


| Basic Information | |
|---|---|
| Family ID | F031204 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRQYLQYF |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.91 % |
| % of genes from short scaffolds (< 2000 bps) | 90.16 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.175 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.497 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.776 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.820 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF06071 | YchF-GTPase_C | 83.06 |
| PF00730 | HhH-GPD | 2.73 |
| PF01794 | Ferric_reduct | 1.09 |
| PF05635 | 23S_rRNA_IVP | 0.55 |
| PF13432 | TPR_16 | 0.55 |
| PF05875 | Ceramidase | 0.55 |
| PF01939 | NucS | 0.55 |
| PF14559 | TPR_19 | 0.55 |
| PF01361 | Tautomerase | 0.55 |
| PF01926 | MMR_HSR1 | 0.55 |
| PF00999 | Na_H_Exchanger | 0.55 |
| PF04542 | Sigma70_r2 | 0.55 |
| PF12840 | HTH_20 | 0.55 |
| PF02518 | HATPase_c | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 83.06 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.73 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 2.73 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 2.73 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 2.73 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 2.73 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.55 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.55 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.55 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.55 |
| COG1637 | Endonuclease NucS, RecB family | Replication, recombination and repair [L] | 0.55 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.55 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.55 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.55 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.55 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.55 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.17 % |
| Unclassified | root | N/A | 3.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1021999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 892 | Open in IMG/M |
| 3300001593|JGI12635J15846_10861138 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100696394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 894 | Open in IMG/M |
| 3300004633|Ga0066395_10590515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 650 | Open in IMG/M |
| 3300005172|Ga0066683_10454558 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005175|Ga0066673_10055919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 2005 | Open in IMG/M |
| 3300005178|Ga0066688_10527780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300005181|Ga0066678_10254330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1137 | Open in IMG/M |
| 3300005187|Ga0066675_10177407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1482 | Open in IMG/M |
| 3300005332|Ga0066388_108152637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300005439|Ga0070711_100273571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1333 | Open in IMG/M |
| 3300005468|Ga0070707_100640130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1026 | Open in IMG/M |
| 3300005468|Ga0070707_102188618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 520 | Open in IMG/M |
| 3300005541|Ga0070733_10639670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 714 | Open in IMG/M |
| 3300005542|Ga0070732_10854517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 555 | Open in IMG/M |
| 3300005545|Ga0070695_100189221 | All Organisms → cellular organisms → Bacteria | 1463 | Open in IMG/M |
| 3300005569|Ga0066705_10074591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1965 | Open in IMG/M |
| 3300005591|Ga0070761_10753050 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005607|Ga0070740_10201580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300006173|Ga0070716_101609485 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 534 | Open in IMG/M |
| 3300006794|Ga0066658_10131244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300006797|Ga0066659_10422327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300006797|Ga0066659_11576215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300006800|Ga0066660_10533263 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300006800|Ga0066660_11419984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 544 | Open in IMG/M |
| 3300006804|Ga0079221_11083659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 611 | Open in IMG/M |
| 3300006806|Ga0079220_10637129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 767 | Open in IMG/M |
| 3300006903|Ga0075426_11397154 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300006953|Ga0074063_12135811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 728 | Open in IMG/M |
| 3300007255|Ga0099791_10322378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 738 | Open in IMG/M |
| 3300007255|Ga0099791_10534840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 570 | Open in IMG/M |
| 3300007258|Ga0099793_10045242 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1925 | Open in IMG/M |
| 3300009038|Ga0099829_10085353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2427 | Open in IMG/M |
| 3300009088|Ga0099830_10177530 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300009089|Ga0099828_11148041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 690 | Open in IMG/M |
| 3300009143|Ga0099792_11008183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 556 | Open in IMG/M |
| 3300009646|Ga0116132_1004918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6501 | Open in IMG/M |
| 3300009792|Ga0126374_11850272 | Not Available | 506 | Open in IMG/M |
| 3300010047|Ga0126382_12523634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300010048|Ga0126373_10223304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1839 | Open in IMG/M |
| 3300010048|Ga0126373_11402706 | Not Available | 764 | Open in IMG/M |
| 3300010325|Ga0134064_10338678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 584 | Open in IMG/M |
| 3300010358|Ga0126370_10384257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300010358|Ga0126370_12157691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 548 | Open in IMG/M |
| 3300010359|Ga0126376_10739085 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 952 | Open in IMG/M |
| 3300010361|Ga0126378_11935281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300010376|Ga0126381_101811240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300010398|Ga0126383_13239828 | Not Available | 532 | Open in IMG/M |
| 3300011269|Ga0137392_10264512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
| 3300011271|Ga0137393_10664636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300011271|Ga0137393_11711136 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012096|Ga0137389_10197519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1673 | Open in IMG/M |
| 3300012096|Ga0137389_11222545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300012189|Ga0137388_11943911 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 517 | Open in IMG/M |
| 3300012198|Ga0137364_10772271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 726 | Open in IMG/M |
| 3300012203|Ga0137399_10896094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 747 | Open in IMG/M |
| 3300012206|Ga0137380_10576973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300012207|Ga0137381_11565141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 550 | Open in IMG/M |
| 3300012210|Ga0137378_10669949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 948 | Open in IMG/M |
| 3300012351|Ga0137386_11261519 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 514 | Open in IMG/M |
| 3300012361|Ga0137360_10039749 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300012361|Ga0137360_11867849 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 506 | Open in IMG/M |
| 3300012362|Ga0137361_11149555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012363|Ga0137390_10622966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1045 | Open in IMG/M |
| 3300012363|Ga0137390_11005720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300012582|Ga0137358_11105413 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300012683|Ga0137398_10014428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4118 | Open in IMG/M |
| 3300012685|Ga0137397_10780567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300012923|Ga0137359_10506933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300012924|Ga0137413_10227284 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300012925|Ga0137419_11620050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 551 | Open in IMG/M |
| 3300012929|Ga0137404_11733410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 580 | Open in IMG/M |
| 3300012930|Ga0137407_10055339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3242 | Open in IMG/M |
| 3300012930|Ga0137407_10484482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300012930|Ga0137407_10618027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1018 | Open in IMG/M |
| 3300012957|Ga0164303_11350615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 530 | Open in IMG/M |
| 3300015241|Ga0137418_11255174 | Not Available | 518 | Open in IMG/M |
| 3300016319|Ga0182033_11719724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 568 | Open in IMG/M |
| 3300016341|Ga0182035_10640093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300016404|Ga0182037_11357091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300016445|Ga0182038_11997073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 525 | Open in IMG/M |
| 3300017823|Ga0187818_10410281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300017955|Ga0187817_10086538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1962 | Open in IMG/M |
| 3300017955|Ga0187817_10379050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 902 | Open in IMG/M |
| 3300017993|Ga0187823_10375796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 512 | Open in IMG/M |
| 3300018006|Ga0187804_10311925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300018012|Ga0187810_10383706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300018085|Ga0187772_10926081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
| 3300018086|Ga0187769_11273900 | Not Available | 556 | Open in IMG/M |
| 3300018468|Ga0066662_11764501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 648 | Open in IMG/M |
| 3300018468|Ga0066662_12190491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300020199|Ga0179592_10265162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300020580|Ga0210403_10668846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300020580|Ga0210403_10815282 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300020583|Ga0210401_10190871 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300020583|Ga0210401_11495951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 532 | Open in IMG/M |
| 3300021086|Ga0179596_10077359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1460 | Open in IMG/M |
| 3300021086|Ga0179596_10270878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
| 3300021171|Ga0210405_11378963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 514 | Open in IMG/M |
| 3300021178|Ga0210408_10114525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2124 | Open in IMG/M |
| 3300021401|Ga0210393_10758429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 790 | Open in IMG/M |
| 3300021401|Ga0210393_10780411 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300021401|Ga0210393_11474049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 542 | Open in IMG/M |
| 3300021402|Ga0210385_10680632 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 787 | Open in IMG/M |
| 3300021402|Ga0210385_11266480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 565 | Open in IMG/M |
| 3300021405|Ga0210387_10716685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 886 | Open in IMG/M |
| 3300021405|Ga0210387_11804258 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021420|Ga0210394_10352272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1293 | Open in IMG/M |
| 3300021420|Ga0210394_11803744 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300021432|Ga0210384_10892758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 789 | Open in IMG/M |
| 3300021432|Ga0210384_11803516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 517 | Open in IMG/M |
| 3300021433|Ga0210391_10214278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1514 | Open in IMG/M |
| 3300021478|Ga0210402_10553963 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300021479|Ga0210410_10362160 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300021479|Ga0210410_11649418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 535 | Open in IMG/M |
| 3300021559|Ga0210409_10186425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1893 | Open in IMG/M |
| 3300024224|Ga0247673_1069372 | Not Available | 519 | Open in IMG/M |
| 3300024288|Ga0179589_10594871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 518 | Open in IMG/M |
| 3300025898|Ga0207692_11159585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300025905|Ga0207685_10423482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300025934|Ga0207686_10909735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 710 | Open in IMG/M |
| 3300026281|Ga0209863_10183998 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026297|Ga0209237_1030585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2944 | Open in IMG/M |
| 3300026300|Ga0209027_1265746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300026310|Ga0209239_1361568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 509 | Open in IMG/M |
| 3300026320|Ga0209131_1074507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1845 | Open in IMG/M |
| 3300026333|Ga0209158_1053743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1636 | Open in IMG/M |
| 3300026334|Ga0209377_1048821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1904 | Open in IMG/M |
| 3300026482|Ga0257172_1087245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 573 | Open in IMG/M |
| 3300026551|Ga0209648_10067266 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300026555|Ga0179593_1013575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2140 | Open in IMG/M |
| 3300027024|Ga0207819_1017821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300027090|Ga0208604_1020728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 624 | Open in IMG/M |
| 3300027381|Ga0208983_1048138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 826 | Open in IMG/M |
| 3300027516|Ga0207761_1048787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300027660|Ga0209736_1044131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1285 | Open in IMG/M |
| 3300027667|Ga0209009_1008202 | All Organisms → cellular organisms → Bacteria | 2497 | Open in IMG/M |
| 3300027773|Ga0209810_1039088 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2655 | Open in IMG/M |
| 3300027829|Ga0209773_10071164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1420 | Open in IMG/M |
| 3300027842|Ga0209580_10044308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
| 3300027846|Ga0209180_10443799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300027853|Ga0209274_10203832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300027862|Ga0209701_10247765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1043 | Open in IMG/M |
| 3300027862|Ga0209701_10483429 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027879|Ga0209169_10023537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3307 | Open in IMG/M |
| 3300027889|Ga0209380_10339864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300027908|Ga0209006_10528672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 981 | Open in IMG/M |
| 3300028020|Ga0265351_1016083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300028381|Ga0268264_10815141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
| 3300030848|Ga0075388_11374407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300030848|Ga0075388_11663190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300030854|Ga0075385_11685264 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300031231|Ga0170824_104543525 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3532 | Open in IMG/M |
| 3300031231|Ga0170824_117403788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 504 | Open in IMG/M |
| 3300031573|Ga0310915_10471112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 892 | Open in IMG/M |
| 3300031640|Ga0318555_10729649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031708|Ga0310686_114701328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3333 | Open in IMG/M |
| 3300031718|Ga0307474_10941663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 684 | Open in IMG/M |
| 3300031747|Ga0318502_10490204 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300031751|Ga0318494_10459405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300031754|Ga0307475_10360353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300031796|Ga0318576_10094339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
| 3300031820|Ga0307473_10230670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
| 3300031823|Ga0307478_10521363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
| 3300031823|Ga0307478_11179033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300031833|Ga0310917_10533030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300031879|Ga0306919_10738900 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300031945|Ga0310913_10694777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
| 3300031945|Ga0310913_10959844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_54_10 | 600 | Open in IMG/M |
| 3300031954|Ga0306926_10549785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1414 | Open in IMG/M |
| 3300031962|Ga0307479_10671995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 1016 | Open in IMG/M |
| 3300031962|Ga0307479_11119731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 753 | Open in IMG/M |
| 3300032035|Ga0310911_10320979 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300032180|Ga0307471_102276587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 683 | Open in IMG/M |
| 3300032261|Ga0306920_102047114 | Not Available | 801 | Open in IMG/M |
| 3300032782|Ga0335082_10128741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2476 | Open in IMG/M |
| 3300032782|Ga0335082_10982400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300032783|Ga0335079_11082925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_3_58_11 | 812 | Open in IMG/M |
| 3300032829|Ga0335070_10264437 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300032955|Ga0335076_10017866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7117 | Open in IMG/M |
| 3300033004|Ga0335084_10522585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
| 3300033289|Ga0310914_10773972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300033402|Ga0326728_10778709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.83% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.83% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.28% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.64% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030848 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030854 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10219992 | 3300001154 | Forest Soil | MAHDLAFRTGLAALLGLIAAAGNLLGGYFVVRRDWPRQYLQYFLALGAGY |
| JGI12635J15846_108611382 | 3300001593 | Forest Soil | MIHELSFRIALAALLGLIAAGGNLLGGYFVVYREWPRRYL |
| JGIcombinedJ26739_1006963941 | 3300002245 | Forest Soil | MANEGTRIALAAVLGLIAAAGNLAGGYFVVRRDWPRQFLQYFLALGAG |
| Ga0066395_105905152 | 3300004633 | Tropical Forest Soil | MGHDVAFRIGLAALLGLVAALGNLLGGYFVVRKDWPRKYLQYFLALGAGY |
| Ga0066683_104545582 | 3300005172 | Soil | MSSPLSIRIATAAALGLIAAAGNLLGGYFVVRREWPRQFLQYFVAF |
| Ga0066673_100559193 | 3300005175 | Soil | LHGLKPVLLAMEHDLGFRTALAAGLGLVAAAGNLIGGYFVVHKDWPRKFLQ |
| Ga0066688_105277802 | 3300005178 | Soil | MAMGHDLAFRTALAAGLGLVAAAGNLVGGYFVVHKDWPRKFLQYFL |
| Ga0066678_102543301 | 3300005181 | Soil | MSSPLSIRIATAAALGLIAAAGNLLGGYFVVRREWPRQFLQ |
| Ga0066675_101774071 | 3300005187 | Soil | MEHDVAFRTGLAVLLGLLAALGNLLGGYFVVRRDWPRQFLHYF |
| Ga0066388_1081526371 | 3300005332 | Tropical Forest Soil | MTADATRTILAAILGLLAAAGNLLGGYFVVRKDWPRHFLQYFLA |
| Ga0070711_1002735712 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYFLALG |
| Ga0070707_1006401301 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MENQEAVRIVLAAVLGLVAAGGNLLGGYFVVRKEWPRKFLQYF |
| Ga0070707_1021886181 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHDLAFRTALAAGLGLVAAAGNLLGGYFVVRKEWPRQFLQYF |
| Ga0070733_106396702 | 3300005541 | Surface Soil | MNHDLAFRTGVAALLGLVAAAGNLLGGYFVIRKDWPRKYLHYFVA |
| Ga0070732_108545171 | 3300005542 | Surface Soil | MGNELAIRTVLAAALGLVAAAGNLIGGYFVVRRDWPRQ |
| Ga0070695_1001892211 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLSQAMGHDIAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRR |
| Ga0066705_100745913 | 3300005569 | Soil | LRATPSWIEGLHRLKPVPLAMGHDLTFRTALAAGLGLVAAAGNLVGGYFVVRRDWPRKYLQYFLA |
| Ga0070761_107530501 | 3300005591 | Soil | MGHDLAFRTGLAAGLGLVAAAGNLIGGYFVVRRDWPRKYLQYFL |
| Ga0070740_102015801 | 3300005607 | Surface Soil | MNHELAFRTALAAGLGIVAAAGNLLGGYFVVYRNW |
| Ga0070716_1016094852 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLNMGHDLAFRTALAAGLGLVAAAGNLIGGYFVV |
| Ga0066658_101312441 | 3300006794 | Soil | PVLLAMGHDLGFRTALAAGLVLVAAAGNLICGYSVVHKAWPR* |
| Ga0066659_104223271 | 3300006797 | Soil | MGHDVAFRTGLAALLGLVAALGNLLGGYFVVRKHWP |
| Ga0066659_115762152 | 3300006797 | Soil | MVHSETARVGMAAGLGLVAAAGNLLGGYFVVRRDWPRRFLNYFVA |
| Ga0066660_105332631 | 3300006800 | Soil | LRDTPRWIEGLHRLKPVPLAMGHDLTFRTALAVGLGLVAAAGNLVGGYFVVRRDWPRKYLQYFLAL |
| Ga0066660_114199842 | 3300006800 | Soil | MEHDIAFRTGLAALLGLVAAAGNLVGGYFVVRKHWPRQY |
| Ga0079221_110836592 | 3300006804 | Agricultural Soil | MKDEAVRIAAAAILGIVAAGGNLLGGYFVVRKDWPQ |
| Ga0079220_106371291 | 3300006806 | Agricultural Soil | VPVAMGHDLAFRTGLATGLGLVAAAGNLVGGYFVVRRDWPRKY |
| Ga0075426_113971542 | 3300006903 | Populus Rhizosphere | MGNTEAVRIGLAAVLGLVAAGGNLLGGYFVVRRDWPRKYLQYFLALGAG |
| Ga0074063_121358112 | 3300006953 | Soil | MENSQAVRIGLAAALGIVAAGGNLLGGYFVVRKEWPRKYLQYFLALGA |
| Ga0099791_103223781 | 3300007255 | Vadose Zone Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRKDWPRQFLQYFLALGA |
| Ga0099791_105348401 | 3300007255 | Vadose Zone Soil | MGHDVAFRTALAAGLGLVAAAGNLVGGYFVVRRNWPRKFLGYFLALGA |
| Ga0099793_100452421 | 3300007258 | Vadose Zone Soil | MGHDLAFRTGLAAGLGLIAAAGNLVGGYFVVHKEWPRKFLQYFLAL |
| Ga0099829_100853531 | 3300009038 | Vadose Zone Soil | MLPDMTHDLAFRTALAAGLGLVAAAGNLAGGYFVVRKEWPRQYLQYFLALG |
| Ga0099830_101775303 | 3300009088 | Vadose Zone Soil | MGHDLAFRTALAAGLGLVAAAGNLAGGYFVVRKDWPRQ |
| Ga0099828_111480412 | 3300009089 | Vadose Zone Soil | MAHDLAFRTALAAGLGLLAAAGNLIGGYFVVHKEWPRKFLQYFL |
| Ga0099792_110081831 | 3300009143 | Vadose Zone Soil | MGHDVAFRTALAAGLGLVAAAGNLIGGYFVVRREWPRKFLQYFLAL |
| Ga0116132_10049188 | 3300009646 | Peatland | MIHELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYFLAL |
| Ga0126374_118502722 | 3300009792 | Tropical Forest Soil | MEHDAALRTTLAALLGLVAAVGNLLGGYFVVRKEWPRQYLQYFLALGAG |
| Ga0126382_125236341 | 3300010047 | Tropical Forest Soil | MMAQDVAFRVTLAALLGLVAAAGNLLGGYFVVRKDWPR |
| Ga0126373_102233041 | 3300010048 | Tropical Forest Soil | LHRELPIRIALAAILGLIAAAGNLIGGYFVVYREWPRRFLQYFLALGA |
| Ga0126373_114027062 | 3300010048 | Tropical Forest Soil | MGHDEAFRTGLAALLGLLAALGNLLGGYFVVRKHWPRQYLQYFLALGAG |
| Ga0134064_103386781 | 3300010325 | Grasslands Soil | MEHDVAFRTGLAALLGLVAALGNLLGGYFVVRKHWPRQY |
| Ga0126370_103842572 | 3300010358 | Tropical Forest Soil | MGLEVAFRTGLAALLGLVAALGNLLGGYFVVCTEW |
| Ga0126370_121576911 | 3300010358 | Tropical Forest Soil | MMHDSAFRTALASGLGLVAAAANLLGGYFVVRRDWSRRV |
| Ga0126376_107390851 | 3300010359 | Tropical Forest Soil | MGLEVAFRTGLAALLGLVAALGNLLGGYFVVRKEWPR |
| Ga0126378_119352811 | 3300010361 | Tropical Forest Soil | MTHDLSFRIALAALLGLIAAAGNVIGGYFVVRGEWPRK |
| Ga0126381_1018112402 | 3300010376 | Tropical Forest Soil | MTHELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQ |
| Ga0126383_132398281 | 3300010398 | Tropical Forest Soil | MGDDVTFRTGLAALLGLVAALGNLVGGYFVVRKHW |
| Ga0137392_102645122 | 3300011269 | Vadose Zone Soil | MENTETASMGWAAVLGLVAAGGNLLGGYFVVRREW |
| Ga0137393_106646362 | 3300011271 | Vadose Zone Soil | MIHELSFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYFLALG |
| Ga0137393_117111362 | 3300011271 | Vadose Zone Soil | VPLVMGHDLAFRTGLAAGLGLVAAAGNLVGGYFVVHREWPR |
| Ga0137389_101975193 | 3300012096 | Vadose Zone Soil | MSHDLSFRIALAALLGLIAAGGNLLGGYFVVYREWPRRYLQ |
| Ga0137389_112225452 | 3300012096 | Vadose Zone Soil | MTNEATRVVLAAGLGLVAAAGNLLGGYFVVRRDWPRQFLQYFLAL |
| Ga0137388_119439111 | 3300012189 | Vadose Zone Soil | MAHDLAFRTALAAGLGLLAAAGNLIGGYFVVHKEWPRKFLQ |
| Ga0137364_107722711 | 3300012198 | Vadose Zone Soil | MGHDLGFRTALAAGLGLVAAAGNLIGGYFVVHKDWRRKFLQYFL |
| Ga0137399_108960942 | 3300012203 | Vadose Zone Soil | MGYDLAFRTALAAGLGLVAAAGNLIGGYFVVRKDWPR |
| Ga0137380_105769732 | 3300012206 | Vadose Zone Soil | MAHSSETRSVLAIILGLTAASANVLGGYFVVRREWPRHFLKYFLALG |
| Ga0137381_115651412 | 3300012207 | Vadose Zone Soil | MGHDVAFRMALAAGLGLVAAAGNLLGGYFVVRKEWPRQFLQYFLAL |
| Ga0137378_106699491 | 3300012210 | Vadose Zone Soil | MAHDLAFRTGVAALLGLVAAAGNLIGGYFVVRKDWPRQ |
| Ga0137386_112615192 | 3300012351 | Vadose Zone Soil | MGHDVAFRTGLAALLGLVAAAGNLLGGYFVVRKEWPRQYLQY |
| Ga0137360_100397491 | 3300012361 | Vadose Zone Soil | MGHDLAFRTTLAAGLGLIAAAGNLVGGYFVVHKEWPRKFLQYFLAL |
| Ga0137360_118678491 | 3300012361 | Vadose Zone Soil | MEHDLAMRTAMAAGLGLVAAAGNLLGGYFVVRKDSPRQYLQYFLALGAG* |
| Ga0137361_111495551 | 3300012362 | Vadose Zone Soil | MTHDLATRVALAAGLGLVAAAGNLIGGYFVVRRDWPRQYLQYFLAL |
| Ga0137390_106229663 | 3300012363 | Vadose Zone Soil | MGHDLAFRTGLAAGLGLVAAAGNLVGGYFVVRKDWPRKFLQ |
| Ga0137390_110057201 | 3300012363 | Vadose Zone Soil | MLLDMTHDLAFRTALAAGLGLVAAAGNLAGGYFVVRKDWP |
| Ga0137358_111054132 | 3300012582 | Vadose Zone Soil | MVNTEAMRMGWAAVLGLVAAGGNLLGGYFVVRKEWPRKFLQYFLA |
| Ga0137398_100144281 | 3300012683 | Vadose Zone Soil | MGHDLAFRTALAAGLGLVAAAGNLVGGYFVVHKEWPRKFLQY |
| Ga0137397_107805671 | 3300012685 | Vadose Zone Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVIRRDWPRQFLQYF |
| Ga0137359_105069331 | 3300012923 | Vadose Zone Soil | MGNQEALRIGLAAILGLVAAGGNLLGGYFVVRKEWPRRFLQYF |
| Ga0137413_102272843 | 3300012924 | Vadose Zone Soil | MHTLAFRMGLAALLGLMAAAGNLIGGYFVVRGDWSRKYLQ |
| Ga0137419_116200502 | 3300012925 | Vadose Zone Soil | MIHELSFRVALAALLGLIAAGGNLLGGYFVVSREWPRP |
| Ga0137404_117334101 | 3300012929 | Vadose Zone Soil | MAHDLAFRTALAAGLGLVAAAGNLIGGYFVVRKDWPRQ |
| Ga0137407_100553391 | 3300012930 | Vadose Zone Soil | MAHDLAFRTALAAGLGLVAAAGNLIGGYFVVRKEWPRRV |
| Ga0137407_104844821 | 3300012930 | Vadose Zone Soil | MAHDLAFRTALAAGLGLVAAAGNLIGGYFVVRKDWPRQFLQYFLALGA |
| Ga0137407_106180272 | 3300012930 | Vadose Zone Soil | MIHELSFRIALAALLGLVAAGGNLLGGYFVVYREWP |
| Ga0164303_113506151 | 3300012957 | Soil | MAHDLAFRTALAAGLGLVAAAGNLIGGYFVIRKDWPRQFL |
| Ga0137418_112551741 | 3300015241 | Vadose Zone Soil | MIHELPARVGMAAGLGVVAAAGNLLGGLFVVRRDWPRRFLHYFMALGA |
| Ga0182033_117197241 | 3300016319 | Soil | MSHDLAFRTALAGLLGLVAAGGNVLGGYFVVRREW |
| Ga0182035_106400931 | 3300016341 | Soil | LTRQLRTYNLMSHDLAFRTALAGLLGLVAAGGNVLGGYFVVRREWP |
| Ga0182037_113570912 | 3300016404 | Soil | MSHDLAFRTVLAGLLGLVAAGGNVLGGYFVVRREWPRK |
| Ga0182038_119970731 | 3300016445 | Soil | MSHDLAFRTALAALLGLVAAGGNVLGGYFVVRREWPRKYLQYFLA |
| Ga0187818_104102812 | 3300017823 | Freshwater Sediment | MTHDLPFRIALAALLGLVAAGGNVLGGYFVVRREWPRRYLQ |
| Ga0187817_100865381 | 3300017955 | Freshwater Sediment | MAHDLAFRTALAAGLGLVAAAGNLLGGYFVVRGEWPRKYLQYFLA |
| Ga0187817_103790501 | 3300017955 | Freshwater Sediment | MGHDLAFRTALAAGLGLVAAAGNLLGGYFVVRGEWPRKYLQY |
| Ga0187823_103757961 | 3300017993 | Freshwater Sediment | MGHDLAFRTGLAAGLGLVAAAGNLVGGYFVVRRDWPRRYLQY |
| Ga0187804_103119252 | 3300018006 | Freshwater Sediment | MAHDLSFRIALAAFLGLIAAAGNVLGGYFVVRREWPRKYLQYFVALGA |
| Ga0187810_103837061 | 3300018012 | Freshwater Sediment | MTHDLPFRIALAALLGLDAAGGNVLGGYFVVRREWPRR |
| Ga0187772_109260812 | 3300018085 | Tropical Peatland | MTHELPFRIALAALLGLIAAGGNLLGGYFVVYRNWPRRYLQYFLA |
| Ga0187769_112739001 | 3300018086 | Tropical Peatland | MYHDLSFRIALAALLGLIAAAGNVIGGYFVVRREWPRKYLQYFVALGA |
| Ga0066662_117645012 | 3300018468 | Grasslands Soil | VPLAMGHDVTFRTALVAGLGLVAAAGNLVGGYFVVR |
| Ga0066662_121904911 | 3300018468 | Grasslands Soil | MAHWSETRSVLAIVLGLTAASANVLGGYFVVRREWPRHFLKYFLAL |
| Ga0179592_102651622 | 3300020199 | Vadose Zone Soil | MGHDLTFRTLLAVGLGLVAAAGNLIGGYFVVHREWPRKF |
| Ga0210403_106688461 | 3300020580 | Soil | MGHDLAFRTALAAGLGLVAAAGNLVGGYFVVRRDWP |
| Ga0210403_108152821 | 3300020580 | Soil | VRLNMAHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRQYLQYFLAI |
| Ga0210401_101908715 | 3300020583 | Soil | MTHDLAFRTGLAAGLGLVAAAGNLIGGYFVVRRDWPRRFLQY |
| Ga0210401_114959511 | 3300020583 | Soil | MIHELSFRVALAALLGLIAAGGNLLGGYFVVYREWPRRYLQYF |
| Ga0179596_100773591 | 3300021086 | Vadose Zone Soil | MGHDLAFRTGLAAGLGLVAAAGNLVGGYFVVHREWPRK |
| Ga0179596_102708781 | 3300021086 | Vadose Zone Soil | VPLAMEHDLAMRTAMAAGLGLVAAAGNLLGGYFVVRKDWPRQY |
| Ga0210405_113789632 | 3300021171 | Soil | MGHDLAFRTALAAGLGLVAAAGNLVGGYFVVRRDWPRKYLQY |
| Ga0210408_101145251 | 3300021178 | Soil | MGHDLAFRTTLAAGLGLIAAAGNLVGGYFVVHKEWPRKFLQY |
| Ga0210393_107584291 | 3300021401 | Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRQYLQYF |
| Ga0210393_107804111 | 3300021401 | Soil | VLLIAEMSNDLALRTALAAFLGLIAAGGNLLGGYFVVYREWPRRYLQYFLALG |
| Ga0210393_114740491 | 3300021401 | Soil | VPLKMGHDLAFRVGLAAGLGLVAAAGNLVGGYFVVRRDWPRRYLQYFLALGA |
| Ga0210385_106806322 | 3300021402 | Soil | MHSLAFRTGLAALLGLMAAAGNLIGGYFVVRKDWSRKYLQYFLALGAGY |
| Ga0210385_112664802 | 3300021402 | Soil | MGHDLAFQTALAAGLGLVAAAGNLIGGYFVVRRDWPRKYLQYF |
| Ga0210387_107166851 | 3300021405 | Soil | MGHDLAFRTGLAALLGLMAAAGNLIGGYFVVRKDWSRKY |
| Ga0210387_118042582 | 3300021405 | Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWP |
| Ga0210394_103522722 | 3300021420 | Soil | MGHELSFRIALAALLGLIAAGGNLLGGYFVVYREWPRR |
| Ga0210394_118037442 | 3300021420 | Soil | MIHELSFRVALAALLGLIAAGGNLLGGYFVVYREWPRRYLQYFLAL |
| Ga0210384_108927582 | 3300021432 | Soil | MIRDLAFRTGLAAALGLVAATGNLIGGYFVVRRDWSRQ |
| Ga0210384_118035162 | 3300021432 | Soil | MTHELSFRVALAAILGLVAGGGNLLGGYFVVRRDWPRQY |
| Ga0210391_102142781 | 3300021433 | Soil | MGHDLAFRTALAAGLGLVAAAGNLVGGYFVVRRDWPRKYLQYF |
| Ga0210402_105539633 | 3300021478 | Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRQFLQYFL |
| Ga0210410_103621601 | 3300021479 | Soil | VLLIAEMSNDLALRTALAAFLGLIAAGGNLLGGYFVVYREWPRRYLQYFLA |
| Ga0210410_116494182 | 3300021479 | Soil | MSHDLAFRTALAGGLGLVAAAGNLLGGYFVVHREWSRKVLQYF |
| Ga0210409_101864252 | 3300021559 | Soil | MAHDLAFRAGLAALLGLIAAAGNLIGGYFVVRRDWPRQYLQYF |
| Ga0247673_10693722 | 3300024224 | Soil | MAHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRRYLQYFLALG |
| Ga0179589_105948712 | 3300024288 | Vadose Zone Soil | MHELSARVGMAAGQGVVAAAGNLIGGLIVVRRAWPRQ |
| Ga0207692_111595851 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTHELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYF |
| Ga0207685_104234821 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MGNQEALRIGLAAILGLVAAGGNLLGGYFVVRKEWPRR |
| Ga0207686_109097351 | 3300025934 | Miscanthus Rhizosphere | MVHDETTRVGMAAGLGLVAAAGNLLGGYFVVRRDWPRQFLNYFVA |
| Ga0209863_101839982 | 3300026281 | Prmafrost Soil | MQHELTFRIALASALGVVAGGGNLLGGYFVVYREWPRKYLQY |
| Ga0209237_10305851 | 3300026297 | Grasslands Soil | MGHDVTFRTALAAGLGLVAAAGNLLGGYFVVRKDWPRQSLQ |
| Ga0209027_12657462 | 3300026300 | Grasslands Soil | LRATPSWIEGLHRLKPVPLAMGHDLTFRTALAAGLGLVAAAGNLVGGYFVVRRDWPRK |
| Ga0209239_13615681 | 3300026310 | Grasslands Soil | LRRLKPVPLAMEHDLAMRTAMAAGLGLVAAAGNLLGGYFVVRKDWPRQYLQYFLA |
| Ga0209131_10745073 | 3300026320 | Grasslands Soil | MNHELSARVGLAAGLGIVAAAGNLIGGLFLVQRAW |
| Ga0209158_10537431 | 3300026333 | Soil | MGHDVAFRTALAAGLGLVAAAGNLVGGYFVVRRNWPRK |
| Ga0209377_10488211 | 3300026334 | Soil | LHRLKPVPLAMGHDLTFRTALAAGLGLVAAAGNLVGGYFVVRRDWPRKYLQYFLAL |
| Ga0257172_10872451 | 3300026482 | Soil | MNHELPARVGMAAGLGVVAAAGNLLGGLFVVRRDWP |
| Ga0209648_100672664 | 3300026551 | Grasslands Soil | MKRSLLLPMTSDLAFRTGIAALLGLVAAAGNLIGGYFVVRRDWPRQFLQYF |
| Ga0179593_10135751 | 3300026555 | Vadose Zone Soil | MHSLAFRTGLAALLGLMAAAGKLIGGYFVIRRIGR |
| Ga0207819_10178212 | 3300027024 | Tropical Forest Soil | MMNELPFRIALAALLGLVAAAGNVIGGYFVVRREWPRKYLEYFVA |
| Ga0208604_10207282 | 3300027090 | Forest Soil | VPLAMGHDLGFRTALAAGLGLVAAAGNLIGGYFVVRRDWPQRYLQYFLA |
| Ga0208983_10481382 | 3300027381 | Forest Soil | MPHPDSTRIALAAVLGLVAAGGNLLGGYFVVYRNWQRRNLQYFVA |
| Ga0207761_10487871 | 3300027516 | Tropical Forest Soil | MLHELSSRLALAIALGLVAGAGNLLGGYFVVYRQW |
| Ga0209736_10441312 | 3300027660 | Forest Soil | MIHELSFRIALAALLGLIAAGGNLLGGYFVVYREWPRRYLQYFLAL |
| Ga0209009_10082021 | 3300027667 | Forest Soil | MPHTDSTRVALAAILGLVAAGGNLLGGYFVVYRNWQRRYLQYFV |
| Ga0209810_10390881 | 3300027773 | Surface Soil | MKDEAIRIAMAAALGVVAAGGNLLGGYFVVRRDWPRKFLHYFLSLGAGYMLAVAFAE |
| Ga0209773_100711642 | 3300027829 | Bog Forest Soil | LIDQELATRTALAAGLGLVAAGGNLLGGYFVIHKNWPRKYLQYF |
| Ga0209580_100443081 | 3300027842 | Surface Soil | MGHDLAFRTGLAAGLGLVAAAGNLIGGYFVVRRDWPR |
| Ga0209180_104437991 | 3300027846 | Vadose Zone Soil | MTHELSFRIALAALLGLVAAAGNLLGGYFVVFREWPR |
| Ga0209274_102038321 | 3300027853 | Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRK |
| Ga0209701_102477652 | 3300027862 | Vadose Zone Soil | LRPRVAAEMERLHRLKFVLLAMGHDVALRTALAAGLGLVAAAGNLVGGYFVVRRDWPR |
| Ga0209701_104834291 | 3300027862 | Vadose Zone Soil | MGHDLAFRTALAAGLGLVAAAGNLVGGYFVVHKDWP |
| Ga0209169_100235371 | 3300027879 | Soil | MNHDLAFRVGLAALLGVMAAAGNLIGGYFVVRGDWSRK |
| Ga0209380_103398641 | 3300027889 | Soil | MGHDLAFRTALAAGLGLVAAAGNLIGGYFVVRRDWPRKYLQYFL |
| Ga0209006_105286721 | 3300027908 | Forest Soil | VLIDHELATRTALAAALGLVAAGGNLLGGYFVVHKNWPRRYLQYF |
| Ga0265351_10160831 | 3300028020 | Soil | MIHELSFRIALAALLGLIAAGGNLLGGYFVVYREWPRRYLQYFLALG |
| Ga0268264_108151412 | 3300028381 | Switchgrass Rhizosphere | MVHDETTRVGMAAGLGLVAAAGNLLGGYFVVRRDWPRQNSR |
| Ga0075388_113744071 | 3300030848 | Soil | MTHELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYFLALGA |
| Ga0075388_116631902 | 3300030848 | Soil | MENSEAARIGLAAGLGLVAAVGNLLGGYFVVRREWPRKYLQYFLA |
| Ga0075385_116852641 | 3300030854 | Soil | MGNTETVRMGWAAVLGLVAAGGNLLGGYFVVRREWPRKFLQYFL |
| Ga0170824_1045435257 | 3300031231 | Forest Soil | MTHSLVFRMGLAALLGVMAAAGNLIGGYFVVRGDWSRKYLQYF |
| Ga0170824_1174037881 | 3300031231 | Forest Soil | MNHELSFRIALAALLGLIAAGGNLLGGYFVVYREWPRRYL |
| Ga0310915_104711121 | 3300031573 | Soil | MGHDEAFRTGLAALLGLLAALGNLLGGYFVVRKHWPRQYLQYFLALGAGYM |
| Ga0318555_107296491 | 3300031640 | Soil | MGHDEAFRTGLAALLGLLAALGNLLGGYFVVRKHWPRQYLQY |
| Ga0310686_1147013286 | 3300031708 | Soil | LHRLKAVPLAMGHDLGFRTALAAGLGLVAAAGNLIGGYFVVRRDWPQRYLQYFLALG |
| Ga0307474_109416632 | 3300031718 | Hardwood Forest Soil | MSHDLVFRMGLAALLGVMAAAGNLIGGYFVVRGDWSRKYLQYF |
| Ga0318502_104902042 | 3300031747 | Soil | MSHDLAFRTVLAGLLGLVAAGGNVLGGYFVVRREWPRKYLQY |
| Ga0318494_104594052 | 3300031751 | Soil | MGHDEAFRTGLAALLGLLAALGNLLGGYFVVRKHWPRQ |
| Ga0307475_103603531 | 3300031754 | Hardwood Forest Soil | MTYELPARAGMAAGLGIVAAAGNLLGGLFVVRRNWSRRFLHYFM |
| Ga0318576_100943391 | 3300031796 | Soil | MSHDLAFRTALAALLGLVAAGGNVLGGYFVVRREWPRKYLQYFLALGA |
| Ga0307473_102306702 | 3300031820 | Hardwood Forest Soil | MIHELSFRIALAALLGLVAAGGNVLGGYFVVRREWPRKYLQYFL |
| Ga0307478_105213631 | 3300031823 | Hardwood Forest Soil | MENTEAVRTGLAAVLGLVAASGNLLGGYFVVRKEWPRNFLQYFLAL |
| Ga0307478_111790331 | 3300031823 | Hardwood Forest Soil | MPHPDSTRIALAAVLGLVAAGGNLLGGYFVVYRKWQRRNLQYFVALGAGY |
| Ga0310917_105330302 | 3300031833 | Soil | MTHELPFRIALAALLGLVAAGGNLLGGYFVVYREWPRRYLQYFL |
| Ga0306919_107389001 | 3300031879 | Soil | MSHDLAFRTALAALLGLVAAGGNVLGGYFVVRREWP |
| Ga0310913_106947771 | 3300031945 | Soil | MSHELPFRFALAALLGLVAAVGNLLGGYFVVYREWPRRYLQY |
| Ga0310913_109598441 | 3300031945 | Soil | MSHDLAFRTALAALLGLVAAGGNVLGGYFVVRREWPRKYL |
| Ga0306926_105497851 | 3300031954 | Soil | MSHDLAFRTALAALLGLVAAVGNVLGGYFVVRREWQRKYLQ |
| Ga0307479_106719952 | 3300031962 | Hardwood Forest Soil | VLLAMGHDLGFRTALAAGLGLVAAAGNLIGGYFVV |
| Ga0307479_111197312 | 3300031962 | Hardwood Forest Soil | MGHDLAFRTALAAGLGLVAAAGNLLGGYFVVRRDWPRKFLGYFLAL |
| Ga0310911_103209791 | 3300032035 | Soil | MSHELPFRFALAALLGLVAAVGNLLGGYFVVYREWPR |
| Ga0307471_1022765871 | 3300032180 | Hardwood Forest Soil | MNHELPVRVGMAAGLGVVAAAGNLLGGLFVVRRNWPRRFLHYF |
| Ga0306920_1020471142 | 3300032261 | Soil | MEQELAMRTAMAAGLGLVAAAGNLLGGFCVVRKDWP |
| Ga0335082_101287414 | 3300032782 | Soil | MNHELPIRIALAAILGLIAAAGNLIGGYFVVYREWPR |
| Ga0335082_109824002 | 3300032782 | Soil | MNEEAARIAMAAVLGIVAAGGNLLGGYFVIRKDWPRQYLQHF |
| Ga0335079_110829251 | 3300032783 | Soil | MEHELAMRVGLAAGLGLVAAAGNLLGGYFVVRRDWPRIWLQYFLAL |
| Ga0335070_102644373 | 3300032829 | Soil | MNHELPIRIALAAILGLIAAAGNLIGGYFVVYREWPRRFLQY |
| Ga0335076_100178668 | 3300032955 | Soil | MIHELPFRIALAALLGLVAAGGNVLGGYFVVRREWPR |
| Ga0335084_105225852 | 3300033004 | Soil | MGYLTIDHDLATRTAMAAGLGLVAAAGNLLGGYFVIRKDWPRQFLQY |
| Ga0310914_107739721 | 3300033289 | Soil | MSHDLAFRTVLAGLLGLVAAGGNVLGGYFVVRREWP |
| Ga0326728_107787091 | 3300033402 | Peat Soil | MIHELSFRIALAVLLGLIAGAGNVLGGYFVVRREWPRKYLQYFLA |
| ⦗Top⦘ |