


| Basic Information | |
|---|---|
| Family ID | F031276 |
| Family Type | Metagenome |
| Number of Sequences | 183 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDS |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.98 % |
| % of genes near scaffold ends (potentially truncated) | 95.08 % |
| % of genes from short scaffolds (< 2000 bps) | 85.25 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.224 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (9.290 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.530 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF05988 | DUF899 | 1.09 |
| PF01370 | Epimerase | 1.09 |
| PF04966 | OprB | 1.09 |
| PF04655 | APH_6_hur | 1.09 |
| PF07690 | MFS_1 | 1.09 |
| PF00793 | DAHP_synth_1 | 1.09 |
| PF00266 | Aminotran_5 | 1.09 |
| PF07366 | SnoaL | 1.09 |
| PF00196 | GerE | 0.55 |
| PF08028 | Acyl-CoA_dh_2 | 0.55 |
| PF03551 | PadR | 0.55 |
| PF01055 | Glyco_hydro_31 | 0.55 |
| PF01569 | PAP2 | 0.55 |
| PF01019 | G_glu_transpept | 0.55 |
| PF05163 | DinB | 0.55 |
| PF01026 | TatD_DNase | 0.55 |
| PF00144 | Beta-lactamase | 0.55 |
| PF02321 | OEP | 0.55 |
| PF00999 | Na_H_Exchanger | 0.55 |
| PF01872 | RibD_C | 0.55 |
| PF02518 | HATPase_c | 0.55 |
| PF12072 | RNase_Y_N | 0.55 |
| PF13193 | AMP-binding_C | 0.55 |
| PF13453 | zf-TFIIB | 0.55 |
| PF01906 | YbjQ_1 | 0.55 |
| PF00561 | Abhydrolase_1 | 0.55 |
| PF01145 | Band_7 | 0.55 |
| PF08281 | Sigma70_r4_2 | 0.55 |
| PF03576 | Peptidase_S58 | 0.55 |
| PF06983 | 3-dmu-9_3-mt | 0.55 |
| PF02652 | Lactate_perm | 0.55 |
| PF01927 | Mut7-C | 0.55 |
| PF05015 | HigB-like_toxin | 0.55 |
| PF02780 | Transketolase_C | 0.55 |
| PF03446 | NAD_binding_2 | 0.55 |
| PF01061 | ABC2_membrane | 0.55 |
| PF13905 | Thioredoxin_8 | 0.55 |
| PF02452 | PemK_toxin | 0.55 |
| PF13533 | Biotin_lipoyl_2 | 0.55 |
| PF14534 | DUF4440 | 0.55 |
| PF13683 | rve_3 | 0.55 |
| PF02082 | Rrf2 | 0.55 |
| PF13531 | SBP_bac_11 | 0.55 |
| PF10442 | FIST_C | 0.55 |
| PF12697 | Abhydrolase_6 | 0.55 |
| PF12867 | DinB_2 | 0.55 |
| PF02774 | Semialdhyde_dhC | 0.55 |
| PF00583 | Acetyltransf_1 | 0.55 |
| PF13489 | Methyltransf_23 | 0.55 |
| PF12695 | Abhydrolase_5 | 0.55 |
| PF07228 | SpoIIE | 0.55 |
| PF00903 | Glyoxalase | 0.55 |
| PF14066 | DUF4256 | 0.55 |
| PF03167 | UDG | 0.55 |
| PF13620 | CarboxypepD_reg | 0.55 |
| PF04972 | BON | 0.55 |
| PF09335 | SNARE_assoc | 0.55 |
| PF01381 | HTH_3 | 0.55 |
| PF00303 | Thymidylat_synt | 0.55 |
| PF02687 | FtsX | 0.55 |
| PF07732 | Cu-oxidase_3 | 0.55 |
| PF13506 | Glyco_transf_21 | 0.55 |
| PF13495 | Phage_int_SAM_4 | 0.55 |
| PF01297 | ZnuA | 0.55 |
| PF00106 | adh_short | 0.55 |
| PF00581 | Rhodanese | 0.55 |
| PF05016 | ParE_toxin | 0.55 |
| PF13376 | OmdA | 0.55 |
| PF04075 | F420H2_quin_red | 0.55 |
| PF03060 | NMO | 0.55 |
| PF13180 | PDZ_2 | 0.55 |
| PF13189 | Cytidylate_kin2 | 0.55 |
| PF00589 | Phage_integrase | 0.55 |
| PF13560 | HTH_31 | 0.55 |
| PF10282 | Lactonase | 0.55 |
| PF00069 | Pkinase | 0.55 |
| PF06197 | DUF998 | 0.55 |
| PF13618 | Gluconate_2-dh3 | 0.55 |
| PF02913 | FAD-oxidase_C | 0.55 |
| PF03466 | LysR_substrate | 0.55 |
| PF13419 | HAD_2 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.19 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.09 |
| COG3570 | Streptomycin 6-kinase | Defense mechanisms [V] | 1.09 |
| COG3659 | Carbohydrate-selective porin OprB | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.09 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 0.55 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 0.55 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.55 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.55 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.55 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.55 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.55 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.55 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.55 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.55 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.55 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.55 |
| COG1501 | Alpha-glucosidase/xylosidase, GH31 family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG1620 | L-lactate permease | Energy production and conversion [C] | 0.55 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.55 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.55 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.55 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.55 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.55 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.55 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.55 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.55 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.55 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.55 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.55 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.55 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.55 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.55 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.55 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.55 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.55 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.55 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.55 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.55 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.55 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.22 % |
| Unclassified | root | N/A | 26.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111022|2221214517 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300000559|F14TC_100513649 | Not Available | 694 | Open in IMG/M |
| 3300001305|C688J14111_10243953 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300001686|C688J18823_10813877 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300002908|JGI25382J43887_10025349 | All Organisms → cellular organisms → Bacteria | 3185 | Open in IMG/M |
| 3300004052|Ga0055490_10048047 | Not Available | 1107 | Open in IMG/M |
| 3300004463|Ga0063356_105844055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 528 | Open in IMG/M |
| 3300005178|Ga0066688_10419182 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005329|Ga0070683_100018293 | All Organisms → cellular organisms → Bacteria | 6203 | Open in IMG/M |
| 3300005332|Ga0066388_100366446 | All Organisms → cellular organisms → Bacteria | 2087 | Open in IMG/M |
| 3300005353|Ga0070669_100243515 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300005353|Ga0070669_100708347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 850 | Open in IMG/M |
| 3300005437|Ga0070710_10670893 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005454|Ga0066687_10333853 | Not Available | 866 | Open in IMG/M |
| 3300005467|Ga0070706_101001782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 770 | Open in IMG/M |
| 3300005468|Ga0070707_100296361 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300005553|Ga0066695_10491554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. CF079 | 755 | Open in IMG/M |
| 3300005555|Ga0066692_10065493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → unclassified Alteromonadaceae → Alteromonadaceae bacterium Bs31 | 2067 | Open in IMG/M |
| 3300005555|Ga0066692_10930112 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005556|Ga0066707_10727347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 619 | Open in IMG/M |
| 3300005569|Ga0066705_10626796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300005713|Ga0066905_101206140 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005719|Ga0068861_102149619 | Not Available | 559 | Open in IMG/M |
| 3300005764|Ga0066903_101582247 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300005840|Ga0068870_10176514 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300005844|Ga0068862_100123356 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2285 | Open in IMG/M |
| 3300006028|Ga0070717_11086422 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006028|Ga0070717_11351123 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006034|Ga0066656_10243813 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300006163|Ga0070715_10608036 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006844|Ga0075428_100000838 | All Organisms → cellular organisms → Bacteria | 32194 | Open in IMG/M |
| 3300006846|Ga0075430_100411321 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300006847|Ga0075431_101069650 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300006881|Ga0068865_100207136 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300006893|Ga0073928_10130542 | Not Available | 2056 | Open in IMG/M |
| 3300006893|Ga0073928_11027425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 560 | Open in IMG/M |
| 3300006894|Ga0079215_10419676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 799 | Open in IMG/M |
| 3300006903|Ga0075426_10083097 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300006904|Ga0075424_101847741 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300006918|Ga0079216_10333319 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300009012|Ga0066710_100707869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1536 | Open in IMG/M |
| 3300009091|Ga0102851_12629566 | Not Available | 577 | Open in IMG/M |
| 3300009792|Ga0126374_10932011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo6 | 676 | Open in IMG/M |
| 3300010037|Ga0126304_10118496 | Not Available | 1689 | Open in IMG/M |
| 3300010044|Ga0126310_10822969 | Not Available | 716 | Open in IMG/M |
| 3300010044|Ga0126310_11726968 | Not Available | 520 | Open in IMG/M |
| 3300010048|Ga0126373_10143233 | All Organisms → cellular organisms → Bacteria | 2263 | Open in IMG/M |
| 3300011411|Ga0153933_1037487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 1093 | Open in IMG/M |
| 3300012357|Ga0137384_11111125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
| 3300012917|Ga0137395_10514667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 862 | Open in IMG/M |
| 3300012930|Ga0137407_10020015 | All Organisms → cellular organisms → Bacteria | 5002 | Open in IMG/M |
| 3300012944|Ga0137410_11950345 | Not Available | 521 | Open in IMG/M |
| 3300012971|Ga0126369_11157954 | Not Available | 863 | Open in IMG/M |
| 3300015242|Ga0137412_10271387 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300015371|Ga0132258_10121866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6198 | Open in IMG/M |
| 3300015374|Ga0132255_102270673 | Not Available | 828 | Open in IMG/M |
| 3300016270|Ga0182036_10462117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 1000 | Open in IMG/M |
| 3300016319|Ga0182033_11779468 | Not Available | 559 | Open in IMG/M |
| 3300016371|Ga0182034_10312821 | Not Available | 1263 | Open in IMG/M |
| 3300016422|Ga0182039_10700252 | Not Available | 893 | Open in IMG/M |
| 3300016422|Ga0182039_10981623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → Phenylobacterium haematophilum | 757 | Open in IMG/M |
| 3300017933|Ga0187801_10422923 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. BvORR106 | 556 | Open in IMG/M |
| 3300017935|Ga0187848_10442615 | Not Available | 533 | Open in IMG/M |
| 3300017936|Ga0187821_10009537 | All Organisms → cellular organisms → Bacteria | 3306 | Open in IMG/M |
| 3300017942|Ga0187808_10013883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 3189 | Open in IMG/M |
| 3300017946|Ga0187879_10225570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 1047 | Open in IMG/M |
| 3300017972|Ga0187781_11372066 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017975|Ga0187782_10567480 | Not Available | 871 | Open in IMG/M |
| 3300018006|Ga0187804_10246772 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300018006|Ga0187804_10249562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 766 | Open in IMG/M |
| 3300018016|Ga0187880_1306589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300018028|Ga0184608_10008101 | All Organisms → cellular organisms → Bacteria | 3494 | Open in IMG/M |
| 3300018033|Ga0187867_10213493 | Not Available | 1094 | Open in IMG/M |
| 3300018038|Ga0187855_10298042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 944 | Open in IMG/M |
| 3300018043|Ga0187887_10209488 | Not Available | 1158 | Open in IMG/M |
| 3300018072|Ga0184635_10117135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1058 | Open in IMG/M |
| 3300018088|Ga0187771_11519313 | Not Available | 568 | Open in IMG/M |
| 3300018090|Ga0187770_11561267 | Not Available | 538 | Open in IMG/M |
| 3300018422|Ga0190265_10118362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | 2525 | Open in IMG/M |
| 3300018431|Ga0066655_11100187 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300018433|Ga0066667_10756888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 821 | Open in IMG/M |
| 3300020003|Ga0193739_1129889 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300020170|Ga0179594_10154675 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300020220|Ga0194119_10927079 | Not Available | 505 | Open in IMG/M |
| 3300021088|Ga0210404_10521839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 672 | Open in IMG/M |
| 3300021377|Ga0213874_10385089 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021420|Ga0210394_10366124 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300021420|Ga0210394_11420442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300021432|Ga0210384_10689332 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300021444|Ga0213878_10359866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 630 | Open in IMG/M |
| 3300021474|Ga0210390_11603926 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021559|Ga0210409_10468109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo6 | 1122 | Open in IMG/M |
| 3300021559|Ga0210409_10942425 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300022557|Ga0212123_10335505 | Not Available | 1040 | Open in IMG/M |
| 3300023247|Ga0224529_1068384 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300024290|Ga0247667_1039027 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300024330|Ga0137417_1004896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300025324|Ga0209640_10610104 | Not Available | 879 | Open in IMG/M |
| 3300025509|Ga0208848_1012125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1815 | Open in IMG/M |
| 3300025509|Ga0208848_1038323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1037 | Open in IMG/M |
| 3300025664|Ga0208849_1017646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2412 | Open in IMG/M |
| 3300025910|Ga0207684_10740709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300025910|Ga0207684_11124819 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 653 | Open in IMG/M |
| 3300025933|Ga0207706_11407635 | Not Available | 572 | Open in IMG/M |
| 3300025939|Ga0207665_10278464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1244 | Open in IMG/M |
| 3300026297|Ga0209237_1117541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
| 3300026330|Ga0209473_1216708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
| 3300026529|Ga0209806_1025502 | All Organisms → cellular organisms → Bacteria | 2990 | Open in IMG/M |
| 3300026557|Ga0179587_10054557 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300026557|Ga0179587_10325983 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300027587|Ga0209220_1078204 | Not Available | 875 | Open in IMG/M |
| 3300027645|Ga0209117_1023681 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300027655|Ga0209388_1003145 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4066 | Open in IMG/M |
| 3300027667|Ga0209009_1027388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300027671|Ga0209588_1010369 | All Organisms → cellular organisms → Bacteria | 2801 | Open in IMG/M |
| 3300027674|Ga0209118_1043401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1345 | Open in IMG/M |
| 3300027738|Ga0208989_10144279 | Not Available | 801 | Open in IMG/M |
| 3300027783|Ga0209448_10109910 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027812|Ga0209656_10371664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300027880|Ga0209481_10227078 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300027882|Ga0209590_10577480 | Not Available | 724 | Open in IMG/M |
| 3300027882|Ga0209590_10711646 | Not Available | 642 | Open in IMG/M |
| 3300027903|Ga0209488_10868851 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300027903|Ga0209488_10883334 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300027905|Ga0209415_10909828 | Not Available | 597 | Open in IMG/M |
| 3300027909|Ga0209382_11832306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300027911|Ga0209698_11077543 | Not Available | 596 | Open in IMG/M |
| 3300028381|Ga0268264_12270055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300028711|Ga0307293_10127036 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300028807|Ga0307305_10102166 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300028878|Ga0307278_10546007 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300028884|Ga0307308_10095733 | Not Available | 1412 | Open in IMG/M |
| 3300028906|Ga0308309_10786784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola | 827 | Open in IMG/M |
| 3300028906|Ga0308309_11636358 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300028909|Ga0302200_10303423 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300029817|Ga0247275_1006481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 5245 | Open in IMG/M |
| 3300029943|Ga0311340_10278156 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300029944|Ga0311352_10287708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 1373 | Open in IMG/M |
| 3300029952|Ga0311346_10945496 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300029999|Ga0311339_10014952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 11885 | Open in IMG/M |
| 3300030011|Ga0302270_10245968 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300030045|Ga0302282_1226864 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300030496|Ga0268240_10162056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 556 | Open in IMG/M |
| 3300030520|Ga0311372_13077276 | Not Available | 501 | Open in IMG/M |
| 3300030580|Ga0311355_10050538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4893 | Open in IMG/M |
| 3300030743|Ga0265461_13318616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031228|Ga0299914_10337250 | Not Available | 1323 | Open in IMG/M |
| 3300031229|Ga0299913_11027588 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300031231|Ga0170824_115135514 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300031232|Ga0302323_103449464 | Not Available | 503 | Open in IMG/M |
| 3300031234|Ga0302325_10071753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 6694 | Open in IMG/M |
| 3300031234|Ga0302325_11020865 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1127 | Open in IMG/M |
| 3300031525|Ga0302326_11752226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca → Stigmatella aurantiaca DW4/3-1 | 816 | Open in IMG/M |
| 3300031708|Ga0310686_107220305 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300031708|Ga0310686_118217089 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300031715|Ga0307476_10701917 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031716|Ga0310813_11220308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_58_4 | 693 | Open in IMG/M |
| 3300031720|Ga0307469_10942345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300031720|Ga0307469_11592902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. Hiyo6 | 627 | Open in IMG/M |
| 3300031747|Ga0318502_10697805 | Not Available | 613 | Open in IMG/M |
| 3300031753|Ga0307477_10336416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300031754|Ga0307475_11163925 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300031819|Ga0318568_10531003 | Not Available | 734 | Open in IMG/M |
| 3300031820|Ga0307473_11417697 | Not Available | 524 | Open in IMG/M |
| 3300031852|Ga0307410_11788734 | Not Available | 546 | Open in IMG/M |
| 3300031897|Ga0318520_10760108 | Not Available | 607 | Open in IMG/M |
| 3300031901|Ga0307406_10458749 | Not Available | 1024 | Open in IMG/M |
| 3300031903|Ga0307407_10138780 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300031954|Ga0306926_10262869 | All Organisms → cellular organisms → Bacteria | 2138 | Open in IMG/M |
| 3300032035|Ga0310911_10216171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1093 | Open in IMG/M |
| 3300032063|Ga0318504_10540711 | Not Available | 559 | Open in IMG/M |
| 3300032126|Ga0307415_102322335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300033004|Ga0335084_11211302 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. | 754 | Open in IMG/M |
| 3300033289|Ga0310914_10240799 | All Organisms → cellular organisms → Bacteria | 1624 | Open in IMG/M |
| 3300033289|Ga0310914_11470669 | Not Available | 584 | Open in IMG/M |
| 3300033290|Ga0318519_10476672 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300033419|Ga0316601_101087207 | Not Available | 800 | Open in IMG/M |
| 3300033486|Ga0316624_10357928 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300033513|Ga0316628_100693733 | Not Available | 1335 | Open in IMG/M |
| 3300033557|Ga0316617_102392659 | Not Available | 547 | Open in IMG/M |
| 3300034143|Ga0334961_093439 | Not Available | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.29% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.46% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.83% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.28% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.73% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.73% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.19% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.19% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.64% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.64% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.64% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.09% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.09% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.55% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.55% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.55% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.55% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.55% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011411 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ017 MetaG | Host-Associated | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300028909 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300034143 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 57SNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222057014 | 2209111022 | Grass Soil | MSDKIGGGPTRANKPNGYVLGSYRIATAPEPNSSRLTSFKSIGFDSPGT |
| F14TC_1005136492 | 3300000559 | Soil | MRPTRAHKPDGYPLGSYLIATALEPSSSRLTSLKSRCFESPANNVGPW |
| C688J14111_102439531 | 3300001305 | Soil | MMRPTRANKPNNYLLGSYRMATAPEPNSSRLTSLKSTRFDS |
| C688J18823_108138771 | 3300001686 | Soil | MMRPTRANKPNNYLLGSYRMATAPEPNSSRLTSLKSTRFD |
| JGI25382J43887_100253491 | 3300002908 | Grasslands Soil | MRPTRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPAN |
| Ga0055490_100480473 | 3300004052 | Natural And Restored Wetlands | MMRLTWANKSDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA |
| Ga0063356_1058440552 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRPTRSNKPHGYLLGSYRIATAPEPNSRRPTSLKSTCFDSPAN |
| Ga0066688_104191822 | 3300005178 | Soil | MMRPTRANKPDGYLLGSYRIATDPEPNSSRLTSLKSTRFDSPANNVGPWP |
| Ga0070683_1000182933 | 3300005329 | Corn Rhizosphere | MMPPTRANKLKGYFLGSYRIAAASEPNSSLLTSLSRICFGSRANDVGPWPVTEPRQPTPS |
| Ga0066388_1003664465 | 3300005332 | Tropical Forest Soil | MTRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFD |
| Ga0070669_1002435154 | 3300005353 | Switchgrass Rhizosphere | MMRPTRANKPDGYLIGSYRIATAPEPNSSRLTSFKSTRFDNPANN |
| Ga0070669_1007083471 | 3300005353 | Switchgrass Rhizosphere | MVATAPDGYLLGSYRIATAPEPSSSRLTSFRSTCFDSPANNVG |
| Ga0070710_106708932 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTRANKPDGYLLGSYRIATAPESNSSRLTSFKSTRFD |
| Ga0066687_103338532 | 3300005454 | Soil | MMRPTQAYKPNGYLLGSYRIAIAPEPNSSRLTSLKSIRFDSPANN |
| Ga0070706_1010017822 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDS |
| Ga0070707_1002963612 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRATRASKPDRYLRGSYRIATAPEPNSSRLTSFKSTRFDSPANNVG |
| Ga0066695_104915542 | 3300005553 | Soil | MTELPVMRQTLAAIYLLGSYRIATAPEPNSSRLTSFK |
| Ga0066692_100654931 | 3300005555 | Soil | MMQPTRSNNADGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANNV |
| Ga0066692_109301121 | 3300005555 | Soil | MRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKSI |
| Ga0066707_107273471 | 3300005556 | Soil | MMRLARASKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA |
| Ga0066705_106267961 | 3300005569 | Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFD |
| Ga0066905_1012061401 | 3300005713 | Tropical Forest Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFK |
| Ga0068861_1021496192 | 3300005719 | Switchgrass Rhizosphere | MRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKST |
| Ga0066903_1015822471 | 3300005764 | Tropical Forest Soil | MPPARRNKTNSYLLSSYRIATAPEPNSSWLTSFKSTGFDSPA |
| Ga0068870_101765141 | 3300005840 | Miscanthus Rhizosphere | MAQVREGYLLGSYRIAITPEPNSRRLTSLNSTLFDNPASNVGPWPASLG* |
| Ga0068862_1001233561 | 3300005844 | Switchgrass Rhizosphere | MVATAPDGYLLGSYRIATAPEPSSSRLTSFRSTCFDSPANN |
| Ga0070717_110864222 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKTLASKPNGYLLGSYRIATAPEPNSSRLTSLKSTGFD |
| Ga0070717_113511231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MMLPTGANKPDGYLRGSYRIATAPEPNPSRLTSLKSTRFDSPA |
| Ga0066656_102438132 | 3300006034 | Soil | MRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKST |
| Ga0070715_106080362 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTRANKPDGYLLASYRIATAPELNSSRLTSFKSTRFDSPANNVG |
| Ga0075428_10000083827 | 3300006844 | Populus Rhizosphere | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIPFDSPANKVGPWPQSA* |
| Ga0075430_1004113212 | 3300006846 | Populus Rhizosphere | MTRPTRANKPDGYRLGSYRIATAPELNSSRFTSFKSIRF |
| Ga0075431_1010696501 | 3300006847 | Populus Rhizosphere | VRPTWANKPDGYLLGSYRIATAPEPNSRRLTSFKS |
| Ga0068865_1002071361 | 3300006881 | Miscanthus Rhizosphere | MLNKPSDYPLGSYRIAPEPTSSWLTSLKSTYFDSPAN |
| Ga0073928_101305423 | 3300006893 | Iron-Sulfur Acid Spring | MMRPNRANKPNGYLLGSYRIATAPEPNSSRLTSLK |
| Ga0073928_110274251 | 3300006893 | Iron-Sulfur Acid Spring | MTGPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDS |
| Ga0079215_104196761 | 3300006894 | Agricultural Soil | MRATRASKPDGYLFGSYRIATAPEPNSSRLTSFKSTRFDSPANNVG |
| Ga0075426_100830971 | 3300006903 | Populus Rhizosphere | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANN |
| Ga0075424_1018477411 | 3300006904 | Populus Rhizosphere | MRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKS |
| Ga0079216_103333192 | 3300006918 | Agricultural Soil | MNQCFSVLKTSGHILGSYRIANAPEPNSSRLTSFKSRCFDSPANNVGPWPASLG |
| Ga0066710_1007078693 | 3300009012 | Grasslands Soil | MRPTRATKPDVYLLGSYRIATAPEPNSSLLTSFKS |
| Ga0102851_126295662 | 3300009091 | Freshwater Wetlands | MLLLARSYPDGYFLGSHRKATAPEPNSSWLTSFKSTCFDSPANKIGP |
| Ga0126374_109320112 | 3300009792 | Tropical Forest Soil | MCRKAHSSPNGYLLGSYRIATAPDPNSSRLTSFKSTCFDSPANNV |
| Ga0126304_101184961 | 3300010037 | Serpentine Soil | MMRPTQANKPDGYLLGSYRIATAPEPNSSRLTSFK |
| Ga0126310_108229691 | 3300010044 | Serpentine Soil | MMQPTRANTPDGYRLGSYRIATAPEPNSSRLTSCKS |
| Ga0126310_117269681 | 3300010044 | Serpentine Soil | MQPTRANTPDGYRLGTYRIATAPEPNSRRLTSVKS |
| Ga0126373_101432331 | 3300010048 | Tropical Forest Soil | MMRPTRANKSNGYLLGSYRIATAPEPNSSWPTSLK |
| Ga0134126_129004852 | 3300010396 | Terrestrial Soil | VPPLPEKPNSYLLGSYRIATAPELNSCRLTGRKSIGFDSPANKVGPWPA |
| Ga0153933_10374871 | 3300011411 | Attine Ant Fungus Gardens | MMRPNRINKPNSYLLGSYRIATTPERNSSRLTSLKSRGFDSPANN |
| Ga0137384_111111251 | 3300012357 | Vadose Zone Soil | MMQPARASKPDGYLLGSYRIATAPEPNSSRLTSFK |
| Ga0137395_105146673 | 3300012917 | Vadose Zone Soil | MDIKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANN |
| Ga0137407_100200159 | 3300012930 | Vadose Zone Soil | MMRPIRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANKVGPWPASLGC |
| Ga0137410_119503451 | 3300012944 | Vadose Zone Soil | MHELRVMRLTRANKPNRYLLGSYRIATAPEPNSSRLTSLK |
| Ga0126369_111579541 | 3300012971 | Tropical Forest Soil | MMRPTRANKANGYLLGSYRIATAPEPNSSRLTSLKS |
| Ga0137412_102713874 | 3300015242 | Vadose Zone Soil | MMRPIRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPANHVCPWPVS |
| Ga0132258_101218661 | 3300015371 | Arabidopsis Rhizosphere | MNLLMPCMIRPTRVDKRDGYLLGSYRIATAPEPNSRRLT |
| Ga0132255_1022706731 | 3300015374 | Arabidopsis Rhizosphere | MIQPTRGNEPNGYLVGSYRIATAPEPNSNRLTSLRSTC |
| Ga0182036_104621171 | 3300016270 | Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRF |
| Ga0182033_117794682 | 3300016319 | Soil | MMRLTRANKPSYLLDSYRIATAPEPNSIRLTSFKS |
| Ga0182034_103128214 | 3300016371 | Soil | MVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFD |
| Ga0182039_107002523 | 3300016422 | Soil | MVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFDSP |
| Ga0182039_109816231 | 3300016422 | Soil | MMRLTRANKPSYLPDSYRIATAPEPNSIRLTSFKSIDLDS |
| Ga0187801_104229231 | 3300017933 | Freshwater Sediment | MMRPTRANKPNGYLLGSYRIATAPEPNSSRPTSFKSMRFDSPANNV |
| Ga0187848_104426151 | 3300017935 | Peatland | MMRPTRTNKPNGYLLGSYRIATAPEPNSSRLTSLKS |
| Ga0187821_100095371 | 3300017936 | Freshwater Sediment | MMRWTRANKPNCYLLGSYRIATAPEPNSSRLTSFKSSHFDIPANN |
| Ga0187808_100138836 | 3300017942 | Freshwater Sediment | MLRPTRANKPNVYLLGSYRIATAPEPNSSRLTSLKST |
| Ga0187879_102255702 | 3300017946 | Peatland | MRPTRANKPKCYLLGSYPIATAPEPNSSRLTSLKSTRFDSPANNVGPWP |
| Ga0187781_113720662 | 3300017972 | Tropical Peatland | MMRPARANRPNGYLLGSYRIATAPEPNSSRFTSLKSTGFDSPANNV |
| Ga0187782_105674802 | 3300017975 | Tropical Peatland | MMRRLGLNQPDGYFLGSYRIATVPEANSSRLTSLKST |
| Ga0187804_102467721 | 3300018006 | Freshwater Sediment | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLK |
| Ga0187804_102495623 | 3300018006 | Freshwater Sediment | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKST |
| Ga0187880_13065891 | 3300018016 | Peatland | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSP |
| Ga0184608_100081018 | 3300018028 | Groundwater Sediment | MMRATRASKPDDYLLGSYRIATAPEPNSSRLTSFKSTCFDSP |
| Ga0187867_102134933 | 3300018033 | Peatland | MMRPTRANKPNGYLGSYRIATAPEPNSSRLTSLKSTRFDSPA |
| Ga0187855_102980421 | 3300018038 | Peatland | MRPTRANKPNGYPLGSYRIATAPEPNSSRLTNLKSTCF |
| Ga0187887_102094882 | 3300018043 | Peatland | MMRPTHANRLNGYFLGSYRSTTAPEPNSSRLTSFK |
| Ga0184635_101171353 | 3300018072 | Groundwater Sediment | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDS |
| Ga0187771_115193131 | 3300018088 | Tropical Peatland | MMRSTRANKPNGYLLGSYRIATVPEPNSSRLTSLKST |
| Ga0187770_115612671 | 3300018090 | Tropical Peatland | MWPTPANKPNAYLLGSYRIATAPEPNSSRLTSLKSRGFDS |
| Ga0190265_101183623 | 3300018422 | Soil | MMRPTRANKPDGYLLGSYRIATAPEPSSSRLTSFK |
| Ga0066655_111001872 | 3300018431 | Grasslands Soil | MRPARANKPEGYLLGSYRIATAPEPNSSRLTSFKSTHFDSPAN |
| Ga0066667_107568881 | 3300018433 | Grasslands Soil | MLLLARFSPDGYLLGSYRIATAPEPNSSRLTSFKSIC |
| Ga0193739_11298891 | 3300020003 | Soil | MMRATRASKPDGYLLGSYRIATAPEPNSSRLTSFKSTC |
| Ga0179594_101546751 | 3300020170 | Vadose Zone Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSI |
| Ga0194119_109270791 | 3300020220 | Freshwater Lake | MTWPELLRGRLGLTSPNGYLLGSYRIATAPEPNSSRSTSFKSTRFESPA |
| Ga0210404_105218391 | 3300021088 | Soil | MMRATRANKPNGYLLGSYRIATAPEPNSSRLTSLKS |
| Ga0213874_103850892 | 3300021377 | Plant Roots | MMRPIWANQGNGYLLGSYLIATAPEPNSTRLTSLKSTGFDRP |
| Ga0210394_103661242 | 3300021420 | Soil | MRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANNV |
| Ga0210394_114204421 | 3300021420 | Soil | MMRPTGANKPDGYLLGSYRIATAPEPNSSRLTSLKST |
| Ga0210384_106893321 | 3300021432 | Soil | MVRPARSSEPDGYLLGSYRIATAPEPNSSRLTSFRSTCFD |
| Ga0213878_103598661 | 3300021444 | Bulk Soil | MMRPTRASKPNSYLLGSYRTATAPEPNSSWLTSLK |
| Ga0210390_116039262 | 3300021474 | Soil | MRPTRANKPNGYLLGSYRIATAPEPNTSRLTSLKSTCFDSPANNV |
| Ga0210409_104681092 | 3300021559 | Soil | MQPTRANKPNGYLLGSYRIATAPEPNSSRLTSRKSTCFDSPA |
| Ga0210409_109424253 | 3300021559 | Soil | MMRPTRANKPNGYLIGSYRIATAPESNSSRLTSLKST |
| Ga0212123_103355053 | 3300022557 | Iron-Sulfur Acid Spring | MIWPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKS |
| Ga0224529_10683842 | 3300023247 | Soil | MRPTLASKPKGYLLGSYRMATAPEPNSSRLTSLKSICFDSPANNV |
| Ga0247667_10390271 | 3300024290 | Soil | MRPTRANKPNGYLLGSYRIATAPEPSSSRLTSLKSTCFDSPTNNVGPWPASLGCTT |
| Ga0137417_10048963 | 3300024330 | Vadose Zone Soil | MMRPARASKPDGYLLGSYRIATAPEPNSSRLTSFKSRC |
| Ga0209640_106101041 | 3300025324 | Soil | MRPTRATKPDVYLLGSYRIATAPEPNSSRFTSFKS |
| Ga0208848_10121251 | 3300025509 | Arctic Peat Soil | MMRPARASKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSP |
| Ga0208848_10383234 | 3300025509 | Arctic Peat Soil | MRPARASNPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSP |
| Ga0208849_10176461 | 3300025664 | Arctic Peat Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPA |
| Ga0207684_107407091 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSICFDSP |
| Ga0207684_111248192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTWANKPNGYLLGSYRIATAPEPNSSQLTSLKSTCF |
| Ga0207706_114076351 | 3300025933 | Corn Rhizosphere | MMQPTRANKPNGYLLGSYRIATAPEPNSSRLTSFK |
| Ga0207665_102784641 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRPTQANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRF |
| Ga0207667_106666073 | 3300025949 | Corn Rhizosphere | LLGSYRIATAPDSNSNRPTSFKSTYFDSPANNGYPIRPL |
| Ga0209237_11175411 | 3300026297 | Grasslands Soil | VSLNSKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPANNV |
| Ga0209473_12167081 | 3300026330 | Soil | MIRPTRAKTPDGYLFGSYRIATAPEPSSSRPTSFKSIHFDSPAN |
| Ga0209806_10255022 | 3300026529 | Soil | MMRPTRANKPDGYLLGSYRIATDPEPNSSRLTSLKSTRFDSPANNVGPWPASLA |
| Ga0179587_100545575 | 3300026557 | Vadose Zone Soil | MIRPARASKPDGYLPGSYRIATAPEPNSSRLTSFKSTCFDSPASNVGPWPASL |
| Ga0179587_103259832 | 3300026557 | Vadose Zone Soil | MMRPTGLSKRNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPA |
| Ga0209220_10782041 | 3300027587 | Forest Soil | MIWPTPANKPDGYLRGSYRIATAPEPNSSRLTSLKSTRFDSPANSV |
| Ga0209117_10236811 | 3300027645 | Forest Soil | MIRPARANKSDGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANNVG |
| Ga0209388_10031451 | 3300027655 | Vadose Zone Soil | MMRPTWANKPNGYLLGSYRIATAPEPNSSRLTSLKSTC |
| Ga0209009_10273881 | 3300027667 | Forest Soil | MMRPTRANKPNGYLRGSYRIATAPELNSSRLTSLKST |
| Ga0209588_10103694 | 3300027671 | Vadose Zone Soil | MMRPTRANKPNGYPLGSYRIATAPEPNSSRLTSLKSTCFDSPANTV |
| Ga0209118_10434011 | 3300027674 | Forest Soil | MIWPTRANKPDGYLLGSYRIATAPEPNSSRLTSLKSIRF |
| Ga0208989_101442791 | 3300027738 | Forest Soil | RAGKPECYLLGLYRIATAPEANSSRLTSFKSDTLR |
| Ga0209448_101099101 | 3300027783 | Bog Forest Soil | MMRPARANKPDGYFLGSYRIATAPEPNSSRLTSFKSTCFDSPANSVGPWP |
| Ga0209656_103716641 | 3300027812 | Bog Forest Soil | MMRPARASKPDGYLLGSYRIATAPEPNSSRLTNFKSTCFDSP |
| Ga0209481_102270781 | 3300027880 | Populus Rhizosphere | MTRPTRANKPDGYLLGSYRIATAPELNSSRFTSFKS |
| Ga0209590_105774801 | 3300027882 | Vadose Zone Soil | MMRPTPANKPNGYLLGSYRIATAPEPNSSRPTSLKSIRF |
| Ga0209590_107116461 | 3300027882 | Vadose Zone Soil | MMRPARANKPDGYLLGSYRIATAPKPNSSRLTSFKSTCFDSPATN |
| Ga0209488_108688512 | 3300027903 | Vadose Zone Soil | MRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRF |
| Ga0209488_108833342 | 3300027903 | Vadose Zone Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSVKSTR |
| Ga0209415_109098281 | 3300027905 | Peatlands Soil | MMRPTRANKPNGYLLGSYRIAIAPEPNSSRLTSLRSTC |
| Ga0209382_118323062 | 3300027909 | Populus Rhizosphere | MRPTRASKPDGYLFGSYRIATAPEPNSSRLTSFKSTSFDSP |
| Ga0209698_110775431 | 3300027911 | Watersheds | MMLPTRVSKPDRYRTGSYRIATAPEPNSSRLTRLK |
| Ga0268264_122700552 | 3300028381 | Switchgrass Rhizosphere | MLNKPSDYPLGSYRIAPEPTSSWLTSLKSTYFDSPANTVGPWP |
| Ga0307293_101270362 | 3300028711 | Soil | MRATRASKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFDSPANNV |
| Ga0307305_101021661 | 3300028807 | Soil | MMRPARAGKPDGYLLGSYRIATAPEPNSSRLTSFKSTCFDS |
| Ga0307278_105460071 | 3300028878 | Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTGFDSPAN |
| Ga0307308_100957332 | 3300028884 | Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSFKSTCFDSPA |
| Ga0308309_107867841 | 3300028906 | Soil | MRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTCFDSPANN |
| Ga0308309_116363582 | 3300028906 | Soil | MRTNRANKPCGYLLGSYRIATAPEPNSSRLTSRKSTCLDSP |
| Ga0302200_103034231 | 3300028909 | Bog | MMRPTRANKSNGYLLGSYRIATAPEPNSSRLTSLKSTCFDS |
| Ga0247275_10064815 | 3300029817 | Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRPTGLKPIRF |
| Ga0311340_102781562 | 3300029943 | Palsa | MMRPTRVNKPNGYLLGSYRIATAPEPNSSRLTSLKSTCLDSPANYGGPVAH |
| Ga0311352_102877082 | 3300029944 | Palsa | MRPTRANKCNGYLLGSYRIATAPEPNSSRLTSLKSTCFD |
| Ga0311346_109454961 | 3300029952 | Bog | VTVCRRGPDKLAGYLRGSYRIATAPEPNSSRLTSLKSIRFDN |
| Ga0311339_1001495211 | 3300029999 | Palsa | MMQPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTHFDSP |
| Ga0302270_102459681 | 3300030011 | Bog | MMRPIRANKPKGYLLGSYRIATAPEPNSSRLTSLKS |
| Ga0302282_12268642 | 3300030045 | Fen | MMRPIRANKPKGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPANN |
| Ga0268240_101620561 | 3300030496 | Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSCKSTY |
| Ga0311372_130772761 | 3300030520 | Palsa | MMLQTLVSKPNAYLLASYLIATAPEPYSSRLMNLKSTGFDSPANNVGP |
| Ga0311355_100505384 | 3300030580 | Palsa | MMRPARANKPNSYLLGSYRIATAPEPNSSRPTSLKSTWFDSPANNV |
| Ga0265461_133186161 | 3300030743 | Soil | MDHDAADLGMRPARANEPNGYLLGSYRIATAPEANSSRLKGLKSTCFD |
| Ga0299914_103372503 | 3300031228 | Soil | MMRPARASKPDGYLLGSYRIATAPEPNSSRFTSFKST |
| Ga0299913_110275881 | 3300031229 | Soil | MRATRASTPDGYLLGSYRIATTPERNSSRLTSFKSTCFDSPAN |
| Ga0170824_1151355141 | 3300031231 | Forest Soil | MMRLTRANQPDGYVLGSYRIATAPERNSSRLTSFKS |
| Ga0302323_1034494642 | 3300031232 | Fen | MIRPTQATPDPYLLGSYRSATAPESNSYRLTSFKSTYF |
| Ga0302325_100717538 | 3300031234 | Palsa | MMRPTRANKPNGYLLGSYRIATAPEPNSSRPTSLKSTCFDSPANNV |
| Ga0302325_110208653 | 3300031234 | Palsa | MMWPTGANKPDGYLLGSYRIATAPEPNSNRLTSLKSTC |
| Ga0302326_117522261 | 3300031525 | Palsa | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDS |
| Ga0310686_1072203052 | 3300031708 | Soil | MWRLGLNKPNGYLLGSYRIATAPEPNSSRLTSLKSTRFDSPANN |
| Ga0310686_1182170891 | 3300031708 | Soil | MMRPTRVNKPNGYLLGSYRSATAPEPNSSRLTSLKSTCFDSPANNV |
| Ga0307476_107019171 | 3300031715 | Hardwood Forest Soil | MRPARVSKPNGYLLGSYRIATAPELNSSRLTSLKS |
| Ga0310813_112203081 | 3300031716 | Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSTRFD |
| Ga0307469_109423452 | 3300031720 | Hardwood Forest Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFD |
| Ga0307469_115929022 | 3300031720 | Hardwood Forest Soil | MRPTRANKPDCYRLGSYRIATAPEPNSSRLTSFKSICLDSPANN |
| Ga0318502_106978051 | 3300031747 | Soil | MMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDSP |
| Ga0307477_103364161 | 3300031753 | Hardwood Forest Soil | MMRPTRANKPNGYLLGSYRMATAPEPNSSRLTSLKSIRFDSP |
| Ga0307475_111639251 | 3300031754 | Hardwood Forest Soil | MPELRVMRLTRANKPKGYLLGSYCSATAPEPNSSRL |
| Ga0318568_105310032 | 3300031819 | Soil | MMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRF |
| Ga0307473_114176972 | 3300031820 | Hardwood Forest Soil | MMRPTRANKPNGYLRGSYRIATAPEPNSSRLTSLKST |
| Ga0307410_117887341 | 3300031852 | Rhizosphere | MRPTQANKPDGYLLGSYRIATAPEPNSSQLTSFKSTGFD |
| Ga0318520_107601081 | 3300031897 | Soil | MMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIRFDSPANN |
| Ga0307406_104587492 | 3300031901 | Rhizosphere | MMRPTRANKPDGYLLGSYRIATAPEPNSSWLTSLKST |
| Ga0307407_101387801 | 3300031903 | Rhizosphere | PTRANKPDGYLLGSYRIATAPEPNSSWLTSLKSTRFDSPANNVGP |
| Ga0306926_102628694 | 3300031954 | Soil | MMRLTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSIR |
| Ga0310911_102161711 | 3300032035 | Soil | LAHRCGRLGANKPNFYLLGSYRIATAPEANSSRLTSLKSTRFDSPENNVGPWPA |
| Ga0318504_105407112 | 3300032063 | Soil | MRPTRANKSIGYLLGAYRIATAPEPNSSRLTSLKSTRFES |
| Ga0307415_1023223352 | 3300032126 | Rhizosphere | MMRPTRANKPDGYLLGSYRIATAPEPNSSWLTSLKSTRFDSPANNVGP |
| Ga0335084_112113021 | 3300033004 | Soil | MRPTRAGKPDGYLFGSYRIATAPKPNSGLLTSFKS |
| Ga0310914_102407991 | 3300033289 | Soil | MRPTGANKPNGYPLGSYRIDAAPAANSSRLTSLNSTGFDSPANNAG |
| Ga0310914_114706691 | 3300033289 | Soil | MVRPTRANNPDGYLVGSYRIATPEPNSSRLTSLKSTGFDSPANNVGPWPASLG |
| Ga0318519_104766722 | 3300033290 | Soil | MMRLTRAHKSDGYLLGSYRIATAPEPNSSRLTSFKSIGFDSP |
| Ga0316601_1010872071 | 3300033419 | Soil | MRPTRSNMPHGYLLGSYRIATAPEPNSSRLTSFKSTCFD |
| Ga0316624_103579281 | 3300033486 | Soil | MMRPTRANKPNGYLLGSYRIATAPEPNSSRLTSLKSIRFDSPAN |
| Ga0316628_1006937333 | 3300033513 | Soil | VSPALTPDGYLLGSYRIATTPEPNSCRLMSFKSRCFDSLENNVGR |
| Ga0316617_1023926592 | 3300033557 | Soil | MMRPTPANKPDGYLLGSYRIATAPEPSSSRLTSFKSTR |
| Ga0334961_093439_2_127 | 3300034143 | Sub-Biocrust Soil | MMRPTRANKPDGYLLGSYRIATAPEPNSSRLTSFKSICFDSP |
| ⦗Top⦘ |