


| Basic Information | |
|---|---|
| Family ID | F031229 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MGQWLIADLSVSDVHFQLWMLLVTGIVLLWFVYVWATR |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.97 % |
| % of genes near scaffold ends (potentially truncated) | 20.77 % |
| % of genes from short scaffolds (< 2000 bps) | 93.44 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.831 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.300 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.230 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (71.585 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.55% β-sheet: 0.00% Coil/Unstructured: 45.45% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF12787 | EcsC | 2.19 |
| PF00536 | SAM_1 | 2.19 |
| PF07859 | Abhydrolase_3 | 1.64 |
| PF00872 | Transposase_mut | 1.64 |
| PF13185 | GAF_2 | 1.64 |
| PF13191 | AAA_16 | 1.09 |
| PF00589 | Phage_integrase | 1.09 |
| PF01590 | GAF | 1.09 |
| PF07721 | TPR_4 | 1.09 |
| PF04392 | ABC_sub_bind | 0.55 |
| PF03703 | bPH_2 | 0.55 |
| PF00440 | TetR_N | 0.55 |
| PF02771 | Acyl-CoA_dh_N | 0.55 |
| PF07647 | SAM_2 | 0.55 |
| PF13826 | DUF4188 | 0.55 |
| PF06078 | DUF937 | 0.55 |
| PF03992 | ABM | 0.55 |
| PF13683 | rve_3 | 0.55 |
| PF00999 | Na_H_Exchanger | 0.55 |
| PF08240 | ADH_N | 0.55 |
| PF12006 | DUF3500 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.64 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.64 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.55 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.55 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
| COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.55 |
| COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.55 |
| COG3753 | Uncharacterized conserved protein YidB, DUF937 family | Function unknown [S] | 0.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.83 % |
| All Organisms | root | All Organisms | 43.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig40104 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10048644 | Not Available | 1604 | Open in IMG/M |
| 3300004152|Ga0062386_101242022 | Not Available | 619 | Open in IMG/M |
| 3300005147|Ga0066821_1007943 | Not Available | 718 | Open in IMG/M |
| 3300005332|Ga0066388_101909241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
| 3300005332|Ga0066388_106995156 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300005336|Ga0070680_101777611 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005437|Ga0070710_10990875 | Not Available | 612 | Open in IMG/M |
| 3300005439|Ga0070711_100223792 | Not Available | 1464 | Open in IMG/M |
| 3300005541|Ga0070733_10162325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1453 | Open in IMG/M |
| 3300005610|Ga0070763_10185590 | Not Available | 1103 | Open in IMG/M |
| 3300005764|Ga0066903_100678938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1809 | Open in IMG/M |
| 3300005764|Ga0066903_101035017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1505 | Open in IMG/M |
| 3300005764|Ga0066903_104071344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 783 | Open in IMG/M |
| 3300005764|Ga0066903_104368687 | Not Available | 755 | Open in IMG/M |
| 3300005764|Ga0066903_104549127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. 28-YEA-48 | 739 | Open in IMG/M |
| 3300005764|Ga0066903_105548807 | Not Available | 665 | Open in IMG/M |
| 3300005921|Ga0070766_10114957 | Not Available | 1611 | Open in IMG/M |
| 3300006041|Ga0075023_100534983 | Not Available | 534 | Open in IMG/M |
| 3300006047|Ga0075024_100821101 | Not Available | 522 | Open in IMG/M |
| 3300006050|Ga0075028_101030856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 513 | Open in IMG/M |
| 3300006052|Ga0075029_100274674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1070 | Open in IMG/M |
| 3300006057|Ga0075026_100271991 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006059|Ga0075017_100227004 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300006059|Ga0075017_100347456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1104 | Open in IMG/M |
| 3300006059|Ga0075017_100568248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300006086|Ga0075019_10297079 | Not Available | 972 | Open in IMG/M |
| 3300006172|Ga0075018_10623265 | Not Available | 576 | Open in IMG/M |
| 3300006174|Ga0075014_100021584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2477 | Open in IMG/M |
| 3300006174|Ga0075014_100334463 | Not Available | 808 | Open in IMG/M |
| 3300006174|Ga0075014_100382271 | Not Available | 763 | Open in IMG/M |
| 3300006354|Ga0075021_10254269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1082 | Open in IMG/M |
| 3300006606|Ga0074062_10402917 | Not Available | 744 | Open in IMG/M |
| 3300006893|Ga0073928_10940716 | Not Available | 591 | Open in IMG/M |
| 3300009098|Ga0105245_12246628 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009520|Ga0116214_1292310 | Not Available | 624 | Open in IMG/M |
| 3300009521|Ga0116222_1040830 | Not Available | 2032 | Open in IMG/M |
| 3300009522|Ga0116218_1025990 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300009522|Ga0116218_1434907 | Not Available | 585 | Open in IMG/M |
| 3300009522|Ga0116218_1512542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
| 3300009525|Ga0116220_10127246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1088 | Open in IMG/M |
| 3300009700|Ga0116217_10883325 | Not Available | 549 | Open in IMG/M |
| 3300010046|Ga0126384_10589550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
| 3300010048|Ga0126373_10919013 | Not Available | 939 | Open in IMG/M |
| 3300010048|Ga0126373_12097240 | Not Available | 627 | Open in IMG/M |
| 3300010339|Ga0074046_10480476 | Not Available | 743 | Open in IMG/M |
| 3300010359|Ga0126376_11555882 | Not Available | 692 | Open in IMG/M |
| 3300010360|Ga0126372_12651180 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010361|Ga0126378_10900797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 991 | Open in IMG/M |
| 3300010362|Ga0126377_13047198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300010366|Ga0126379_12600127 | Not Available | 604 | Open in IMG/M |
| 3300010371|Ga0134125_12318123 | Not Available | 584 | Open in IMG/M |
| 3300010376|Ga0126381_101475916 | Not Available | 983 | Open in IMG/M |
| 3300010376|Ga0126381_101656773 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300010376|Ga0126381_101909411 | Not Available | 856 | Open in IMG/M |
| 3300010376|Ga0126381_102770906 | Not Available | 700 | Open in IMG/M |
| 3300010376|Ga0126381_103241875 | Not Available | 643 | Open in IMG/M |
| 3300010376|Ga0126381_103491105 | Not Available | 618 | Open in IMG/M |
| 3300010379|Ga0136449_100645064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1791 | Open in IMG/M |
| 3300010379|Ga0136449_100669034 | Not Available | 1749 | Open in IMG/M |
| 3300010379|Ga0136449_100758000 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1614 | Open in IMG/M |
| 3300010379|Ga0136449_101127259 | Not Available | 1245 | Open in IMG/M |
| 3300010379|Ga0136449_101307218 | Not Available | 1130 | Open in IMG/M |
| 3300010379|Ga0136449_101385714 | Not Available | 1087 | Open in IMG/M |
| 3300010379|Ga0136449_103456754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300010379|Ga0136449_103663367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 581 | Open in IMG/M |
| 3300010398|Ga0126383_12486210 | Not Available | 602 | Open in IMG/M |
| 3300010398|Ga0126383_12552122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 595 | Open in IMG/M |
| 3300011120|Ga0150983_11576359 | Not Available | 546 | Open in IMG/M |
| 3300011120|Ga0150983_14809963 | Not Available | 636 | Open in IMG/M |
| 3300012177|Ga0153943_1135983 | Not Available | 535 | Open in IMG/M |
| 3300012181|Ga0153922_1175642 | Not Available | 508 | Open in IMG/M |
| 3300012958|Ga0164299_10500255 | Not Available | 808 | Open in IMG/M |
| 3300012971|Ga0126369_12997474 | Not Available | 553 | Open in IMG/M |
| 3300012989|Ga0164305_10452849 | Not Available | 997 | Open in IMG/M |
| 3300014169|Ga0181531_10555001 | Not Available | 711 | Open in IMG/M |
| 3300014201|Ga0181537_10203664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1360 | Open in IMG/M |
| 3300014654|Ga0181525_10285260 | Not Available | 901 | Open in IMG/M |
| 3300015371|Ga0132258_11423223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1751 | Open in IMG/M |
| 3300016270|Ga0182036_10322750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1181 | Open in IMG/M |
| 3300016270|Ga0182036_11508738 | Not Available | 564 | Open in IMG/M |
| 3300016294|Ga0182041_10934953 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 781 | Open in IMG/M |
| 3300016294|Ga0182041_12305653 | Not Available | 504 | Open in IMG/M |
| 3300016341|Ga0182035_11319219 | Not Available | 646 | Open in IMG/M |
| 3300016341|Ga0182035_11730328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300016357|Ga0182032_10686289 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300016357|Ga0182032_10792404 | Not Available | 800 | Open in IMG/M |
| 3300016371|Ga0182034_11105912 | Not Available | 687 | Open in IMG/M |
| 3300016371|Ga0182034_11317375 | Not Available | 630 | Open in IMG/M |
| 3300016387|Ga0182040_11601842 | Not Available | 554 | Open in IMG/M |
| 3300016387|Ga0182040_11603131 | Not Available | 554 | Open in IMG/M |
| 3300016404|Ga0182037_11306086 | Not Available | 640 | Open in IMG/M |
| 3300016404|Ga0182037_11590515 | Not Available | 581 | Open in IMG/M |
| 3300016445|Ga0182038_10220333 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300017822|Ga0187802_10223067 | Not Available | 727 | Open in IMG/M |
| 3300017933|Ga0187801_10019120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2315 | Open in IMG/M |
| 3300017933|Ga0187801_10057674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1421 | Open in IMG/M |
| 3300017936|Ga0187821_10313979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 187 | 625 | Open in IMG/M |
| 3300017943|Ga0187819_10697661 | Not Available | 572 | Open in IMG/M |
| 3300017946|Ga0187879_10098856 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300017955|Ga0187817_10308888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1008 | Open in IMG/M |
| 3300017955|Ga0187817_10419659 | Not Available | 854 | Open in IMG/M |
| 3300017955|Ga0187817_10750096 | Not Available | 623 | Open in IMG/M |
| 3300017970|Ga0187783_10159735 | Not Available | 1660 | Open in IMG/M |
| 3300017970|Ga0187783_10238480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. LMTR 3 | 1331 | Open in IMG/M |
| 3300017970|Ga0187783_10407192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 988 | Open in IMG/M |
| 3300017970|Ga0187783_10885151 | Not Available | 644 | Open in IMG/M |
| 3300017972|Ga0187781_11117772 | Not Available | 578 | Open in IMG/M |
| 3300017974|Ga0187777_10228132 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300017975|Ga0187782_11489765 | Not Available | 533 | Open in IMG/M |
| 3300017995|Ga0187816_10547268 | Not Available | 521 | Open in IMG/M |
| 3300018007|Ga0187805_10316734 | Not Available | 718 | Open in IMG/M |
| 3300018085|Ga0187772_10187609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1384 | Open in IMG/M |
| 3300018085|Ga0187772_10571168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 803 | Open in IMG/M |
| 3300020579|Ga0210407_10906434 | Not Available | 676 | Open in IMG/M |
| 3300020579|Ga0210407_10939790 | Not Available | 662 | Open in IMG/M |
| 3300020582|Ga0210395_10431196 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300020583|Ga0210401_10639130 | Not Available | 925 | Open in IMG/M |
| 3300020583|Ga0210401_10641704 | Not Available | 923 | Open in IMG/M |
| 3300020583|Ga0210401_10716670 | Not Available | 861 | Open in IMG/M |
| 3300021170|Ga0210400_10091490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2401 | Open in IMG/M |
| 3300021171|Ga0210405_10491359 | Not Available | 962 | Open in IMG/M |
| 3300021178|Ga0210408_11010094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 643 | Open in IMG/M |
| 3300021180|Ga0210396_10189714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1839 | Open in IMG/M |
| 3300021401|Ga0210393_10401228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1118 | Open in IMG/M |
| 3300021405|Ga0210387_10292587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1432 | Open in IMG/M |
| 3300021405|Ga0210387_10782165 | Not Available | 844 | Open in IMG/M |
| 3300021405|Ga0210387_11379239 | Not Available | 607 | Open in IMG/M |
| 3300021407|Ga0210383_10544329 | Not Available | 1002 | Open in IMG/M |
| 3300021407|Ga0210383_11095147 | Not Available | 673 | Open in IMG/M |
| 3300021407|Ga0210383_11620911 | Not Available | 532 | Open in IMG/M |
| 3300021420|Ga0210394_10359506 | Not Available | 1280 | Open in IMG/M |
| 3300021433|Ga0210391_10953215 | Not Available | 669 | Open in IMG/M |
| 3300021474|Ga0210390_11006975 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300021560|Ga0126371_10422423 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300021560|Ga0126371_11471129 | Not Available | 810 | Open in IMG/M |
| 3300022498|Ga0242644_1043418 | Not Available | 515 | Open in IMG/M |
| 3300022498|Ga0242644_1046771 | Not Available | 502 | Open in IMG/M |
| 3300022508|Ga0222728_1107700 | Not Available | 535 | Open in IMG/M |
| 3300022533|Ga0242662_10074742 | Not Available | 923 | Open in IMG/M |
| 3300022533|Ga0242662_10312592 | Not Available | 527 | Open in IMG/M |
| 3300022709|Ga0222756_1044185 | Not Available | 652 | Open in IMG/M |
| 3300022715|Ga0242678_1027148 | Not Available | 734 | Open in IMG/M |
| 3300022724|Ga0242665_10157985 | Not Available | 721 | Open in IMG/M |
| 3300025933|Ga0207706_10200816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 1749 | Open in IMG/M |
| 3300026999|Ga0207949_1011397 | Not Available | 806 | Open in IMG/M |
| 3300027604|Ga0208324_1038793 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300027604|Ga0208324_1138990 | Not Available | 665 | Open in IMG/M |
| 3300027867|Ga0209167_10771871 | Not Available | 524 | Open in IMG/M |
| 3300027894|Ga0209068_10831664 | Not Available | 545 | Open in IMG/M |
| 3300027898|Ga0209067_10543831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 663 | Open in IMG/M |
| 3300027898|Ga0209067_10629789 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300027908|Ga0209006_10237709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1571 | Open in IMG/M |
| 3300027910|Ga0209583_10215611 | Not Available | 828 | Open in IMG/M |
| 3300027910|Ga0209583_10519230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
| 3300029999|Ga0311339_10120412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3172 | Open in IMG/M |
| 3300029999|Ga0311339_10345758 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1576 | Open in IMG/M |
| 3300030503|Ga0311370_11351766 | Not Available | 757 | Open in IMG/M |
| 3300030503|Ga0311370_11702446 | Not Available | 647 | Open in IMG/M |
| 3300030524|Ga0311357_11378896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 602 | Open in IMG/M |
| 3300030707|Ga0310038_10070058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1910 | Open in IMG/M |
| 3300031231|Ga0170824_104921904 | Not Available | 721 | Open in IMG/M |
| 3300031708|Ga0310686_105380741 | All Organisms → cellular organisms → Bacteria | 4504 | Open in IMG/M |
| 3300031708|Ga0310686_108442225 | Not Available | 1730 | Open in IMG/M |
| 3300031708|Ga0310686_112508339 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300031708|Ga0310686_112784167 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1989 | Open in IMG/M |
| 3300031708|Ga0310686_119014166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3853 | Open in IMG/M |
| 3300031719|Ga0306917_11372208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 546 | Open in IMG/M |
| 3300031814|Ga0247548_106645 | Not Available | 566 | Open in IMG/M |
| 3300031823|Ga0307478_10741092 | Not Available | 823 | Open in IMG/M |
| 3300031890|Ga0306925_10755778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
| 3300031890|Ga0306925_12146068 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032076|Ga0306924_11445454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 732 | Open in IMG/M |
| 3300032160|Ga0311301_10258359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2858 | Open in IMG/M |
| 3300032160|Ga0311301_10320014 | Not Available | 2462 | Open in IMG/M |
| 3300032160|Ga0311301_10744680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1363 | Open in IMG/M |
| 3300032160|Ga0311301_11181639 | Not Available | 983 | Open in IMG/M |
| 3300032160|Ga0311301_11460977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 846 | Open in IMG/M |
| 3300032160|Ga0311301_12462469 | Not Available | 584 | Open in IMG/M |
| 3300032180|Ga0307471_102940278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 605 | Open in IMG/M |
| 3300032261|Ga0306920_102880442 | Not Available | 653 | Open in IMG/M |
| 3300032895|Ga0335074_10145504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3011 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.30% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 13.11% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 10.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.93% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.73% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.73% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.09% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.55% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.55% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.55% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.55% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.55% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022498 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022508 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022709 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022715 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026999 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF044 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0104.00003380 | 2166559005 | Simulated | MGQWLIADLSVSDVHFQLWMLLVTGIVLLWFVYVWATR |
| JGIcombinedJ51221_100486442 | 3300003505 | Forest Soil | MGQWLIADVSLFDVHLQLWMLFATGIMLLWFIYVWATRLR* |
| Ga0062386_1012215432 | 3300004152 | Bog Forest Soil | MGEWLAADLSFLDVHFQAWMLAVLGIFLFWFPYAWRQRR* |
| Ga0062386_1012420222 | 3300004152 | Bog Forest Soil | MGQWLVADLSVMDVHFQLWMVVVTAILLVWFSFVWATRHVR* |
| Ga0066821_10079432 | 3300005147 | Soil | GATFREGDQQMGQWLIADVSVFDVHLQLWMLLATGIMLLWFIYVWATRLR* |
| Ga0066388_1019092411 | 3300005332 | Tropical Forest Soil | MREWLAADMSVMDVHFQLWMVLVAAFLLGWFALVWATRHVR* |
| Ga0066388_1069951562 | 3300005332 | Tropical Forest Soil | MGQWLVADISVMDVHFQLWMVLVTAMLLVWFAFVWATRHVR* |
| Ga0070680_1017776112 | 3300005336 | Corn Rhizosphere | MAQWLIADVSLFDVHVQVWMLLVAGIFLSWFFFVWRQPH* |
| Ga0070710_109908752 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQWLIADVSVFDVHLQLWMLLATGIMLLWFIYVWATRLR* |
| Ga0070711_1002237924 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MGQWLIADVSLLNVHVQLWMLLVIGIMLLWIIYVWASNCV* |
| Ga0070733_101623252 | 3300005541 | Surface Soil | MAEWLIADVPLFNIHVQLWMLLVTGLVLIWFLYAWVTR* |
| Ga0070763_101855903 | 3300005610 | Soil | MGQWLIADLSVSDVHFQLWMLLVTGIVLLWFVYVWATR* |
| Ga0066903_1006789381 | 3300005764 | Tropical Forest Soil | MRDLLVADLSVMNVHFQLWMVLVTAILLIWFAFVWATRPVR* |
| Ga0066903_1010350174 | 3300005764 | Tropical Forest Soil | MGQWLIADLSVLDVHFQLWMLLVTGIILTWFVYVWATR* |
| Ga0066903_1040713443 | 3300005764 | Tropical Forest Soil | WLIADVSIFDVHLQFWMVLVGGILLLWFIWAWVTRTVR* |
| Ga0066903_1043686873 | 3300005764 | Tropical Forest Soil | MGQWLIADFSILDVHVQLWMMLVTGIILFWFVYVWATR* |
| Ga0066903_1045491272 | 3300005764 | Tropical Forest Soil | MRDLLVADLSVMHVHFQLWMVLVTAILLIWFAFVWATRHVR* |
| Ga0066903_1055488072 | 3300005764 | Tropical Forest Soil | MGQWLIADLSVSDVHFHVWMLLVTGIILFWFLYVWATR* |
| Ga0070766_101149572 | 3300005921 | Soil | MGQWLIADVSLFDVHLQLWMLLATGIMLLWFIYVWATRLR* |
| Ga0075023_1005349831 | 3300006041 | Watersheds | MGQWLIADLSVSDVHFQLWMLLVTAILLIWFAFVWATRHVR* |
| Ga0075024_1008211011 | 3300006047 | Watersheds | MGRWLVADLSVMDVHFQLWMVLVTGILLVWFLFVWATRHVR* |
| Ga0075028_1010308562 | 3300006050 | Watersheds | MATMAEWLIADVPLLGVHLQLWMLLVTSVVLIWFVYVWATR* |
| Ga0075029_1002746742 | 3300006052 | Watersheds | MGQWLIADLSVSDVHFQFWMLLVAGVILFWFLYVWATR* |
| Ga0075026_1002719912 | 3300006057 | Watersheds | MGQWLIADLSVSDVHFQFWMLLVTAILLVWFAFVWATRHVR* |
| Ga0075017_1002270042 | 3300006059 | Watersheds | MGQWLIADLSVSDVHFQLWMLLVTGFILLWFVYVWATR* |
| Ga0075017_1003474564 | 3300006059 | Watersheds | MGRWLIADLSILDVHFQAWMLLVTGIILLWFLYVWATRQHR* |
| Ga0075017_1005682481 | 3300006059 | Watersheds | MEHWLIVDITFLDVHLQLWMLLVTAIMSLWFVYVWVTL* |
| Ga0075019_102970791 | 3300006086 | Watersheds | DTMGQWLAADLSVMDVHLQIWMVLVTAILLVWFAFVSATRQVR* |
| Ga0075018_106232651 | 3300006172 | Watersheds | MAQWLIADISLLDVHVHLWMLLVTGIILLWFLYVWATR* |
| Ga0075014_1000215841 | 3300006174 | Watersheds | MGQWLAADLSVMDVHLQIWMVLVTAILLVWFAFVS |
| Ga0075014_1003344632 | 3300006174 | Watersheds | MGRWLIADLSILDVHFQAWMLLVTGIILLWFLYVWATR* |
| Ga0075014_1003822713 | 3300006174 | Watersheds | WLIADVSLFDVHVQLWMLFATSIMLLWFIYVWATRLR* |
| Ga0075021_102542692 | 3300006354 | Watersheds | MGRWLVADLSVMDVHFQLWMVLVTGILLVWFLFVWATRQVR* |
| Ga0074062_104029172 | 3300006606 | Soil | MGQWLIADVSLFDVHLQLWMLFATGIILLWFIYVWATRLR* |
| Ga0073928_109407161 | 3300006893 | Iron-Sulfur Acid Spring | MGQWLIADVSLFDVHLQLWMLFATGIMLLWFLYVWATRSRP |
| Ga0105245_122466282 | 3300009098 | Miscanthus Rhizosphere | MGQWLITDVWVSNVHFQLWMLLVATVLFLWFVYVWATR* |
| Ga0116214_12923102 | 3300009520 | Peatlands Soil | MGEWLIADLSILDVHVQAWMLLVAGFFLLWLLYVCL* |
| Ga0116222_10408301 | 3300009521 | Peatlands Soil | MGEWLVADLSILDVHFQAWMVLVTGFFLLWLLYAWRQAR* |
| Ga0116218_10259903 | 3300009522 | Peatlands Soil | MGQWLIADLSVSDVHVQLWMLLVTGIVLLWFLYVWATR* |
| Ga0116218_14349071 | 3300009522 | Peatlands Soil | MEIGKMTQWLIADITFLDVHLQLWLLLVTGIISLWFVYVWATR* |
| Ga0116218_15125421 | 3300009522 | Peatlands Soil | AQWLIADISLLDVHAHLWMLLVTGIISIWFLYVWATRSRP* |
| Ga0116220_101272461 | 3300009525 | Peatlands Soil | MGEWLVADLSILDVHFQAWMLLVTGFFLLWLLYAWRQAR* |
| Ga0116217_108833252 | 3300009700 | Peatlands Soil | KMTQWLIADITFLDVHLQLWMLLVTGIISLWFVYVWATR* |
| Ga0126384_105895502 | 3300010046 | Tropical Forest Soil | MGQWLIADVSLFDVHVQVWMLLVTAVVLLWFIYVWATR* |
| Ga0126373_109190132 | 3300010048 | Tropical Forest Soil | MREWLLADLSVMDVHFQLWMVLITAILLVWFLFVWATRHVR* |
| Ga0126373_120972402 | 3300010048 | Tropical Forest Soil | MREWLAADISVMDVHFQLWMVLVAAFLLGWFALVWATRHVR* |
| Ga0074046_104804762 | 3300010339 | Bog Forest Soil | MAQWLIADISLLDVHLQLWMLLVASFILLWFAYVWATR* |
| Ga0126376_115558823 | 3300010359 | Tropical Forest Soil | VADLSVMDVHFKLWMVLVAAILLIWFAFVWATRHVR* |
| Ga0126372_126511801 | 3300010360 | Tropical Forest Soil | MGQWLIADVSLFDVHVQVWMLLVTAVILLWFIYVWATR* |
| Ga0126378_109007972 | 3300010361 | Tropical Forest Soil | MRDLLVADLSVMDVHFQLWMVLVAAILLIWFAFVWATRHVR* |
| Ga0126377_130471981 | 3300010362 | Tropical Forest Soil | MRDLLVADLSVMDVHFQLWMVLVTAILLIVWATRH |
| Ga0126379_126001271 | 3300010366 | Tropical Forest Soil | MGQWLIADLSVSDVHFQLWMVLVTVILLIWFAFVWTTRHVR* |
| Ga0134125_123181231 | 3300010371 | Terrestrial Soil | MAQWLIADIAFLDVHLQLWMLLVTGIISLWFAYVWATR* |
| Ga0126381_1014759161 | 3300010376 | Tropical Forest Soil | MRELLAADISVMDVHFQLWMVLVAAFLLGWFALVWATRHVR* |
| Ga0126381_1016567731 | 3300010376 | Tropical Forest Soil | MRGLLIADLSVMNVHFQLWMVLVTAILLIWFAFVWATRHVR* |
| Ga0126381_1019094114 | 3300010376 | Tropical Forest Soil | DLLVADLSVMDVHFQLWMVLVAAILLIWFAFVWATRHVR* |
| Ga0126381_1027709062 | 3300010376 | Tropical Forest Soil | MREWLLADLSVMDVHFQLWMVLVTAILLVWFLFVWATRHVR* |
| Ga0126381_1032418751 | 3300010376 | Tropical Forest Soil | GRNMRDLLVADLSVMDVHFQLWMVLVTAILLIWFAFVWATRPVR* |
| Ga0126381_1034911051 | 3300010376 | Tropical Forest Soil | MGQWLVADFSLLEVHVQLWILLFTGIILFWLIYVWATR* |
| Ga0136449_1006450641 | 3300010379 | Peatlands Soil | MGQWLIADISVLDVHFHLWMLLVTGIMLLWFVYVWATR* |
| Ga0136449_1006690342 | 3300010379 | Peatlands Soil | MEIGKMTQWLIADITFLDVHLQLWMLLVTGIISLWFVYVWATR* |
| Ga0136449_1007580002 | 3300010379 | Peatlands Soil | MAQWLIADISLLDVHAHLWMLLVTGIISIWFLYVWATRSRP* |
| Ga0136449_1011272591 | 3300010379 | Peatlands Soil | MGEWLIADISLLEIHFQAWMLLVTGIFLLWLLYAWRQAQ* |
| Ga0136449_1013072182 | 3300010379 | Peatlands Soil | MGEWLIADVSLLDVHCQLWMLLVTSFVFLWFLYVWATR* |
| Ga0136449_1013857143 | 3300010379 | Peatlands Soil | MAEWLIADVPLFDVHLQVWMLLVTGAVLIWFVYVWVTR* |
| Ga0136449_1034567542 | 3300010379 | Peatlands Soil | MAEWLTADVPVFDVHLQVWMLLVAGVLLCWLGYVWATRSMN* |
| Ga0136449_1036633671 | 3300010379 | Peatlands Soil | MGQWLIADLSVSEVHFPLWMLLVTGIIFLWFVYVWATR* |
| Ga0126383_124862102 | 3300010398 | Tropical Forest Soil | MRDLLVADLSVMDVHFQLWMVLVTAILLIWFAFVWATRHVR* |
| Ga0126383_125521222 | 3300010398 | Tropical Forest Soil | DLLVADLSVMNVHFQLWMVLVTAILLIWFAFVWATRPVR* |
| Ga0150983_115763592 | 3300011120 | Forest Soil | MGQWLIADVSLLDIHLQLWMLLVTGIMLLWIIYVWATQLR* |
| Ga0150983_148099632 | 3300011120 | Forest Soil | MGQWLVADLSGMDVHFQLWMVLVTAILLVWFAFVWATRHVR* |
| Ga0153943_11359831 | 3300012177 | Attine Ant Fungus Gardens | MGQWLIADLSFLDVHVQLWMTLVTLVILLWLFYVWATRR |
| Ga0153922_11756421 | 3300012181 | Attine Ant Fungus Gardens | MGQWLITDLSVLDIHLPLWMLLVATLILLWFVYVWATR* |
| Ga0164299_105002551 | 3300012958 | Soil | QMGQWLIADVSLFDVHLHLWMLLVTGIISLSFLYVWATRSRP* |
| Ga0126369_129974741 | 3300012971 | Tropical Forest Soil | MRGLLIADLSVMNVHFQLWMVLVTAILLIWFAFVWATRPVR* |
| Ga0164305_104528493 | 3300012989 | Soil | MGQCLIADVSLFDVHLQLWMLFATGIMLLWFIYVWATRLR* |
| Ga0181531_105550013 | 3300014169 | Bog | MGEWLIADVSFLDVHLQLWMLLVTAIVLVWLMYAWATR* |
| Ga0181537_102036643 | 3300014201 | Bog | MGEWLIADVPLFNVHLQLWMLLVTAFILLWLAYVWATRSR* |
| Ga0181525_102852602 | 3300014654 | Bog | MGEWLIADVSLLDVHLQLWMLLVTAIVLVWLMYAWATR* |
| Ga0132258_114232233 | 3300015371 | Arabidopsis Rhizosphere | MRQWVVADLSVMDVHFQLWMVLVTAILLVWFAFVWATRHVR* |
| Ga0182036_103227502 | 3300016270 | Soil | MGQWLIADVSLFGVHVQFWMLLVTAVFLLWFIYVWATR |
| Ga0182036_115087381 | 3300016270 | Soil | MGQWLVADLSVMDVHFQLWMVLVAVILLVWFAHVWATRHVR |
| Ga0182041_109349531 | 3300016294 | Soil | CARSKGASMGQWLIADVSLFDVHVQVWMLLVTAVVLFWFIYVWATR |
| Ga0182041_123056532 | 3300016294 | Soil | MGQWLIADVSLFDVHVQVWMLLVTAVVLLWFIYVWATR |
| Ga0182035_113192191 | 3300016341 | Soil | MREWLVADLSVMDVHFQLWMVLVTAILLVWFLFVWATRHVR |
| Ga0182035_117303281 | 3300016341 | Soil | MGQWLIADVSLFDVHVQVWMLLVTAVVLFWFIYVWATR |
| Ga0182032_106862892 | 3300016357 | Soil | MGQWLIADVSLFGVHVQFWMLLVAAVFLLWFIYVWATR |
| Ga0182032_107924041 | 3300016357 | Soil | MRELLAADISVMDVHFQLWMVLVAAFLLGWFALVWATRHVR |
| Ga0182034_111059121 | 3300016371 | Soil | MGQWLIADVSLLDIHLQLWMLLVTGVMLLWIIYVWATQ |
| Ga0182034_113173752 | 3300016371 | Soil | MGQWLIADVSFLDVHVQLWMLLVVGVLLIWLAAVWVMR |
| Ga0182040_116018421 | 3300016387 | Soil | MRQWLLADFSFLDVHVQLWMVVVTVVILLWLFYVWATRKP |
| Ga0182040_116031311 | 3300016387 | Soil | MRQWLIADVSFLDVHVQLWMVLVVMVFLLWFFYVWANRKP |
| Ga0182037_113060861 | 3300016404 | Soil | GRDMRDLLVADLSVMDVHFQLRMVRVTAILLIWFAFVWATRPFR |
| Ga0182037_115905152 | 3300016404 | Soil | MGQWLIADVPFLDVHVQLWMVLVVMVFLLWFFYVWATRKP |
| Ga0182038_102203331 | 3300016445 | Soil | WLIADVSLLDIHLQLWMLLVTGIMLLLIIYVWATRLR |
| Ga0187802_102230671 | 3300017822 | Freshwater Sediment | MGQWLIADLSVSDVHFQLWMLLVTGFILLWFVYVWATR |
| Ga0187801_100191203 | 3300017933 | Freshwater Sediment | MGQWLIADLSILDVHFQAWMLLVTGIILLWFLYVWATR |
| Ga0187801_100576743 | 3300017933 | Freshwater Sediment | MGEWLVADLSILDVHFQAWMLLVTGFFLLWLLYAWRQAR |
| Ga0187821_103139792 | 3300017936 | Freshwater Sediment | VERVNVTRHSPVWFGRGNMGQWLVADLSVMDVHFQLWMVLVTGILLVWFLFVWATRHVR |
| Ga0187819_106976612 | 3300017943 | Freshwater Sediment | MGQWLIADLSVSDVHVQLWMLLVTGIVLLWFLYVWATR |
| Ga0187879_100988561 | 3300017946 | Peatland | MGEWLIADLSVLDVHFQAWMLLVVGIVLLWFLYVWATR |
| Ga0187817_103088882 | 3300017955 | Freshwater Sediment | LVADLSILDVHFQAWMLLVTGFFLLWLLYAWRQAR |
| Ga0187817_104196591 | 3300017955 | Freshwater Sediment | MGQWLITDLSVSDIHFQLWMLLVTAFILLWFLYVWGTRLR |
| Ga0187817_107500962 | 3300017955 | Freshwater Sediment | MGQWLIADLFSVSDVHVQLWMLLVTGIVFLWFLYVWATR |
| Ga0187783_101597355 | 3300017970 | Tropical Peatland | MRDLLVADLSVMDVHFQLWMALVTAILLIWFAFVWATRPVR |
| Ga0187783_102384801 | 3300017970 | Tropical Peatland | PARVVPMVQWLIADVPLLSVPLQLWMLFVAAFVVAWFFYVWATG |
| Ga0187783_104071922 | 3300017970 | Tropical Peatland | MGQLLIADVSVMDVHFQLWMVLVTVILLIWFAFVWTTRHVR |
| Ga0187783_108851511 | 3300017970 | Tropical Peatland | MGEWLIADVPLFGVHLQLWMLLVTGALLVWFLYGWATRER |
| Ga0187781_111177722 | 3300017972 | Tropical Peatland | MGEWLIADVPLFGVHLQLWMLLVTGCLFLWFLYGWVTRER |
| Ga0187777_102281321 | 3300017974 | Tropical Peatland | MGQWLIADLSVMDVHFQLWMVLVTVILLVWFAFVWATRHVR |
| Ga0187782_114897652 | 3300017975 | Tropical Peatland | MGQWLIADLSFFDTHFQLWMLLFAGLILAWFLYVWAMR |
| Ga0187816_105472682 | 3300017995 | Freshwater Sediment | MAQWLIADITFLDVHLQLWMLLVTGIISLWFVYVWATR |
| Ga0187805_103167341 | 3300018007 | Freshwater Sediment | MGQGQWLITDLSVSDVHVQLWMLLVTSIVLLWFLY |
| Ga0187772_101876093 | 3300018085 | Tropical Peatland | MGQWLAADLSVMDVHFQVWMVLVAVILLVWFAFVWATRDIR |
| Ga0187772_105711681 | 3300018085 | Tropical Peatland | VADAHQEATMGQWLIADLSVADVHVQPWMLLVTGIILLWFLYVWATR |
| Ga0210407_109064341 | 3300020579 | Soil | MGQWLIADVSLFDVHLQLWMLFATGIMLLWFIYVWATRLR |
| Ga0210407_109397902 | 3300020579 | Soil | MGQWLIADLSVSDVHFQFWMLLVAGVILFWFLYVWATR |
| Ga0210395_104311961 | 3300020582 | Soil | MTQWLIADITCLDVHLQLWMLLVTGIISLWFVYVWATR |
| Ga0210401_106391302 | 3300020583 | Soil | WLIADVSLFDVHLQLWMLFATGIMLLWFIYVWATRLR |
| Ga0210401_106417041 | 3300020583 | Soil | MGQWLIADVSLLDVHLQLWMLLVIGIMLLWIIYVWATQLR |
| Ga0210401_107166701 | 3300020583 | Soil | MGQWLVADLSGMDVHFQLWMVLVTAILLVWFAFVWATRHVR |
| Ga0210400_100914903 | 3300021170 | Soil | MGHWLIADVSPLNVHVQLWMLLVIGIMLLWIIYVWASNCV |
| Ga0210405_104913592 | 3300021171 | Soil | MGQWLITDLSVLDIHLPLWMLLVATLILLWFVYVWATR |
| Ga0210408_110100942 | 3300021178 | Soil | MGQWLIADLSFLDIHLQLWMLLVAGVVLLWFLYVWATR |
| Ga0210396_101897141 | 3300021180 | Soil | SDGDYQVGRWLIADVSLLDVHLQLWMLLVIGIMLLWIIYVSAMQLR |
| Ga0210393_104012282 | 3300021401 | Soil | MGQWLIADLSVSDVHFQLVMLLVTGIILLWFAYVWATRWRSRRWLELLYH |
| Ga0210387_102925873 | 3300021405 | Soil | MGQWLIADLSVSDVHFHLWMLLVTGIVLLWFVYVWATRWRSRRWLELLYH |
| Ga0210387_107821653 | 3300021405 | Soil | MGQWLIADVSLFDVHVQLWMLFATGIMLLWFIYVWATRLR |
| Ga0210387_113792392 | 3300021405 | Soil | MGQWLIADLWVSEVHFQLWVLLVTGFILLWFVYVWATR |
| Ga0210383_105443291 | 3300021407 | Soil | MGQWLIADVSLFDVHLQLWMLFATGIMLLWFIYVWAT |
| Ga0210383_110951471 | 3300021407 | Soil | MGQWLIADVSLLDVHLQLWMLLVTGIMLLWIIYVWATQLR |
| Ga0210383_116209111 | 3300021407 | Soil | MGQWLIADLSVSDVHFQLWMLLVAGIIFFWFVYVWATR |
| Ga0210394_103595065 | 3300021420 | Soil | MGQWLIADVSVFDVHLQLWMLLATGIMLLWFIYVWATRLR |
| Ga0210391_109532151 | 3300021433 | Soil | MGQWLIADVSLFDIHLQLWMLFATGIMLLWFIYVWATRLR |
| Ga0210390_110069751 | 3300021474 | Soil | MTQWLIADITFLDVHLQLWMLLVTGIISLWFVCVWATR |
| Ga0126371_104224232 | 3300021560 | Tropical Forest Soil | MGQWLIADVSFLDVHIQLWMLLVVGVLLIWLAAVGATR |
| Ga0126371_114711291 | 3300021560 | Tropical Forest Soil | MREWLAADISVMDVHFQLWMVLVAAFLLGWFALVWATRHVR |
| Ga0242644_10434181 | 3300022498 | Soil | MAQWLIADISLLDLHAHLWMLLVTGIILLWFLYVWATRSRPQT |
| Ga0242644_10467711 | 3300022498 | Soil | MEHCLIVDITFLDVHLQLWMLLVTAIMSLWFVYVWVTL |
| Ga0222728_11077002 | 3300022508 | Soil | MGQWLIADVSLLDIHLQLWMLLVTGIMLLRIIYVWAT |
| Ga0242662_100747422 | 3300022533 | Soil | MGQWLIADVSLLDIHLQLWMLLVTGIMLLWIIYVWAT |
| Ga0242662_103125921 | 3300022533 | Soil | MGQWLIADVSLLGVHLQLWMLLVTGIMLLWIIYVRATKLH |
| Ga0222756_10441852 | 3300022709 | Soil | MAQWLIADISLLDVHAHLWMLLVTGIILLWFLYVWATRSRPQT |
| Ga0242678_10271481 | 3300022715 | Soil | MEHWLIVDITFLDVHLQLWMLLVTAIMSLWFVYVWVTR |
| Ga0242665_101579851 | 3300022724 | Soil | VGRWLIADVSLLDVPLQLWMLLVIGIMLLWIIYVSAMQLR |
| Ga0207706_102008161 | 3300025933 | Corn Rhizosphere | MAQWLIADVSLFDVHVQVWMLLVAGIFLSWFFFVWRQPH |
| Ga0207949_10113971 | 3300026999 | Forest Soil | REGDQQMGQWLIADVSLFDVHLQLWMLFATGIMLLWFIYVWATRLR |
| Ga0208324_10387931 | 3300027604 | Peatlands Soil | MGEWLVADLSILDVHFQAWMVLVTGFFLLWLLYAWRQAR |
| Ga0208324_11389901 | 3300027604 | Peatlands Soil | MGEWLIADLSILDVHVQAWMLLVAGFFLLWLLYVCL |
| Ga0209167_107718711 | 3300027867 | Surface Soil | MAEWLIADVPLFNIHVQLWMLLVTGLVLIWFLYAWVTR |
| Ga0209068_108316641 | 3300027894 | Watersheds | MGQWLIADLSVSDVHFQFWMLLVTAILLVWFAFVWATRHVR |
| Ga0209067_105438312 | 3300027898 | Watersheds | MGRWLVADLSVMDVHFQLWMVLVTGILLVWFLFVWATRHVR |
| Ga0209067_106297891 | 3300027898 | Watersheds | TMGQWLIADLSVSDVHVQLWMLLVTGIVLLWFLYVWATR |
| Ga0209006_102377092 | 3300027908 | Forest Soil | MAQWLIADISLLDVHVHLWMLLVTGIISLWFLYVWATRSRP |
| Ga0209583_102156111 | 3300027910 | Watersheds | MGQWLIADLSVSDVHFQLWMLLVTAILLIWFAFVWATRHVR |
| Ga0209583_105192301 | 3300027910 | Watersheds | MATMAEWLIADVPLLGVHLQLWMLLVTGIVLLWFLYVWATR |
| Ga0311339_101204123 | 3300029999 | Palsa | MGEWLIADVPLFNVHLQLWMLLVTGFILLWFAHVWTTRLR |
| Ga0311339_103457581 | 3300029999 | Palsa | MGEWLIADVSLLDVHLQLWMLLVTAIVLVWLMYAW |
| Ga0311370_113517661 | 3300030503 | Palsa | MGEWLIADVSLLDVHLQLWMLLVTAIVLVWLMYAWATR |
| Ga0311370_117024462 | 3300030503 | Palsa | MREWLIADVSLFDVHLQLWMLLVTGAVLVWFVYVWATR |
| Ga0311357_113788963 | 3300030524 | Palsa | MGEWLIADVPLFNVHLQLWMLLVTGFILLWFAHVWTT |
| Ga0310038_100700583 | 3300030707 | Peatlands Soil | MGQWLIADLSVSDVHVQLWMLLVTGIMLLWFLYVWATR |
| Ga0170824_1049219042 | 3300031231 | Forest Soil | MGQWLIADFSVSDDHFQLWMLLVATVILVWFAYVWKTRSR |
| Ga0310686_1053807413 | 3300031708 | Soil | MAEWLITDISLLDVYFQVWMLLVLGILLCWFMFVWATRSVH |
| Ga0310686_1084422252 | 3300031708 | Soil | MGQWLIADLSVADVHFQPWMLLVTGVVVFWFLYVWATR |
| Ga0310686_1125083391 | 3300031708 | Soil | TGLSVMDVHFQLWMALVAGFLLAWFVLVWTTRHAR |
| Ga0310686_1127841673 | 3300031708 | Soil | MAQWLIADISLLDVHVHLWMLLVTGIILLWFLYVWATR |
| Ga0310686_1190141663 | 3300031708 | Soil | MGQWLVADLSVMDVHFQVWMVLVTAILLVWFAFVSATRQVR |
| Ga0306917_113722081 | 3300031719 | Soil | MGQWLIADVSLFGVHLQFWMLLVTAVFLLWFIYVWATR |
| Ga0247548_1066451 | 3300031814 | Soil | MAEWLITDISLLDVYFQVWMLLVLGILLCWFMFVWA |
| Ga0307478_107410921 | 3300031823 | Hardwood Forest Soil | MGQWLIADIALLDAHLQLWMVLVTGIILLWFIYVCATR |
| Ga0306925_107557783 | 3300031890 | Soil | MRQWLIADVSFLDIHLQLWMLLVAGVVLLWCLYVWATR |
| Ga0306925_121460682 | 3300031890 | Soil | IADVSFLDVHVQLWMVLVVMVFLLWFFYVWANRKP |
| Ga0306924_114454541 | 3300032076 | Soil | MGQWLIADVSLFDVHVQVWMLLVTAVILLWFIYVWATR |
| Ga0311301_102583592 | 3300032160 | Peatlands Soil | MGQWLIADISVLDVHFHLWMLLVTGIMLLWFVYVWATR |
| Ga0311301_103200145 | 3300032160 | Peatlands Soil | MAEWLIADVPLFDVHLQVWMLLVTGAVLIWFVYVWVTR |
| Ga0311301_107446802 | 3300032160 | Peatlands Soil | MAQWLIADISLLDVHAHLWMLLVTGIISIWFLYVWATRSRP |
| Ga0311301_111816392 | 3300032160 | Peatlands Soil | MTQWLIANITFLDVHLQLWMLLVTGIISLWFVYVWATR |
| Ga0311301_114609772 | 3300032160 | Peatlands Soil | MAEWLIADVPVFDVHLQVWMLLVAGVLLCWLGYVWATRSMN |
| Ga0311301_124624691 | 3300032160 | Peatlands Soil | MGEWLIADVSLLDVHCQLWMLLVTSFVFLWFLYVWATR |
| Ga0307471_1029402781 | 3300032180 | Hardwood Forest Soil | VWFGRGNMGRWLVADLSVMDVHFQLWMVLVTGILLVWFLFVWATRHVR |
| Ga0306920_1028804423 | 3300032261 | Soil | MGQWLITDPSVSDVHFQLWMLLLAAFILLWFVYVWATR |
| Ga0335074_101455041 | 3300032895 | Soil | MAEWLIADITLRGVHLQVWTLLVAGFMVVWFLYAWATR |
| ⦗Top⦘ |