873 | Wastewater | MMLNVRDQRRRAVGAPLAVPALWTPLAVPASGVPTRDDRCIA* |
| Ga0131077_105470582 | 3300009873 | Wastewater | MWPNVRDQRRRALGAPLADRSLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_105841651 | 3300009873 | Wastewater | MPNVRDQRRRALGAPLADRHLSVPVPVPASGVPTRDDRCIA* |
| Ga0131077_106066941 | 3300009873 | Wastewater | MLFNVRDQRRRALGAPLADRNPSAPELVPASGVPTRDDRCIA* |
| Ga0131077_106066943 | 3300009873 | Wastewater | MRSNVRDQRRRALGAPLADCNLSAPEPVPASGVPTRDDRCIA* |
| Ga0131077_106133511 | 3300009873 | Wastewater | MLFNVRDQRRRALGAPLADCNLSAPGPVPASGVPTRDDRCIA* |
| Ga0131077_106204682 | 3300009873 | Wastewater | MQMPSNVRDQRRRAVGAPLADRSLSKPGHVPASGVPTRDDRCIA* |
| Ga0131077_106747863 | 3300009873 | Wastewater | PNARDQRRRALGAPLADRCLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_106795352 | 3300009873 | Wastewater | MLLNVRDQRRRALGAPLADRCLSAPVLVPASGVPTRDDRCIA* |
| Ga0131077_109019423 | 3300009873 | Wastewater | MTSNVRDQRRRALGAPLADRSLSKPGHVPASGVPTRDDRCIA* |
| Ga0131077_109083621 | 3300009873 | Wastewater | NVRDQRRRALGAPLADRNSSSLTHVPASGVPTRDDRCIA* |
| Ga0131077_110406561 | 3300009873 | Wastewater | VLMENSCVRSVPSNVRDQRRRAVGAPLADRHLSAPGPVPASGVPTRADRCIA* |
| Ga0131077_110628692 | 3300009873 | Wastewater | MSNARDQRRRALGAPLADRNLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_111084011 | 3300009873 | Wastewater | MLPNARDQRRRALGAPLADRCLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_111726693 | 3300009873 | Wastewater | NVRDQRRRALGAPLADRHLSVPVPVPASGVPTRDDRCIA* |
| Ga0131077_112109341 | 3300009873 | Wastewater | SNVRDQRRRAVGAPLAGETLWTPLAVSASGVTTSADRCIA* |
| Ga0131077_112555722 | 3300009873 | Wastewater | MLPNVRDQRRRALGAPLADRSLSAPGPVPASGVPTRDDRCIA* |
| Ga0131077_112656483 | 3300009873 | Wastewater | MVTPNVRDQRRRALGAPLADRNPSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_112858202 | 3300009873 | Wastewater | MSNVRDQRRRAVGAPLADRNLSTPGPVPASGVQTRDDRCIA |
| Ga0131077_113209752 | 3300009873 | Wastewater | MLLNARDQRRRALGAPLADRCLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_113598302 | 3300009873 | Wastewater | MLLNVRDQRRRALGAPLADRSLSTPAPVPASGVPTRDDRCIA* |
| Ga0131077_113871943 | 3300009873 | Wastewater | SPPNVRDQRRRAVGAPLADRSLSKLRYVPASGVSTRDDRCIA* |
| Ga0131077_114769301 | 3300009873 | Wastewater | MWSNVRDQRRRALGAPLADRHLSAPVPVPASGVPTRDDRCIA* |
| Ga0131077_114777802 | 3300009873 | Wastewater | MPNVRDQRRRAVGAPLADRNLSKLGHVPASGVPTRDDRCIA* |
| Ga0131077_116829881 | 3300009873 | Wastewater | MLLNVRDQRRRALGAPLADRILSAPAPVPASGVPTRDDRCIA* |
| Ga0116237_101264331 | 3300010356 | Anaerobic Digestor Sludge | RDQRRRALGAPLADRNPSAPGPVPASGVPTRDDRCIA* |
| Ga0116237_107282213 | 3300010356 | Anaerobic Digestor Sludge | VKDVRKRVPPNVRDQRRRAVGAPLADRNLWEPLAVVASGVTTRDDRCIA* |
| Ga0116237_108905651 | 3300010356 | Anaerobic Digestor Sludge | MPNVRDQRRRALGAPLADRSFPEPLAVPASGVPTRDDRCIA* |
| Ga0116237_115502292 | 3300010356 | Anaerobic Digestor Sludge | WGGAALQWPNARDQRRRALGAPLANRNLSASGHVAASGVPTRDDRCIA* |
| Ga0136847_102569493 | 3300010391 | Freshwater Sediment | VICLLWSNVRDQRRRAVGAPLADENPWEPLAVPASGVTTSADRCIA* |
| Ga0136847_129082921 | 3300010391 | Freshwater Sediment | DQRRRALGAPLADRNLSAPGPVPASGVPARDDRCIA* |
| Ga0137315_10007925 | 3300011395 | Soil | RRRAVGAALAESALWIPVASPASGVTTSDDRRIA* |
| Ga0137356_10043143 | 3300011402 | Soil | MLPSNVRDQRRRAVGAPLAALNSWEHLAVPASGVTTRADRCIA* |
| Ga0137440_10693651 | 3300011410 | Soil | TREKPNVHDQRRRAVGAPRAGPAIGMPLVVSACGETTGADRCIA* |
| Ga0137325_10456043 | 3300011415 | Soil | PNVRDQRRRAVGAPLADRNFWVSLAGAASGVTTSGDRCIA* |
| Ga0137422_10505903 | 3300011416 | Soil | MTLAQPNLVLSNVRDQRRRAVGAPLAEPSLWKPLAHLASGVKTSADRCI |
| Ga0137326_10974301 | 3300011417 | Soil | FAAMPSLLPNVRDQRRRAVGAPLAEHNLWEPHAIPASGVMTSAERCIA* |
| Ga0137443_11401242 | 3300011433 | Soil | PWGSVLPNARDQRRRAVGAPLAFAASGVTTSAERCIA* |
| Ga0137332_10071262 | 3300012122 | Soil | MRSNVRDQRRRAVGAPLAWIAVGLPLAVTASGVTTRDDRRIA* |
| Ga0181613_11840131 | 3300014149 | Anoxic, Neutral-Ph, Fe/Si-Rich Hot Spring Water | PNVRDQRRRAVGAPLASSNLWEPLAVPASGVTTSDDRCIA* |
| Ga0075309_11883132 | 3300014268 | Natural And Restored Wetlands | MTPNVRDQRRRAVGAPLADRSLSALAPVPASGVPTRDDRCIA* |
| Ga0075327_12025932 | 3300014272 | Natural And Restored Wetlands | MFNVRDQRRRAVGAPLADLRWWETLAVLASGVTTRADRCIA* |
| Ga0157380_130065392 | 3300014326 | Switchgrass Rhizosphere | MTPNVRDQRRRAVGAPLADSNIWEPLKLGASGVSTSADRCIA* |
| Ga0180060_10171551 | 3300014863 | Soil | EVPSASFSMRANARDQRRRAVGTPLAQVEVGTPLALIASGVTTSAERCIA* |
| Ga0180063_12152482 | 3300014885 | Soil | VHGSLTLPNVRDQRRRTVGAPLAGRNLSTPVPAAASGVTTRDDRCIA* |
| Ga0180071_10360241 | 3300015249 | Soil | LPNARDQRRRAVGTPLADRNLWDPLARTASGVTTSAERCIAL |
| Ga0180093_11410062 | 3300015258 | Soil | NVRDKRRRAVGAALAESALWIPVASPASGVTTSDDRRIA* |
| Ga0180093_11428292 | 3300015258 | Soil | EQKRLHGKQLRPSFRNQWRRAVGASLAERNLSELLAVPASGVTTSGERCIA* |
| Ga0132256_1024261733 | 3300015372 | Arabidopsis Rhizosphere | MVTPNVRDQRRRAVGAPLADRNPSAPAPFRASGVTTSADRCIAQLGR* |
| Ga0184639_104073082 | 3300018082 | Groundwater Sediment | RDQRRRAVGAPLAQVEVEMPLAVSASGVTTSAERCIA |
| Ga0184629_106536592 | 3300018084 | Groundwater Sediment | MYVLTSNARDQRRRAVGAQLAPVASGVTTSAERCIA |
| Ga0190268_107561572 | 3300018466 | Soil | MMPNVRDQRRRAVGAPLADRILCGPLAIPASGVPTSAERCIA |
| Ga0187892_1000803326 | 3300019458 | Bio-Ooze | VSLSLNVRDQRQRALGAPLADRNLSAPVLVRANGVPTRDDRCIA |
| Ga0187892_100839714 | 3300019458 | Bio-Ooze | MRPNVRDQRRRAVGAPLADRDLSELEHVPASGVPTRADRCIA |
| Ga0187892_101245804 | 3300019458 | Bio-Ooze | MPNVRDQRRRAVGAPLADRNLSSPALVRASGVPTRD |
| Ga0187892_101438102 | 3300019458 | Bio-Ooze | MSNVRDQRRRAVGAPLADRHLSSAEPVTASGVPTSDDRCIA |
| Ga0187892_104111272 | 3300019458 | Bio-Ooze | PSIPRYKMMSNVRDQRRRALGAPLADRNLSSAEPVTASGVPTSADRCIA |
| Ga0187893_100765646 | 3300019487 | Microbial Mat On Rocks | MVTSNVRDQRRRAVGAPLADRNDSDLLALCASGVTTRDDRCIA |
| Ga0187893_102228801 | 3300019487 | Microbial Mat On Rocks | MPNVRDQRRRAVGAPLADRNDSDLLALCASGVTTRDDRCIA |
| Ga0187893_102435084 | 3300019487 | Microbial Mat On Rocks | MMWSNVRDQRRRALGAPLADRSLSSPEPVPASGVPTRDDRCIA |
| Ga0187893_102491814 | 3300019487 | Microbial Mat On Rocks | MPSNVRDQRRRALGAPLADRNLSAPEPVLASGVPTRDDRCI |
| Ga0187893_102664913 | 3300019487 | Microbial Mat On Rocks | NVRDQRRRAVGAPLADRHLSSAEPVTASGVPTSDDRCIA |
| Ga0187893_103555091 | 3300019487 | Microbial Mat On Rocks | MSNVRDQRRRALGATLAELGQWMALAVSASGVTTRDDRCIA |
| Ga0187893_103827222 | 3300019487 | Microbial Mat On Rocks | MRRIFFVTPNVRDQRRRALGAPLADRHLSKPRHVPASGVPTSADRCIA |
| Ga0187893_104607862 | 3300019487 | Microbial Mat On Rocks | MPSNVRDQRRRAVGAPLADRSLSKLGHVPASGAPMRDDRCIA |
| Ga0187893_105095822 | 3300019487 | Microbial Mat On Rocks | SHPLKLQMETPNVRDQRRRALGAPLADCNLSEPGPVPASGVPTRADRCIA |
| Ga0187893_105114531 | 3300019487 | Microbial Mat On Rocks | NVRDQRRRAVGAPLADRNLSPPVPVPASGVPTSDDRCIA |
| Ga0187893_105360141 | 3300019487 | Microbial Mat On Rocks | NVRDQRRRAVGAPLADRSVSSPAYVPASGVTTRDDRCIA |
| Ga0187893_105749873 | 3300019487 | Microbial Mat On Rocks | SNVRDQRRRAVGAPLADRSLSKLGHVPASGAPMRDDRCIA |
| Ga0187893_105823773 | 3300019487 | Microbial Mat On Rocks | GRRHDISRLMPNVRDQRRRALGAPLADRNLSELGHVIASGVPKRADRCIA |
| Ga0187893_105834132 | 3300019487 | Microbial Mat On Rocks | NVTGYKTPNVRDQRRRALGAPLADRNPSSPTPVPASGVPTRADRCIA |
| Ga0187893_105879631 | 3300019487 | Microbial Mat On Rocks | NVRDQRRRALGAPLADRSLSSAKPVSASGVPTRADRCIA |
| Ga0187893_105930371 | 3300019487 | Microbial Mat On Rocks | MPNVRDQRRRAVGAPLADRSVSSPAYVPASGVTTRDD |
| Ga0187893_106483302 | 3300019487 | Microbial Mat On Rocks | VSHWASVTPNVRDQRRRAVGAPLADRNLSEPSPVPASGVPTSADRCIA |
| Ga0187893_107360452 | 3300019487 | Microbial Mat On Rocks | NVRDQRRRAVGAPLADRHLCAPAPVPASGVPMRDDRCIA |
| Ga0187893_107940112 | 3300019487 | Microbial Mat On Rocks | MPNVRDQRRRAVGAPLADRNPSALELVPASGVPTRDDRCIA |
| Ga0187893_108074711 | 3300019487 | Microbial Mat On Rocks | NARDQRRRAVGAPLADCNPSAPDPVPASGVPTSADRCIA |
| Ga0187893_108197681 | 3300019487 | Microbial Mat On Rocks | SDFRDDMRSNVRDQRRRAVGAPLADCSLSSLPPVPASGVPTRDDRCIA |
| Ga0210339_16448853 | 3300021332 | Estuarine | VRDQRRRAVGAPLADRDLWKPAALFASGVTTSAERCIA |
| Ga0224500_102676502 | 3300022213 | Sediment | MIANRSWRMTRPPLVPANVRDQRRRAVGAPLADHNLWESLAIPASGVPTRDDRCIA |
| Ga0224510_102791121 | 3300022309 | Sediment | LLALPHQVLSNVRDQRRRAVGAPLADRNLSAPVPVPASGVPTRDDRCIA |
| Ga0209398_10114625 | 3300025106 | Groundwater | MLLNVRDQRRRALGAPLADRRLSAPVLVPASGVPTRDDRCIA |
| Ga0209398_10114627 | 3300025106 | Groundwater | MSNVRDQRRRAVGAPLAGWTLWEPLAALASGVTTRDDRCIA |
| Ga0209519_101784631 | 3300025318 | Soil | VERAAHSAAGAPLARIAIGRSLAVRASGVTTSAERCIA |
| Ga0210142_10721822 | 3300025552 | Natural And Restored Wetlands | MTPNVRDQRRRALGAPLDEPTMWTPLAVPASGVTTRDDRCIA |
| Ga0209200_12315353 | 3300025784 | Anaerobic Digestor Sludge | LLLNVRDQRRRALGAPLADRNLSAPEPVPASGVPTRDDRCIA |
| Ga0209096_13202192 | 3300025859 | Anaerobic Digestor Sludge | PLRLHHGPNVRDQRRRALGAPLADRNLSAPEPVPASGVPTRDDRCIA |
| Ga0210102_10538252 | 3300025971 | Natural And Restored Wetlands | VTFNAASLVTPNARDQRRRAVGAPLAGRNHCVPLAFPASGVPTRDDRCIA |
| Ga0208540_10284362 | 3300026059 | Natural And Restored Wetlands | NVRDQRRRALGAPLAEPSLWIPLAVPASGVTTSAERCIA |
| Ga0256867_101932172 | 3300026535 | Soil | MESNVRDQRRRAVGAPLARGSLWDPLAVPESGVTTSDDRCIA |
| Ga0209387_11589392 | 3300027639 | Agricultural Soil | MRSNVRDQRRRAVGAPLASRTSWKPLALVASGVTTSDDRC |
| Ga0256864_11514281 | 3300027964 | Soil | VPSNVRDQRRRAIGAPLADRDLWMPLAVPASGVTTSAERCIA |
| Ga0268299_10000012458 | 3300028648 | Activated Sludge | MTPNVRDQRRRALGAPLADRNLSASEHVHASGVPTRDDRCIA |
| Ga0299906_103765091 | 3300030606 | Soil | PVMPNVRDQRRRAVGAPLAWESLWEPLAVPASGVTTSDDRCIA |
| Ga0268386_103838703 | 3300030619 | Soil | NVRDQRRRAVGAPLAGESLWVPLAVPASGVTTSDDRCIA |
| Ga0268386_110357022 | 3300030619 | Soil | RTLRPFLLMPNVRDQRRRAVGAPLAGEYLSERLAVPASGVTTSDNRCIA |
| Ga0307505_105035991 | 3300031455 | Soil | RDQRRRAVGAPLADRNLWVLLAVPASGVTTSDDRCIA |
| Ga0315284_114393291 | 3300032053 | Sediment | FLIMPPNARDQRRRAVGAPLARIAVEMPLAVSASGVTTRADRCIA |
| Ga0315283_104032565 | 3300032164 | Sediment | QRRRAVGAPLALFAIDMPFAVPASGVTTSAERCIA |
| Ga0315283_108630681 | 3300032164 | Sediment | VRDQRRRVVGAPLAGESLKEPLAVPASGVTTSDDRCIA |
| Ga0315283_111204134 | 3300032164 | Sediment | VRDQRRRAVGAPLALFAIDMPFAVPASGVTTSAERCIA |
| Ga0315270_107633301 | 3300032275 | Sediment | QRRRAGGAPLAKRNLWIPLAVPASGVTTRADRCIA |
| Ga0315273_100270901 | 3300032516 | Sediment | NARDQRRRAVGAPLARIAVEMPLAVSASGVTTRADRCIA |
| Ga0315273_120221001 | 3300032516 | Sediment | DQRRRAGGAPLALVASGVTTSAERCIALLGMWPVT |
| Ga0334722_103863131 | 3300033233 | Sediment | TISGVKPNARDQRRRAVGAPLALVASGVTTSAERCIA |
| Ga0214472_100139211 | 3300033407 | Soil | HRPQANSPPNVRDQRWRRVGAPLARIAVESLLAVSASGVPTSAERCIA |
| Ga0214472_100540331 | 3300033407 | Soil | MLSNVRDQRRRAVGAPLAEQSLGEPLAVPASGVTTSAERCIA |
| Ga0214472_103266071 | 3300033407 | Soil | MMFNVRDQRRRAVGAPLADRNLSSQAPVPASGVPTRDDRCIA |
| Ga0214472_117108741 | 3300033407 | Soil | VLSFMRPNVRDQRRRAVGAPLADRNPSEPRAVPASGVTTSDDRCIA |
| ⦗Top⦘ |