


| Basic Information | |
|---|---|
| Family ID | F031167 |
| Family Type | Metagenome |
| Number of Sequences | 183 |
| Average Sequence Length | 43 residues |
| Representative Sequence | FLNLLGGGIRWAIGDASAQLDANLKQAAPGYAEIPPKQPPRK |
| Number of Associated Samples | 150 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.58 % |
| % of genes near scaffold ends (potentially truncated) | 93.44 % |
| % of genes from short scaffolds (< 2000 bps) | 82.51 % |
| Associated GOLD sequencing projects | 139 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.525 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.322 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.426 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.087 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.14% β-sheet: 0.00% Coil/Unstructured: 62.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF00999 | Na_H_Exchanger | 8.20 |
| PF02585 | PIG-L | 2.19 |
| PF00582 | Usp | 2.19 |
| PF03544 | TonB_C | 2.19 |
| PF02627 | CMD | 1.64 |
| PF07635 | PSCyt1 | 1.64 |
| PF13450 | NAD_binding_8 | 1.64 |
| PF00072 | Response_reg | 1.09 |
| PF13418 | Kelch_4 | 1.09 |
| PF00571 | CBS | 1.09 |
| PF01494 | FAD_binding_3 | 1.09 |
| PF07969 | Amidohydro_3 | 1.09 |
| PF04488 | Gly_transf_sug | 1.09 |
| PF00988 | CPSase_sm_chain | 1.09 |
| PF02321 | OEP | 1.09 |
| PF00069 | Pkinase | 1.09 |
| PF00753 | Lactamase_B | 1.09 |
| PF04073 | tRNA_edit | 1.09 |
| PF01266 | DAO | 1.09 |
| PF05960 | DUF885 | 1.09 |
| PF13378 | MR_MLE_C | 0.55 |
| PF01370 | Epimerase | 0.55 |
| PF06283 | ThuA | 0.55 |
| PF01380 | SIS | 0.55 |
| PF00584 | SecE | 0.55 |
| PF00989 | PAS | 0.55 |
| PF00106 | adh_short | 0.55 |
| PF01541 | GIY-YIG | 0.55 |
| PF00188 | CAP | 0.55 |
| PF13519 | VWA_2 | 0.55 |
| PF13432 | TPR_16 | 0.55 |
| PF01113 | DapB_N | 0.55 |
| PF09852 | DUF2079 | 0.55 |
| PF09664 | DUF2399 | 0.55 |
| PF13592 | HTH_33 | 0.55 |
| PF04055 | Radical_SAM | 0.55 |
| PF00155 | Aminotran_1_2 | 0.55 |
| PF00903 | Glyoxalase | 0.55 |
| PF01636 | APH | 0.55 |
| PF01522 | Polysacc_deac_1 | 0.55 |
| PF00535 | Glycos_transf_2 | 0.55 |
| PF12796 | Ank_2 | 0.55 |
| PF09722 | Xre_MbcA_ParS_C | 0.55 |
| PF00463 | ICL | 0.55 |
| PF03668 | ATP_bind_2 | 0.55 |
| PF04794 | YdjC | 0.55 |
| PF00150 | Cellulase | 0.55 |
| PF13414 | TPR_11 | 0.55 |
| PF13629 | T2SS-T3SS_pil_N | 0.55 |
| PF13641 | Glyco_tranf_2_3 | 0.55 |
| PF07819 | PGAP1 | 0.55 |
| PF07883 | Cupin_2 | 0.55 |
| PF13442 | Cytochrome_CBB3 | 0.55 |
| PF00171 | Aldedh | 0.55 |
| PF13618 | Gluconate_2-dh3 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 8.20 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 8.20 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 8.20 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 8.20 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 8.20 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.37 |
| COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 2.19 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.19 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.19 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 2.19 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 2.19 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 1.64 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 1.64 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.09 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.09 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.09 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.09 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 1.09 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.55 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.55 |
| COG0690 | Preprotein translocase subunit SecE | Intracellular trafficking, secretion, and vesicular transport [U] | 0.55 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.55 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.55 |
| COG1075 | Triacylglycerol esterase/lipase EstA, alpha/beta hydrolase fold | Lipid transport and metabolism [I] | 0.55 |
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 0.55 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.55 |
| COG2267 | Lysophospholipase, alpha-beta hydrolase superfamily | Lipid transport and metabolism [I] | 0.55 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.55 |
| COG2443 | Preprotein translocase subunit Sss1 | Intracellular trafficking, secretion, and vesicular transport [U] | 0.55 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 0.55 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.55 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.55 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.52 % |
| Unclassified | root | N/A | 11.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10442120 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300003321|soilH1_10049570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1633 | Open in IMG/M |
| 3300004082|Ga0062384_100700627 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300004479|Ga0062595_100946826 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300005171|Ga0066677_10139320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1320 | Open in IMG/M |
| 3300005172|Ga0066683_10798753 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005343|Ga0070687_100019081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3185 | Open in IMG/M |
| 3300005437|Ga0070710_11192262 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005450|Ga0066682_10305579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1026 | Open in IMG/M |
| 3300005466|Ga0070685_10591505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300005529|Ga0070741_11166120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300005538|Ga0070731_10057383 | All Organisms → cellular organisms → Bacteria | 2589 | Open in IMG/M |
| 3300005540|Ga0066697_10624452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300005554|Ga0066661_10092827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300005554|Ga0066661_10650673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300005555|Ga0066692_10832712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300005555|Ga0066692_10847536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300005560|Ga0066670_10694685 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005566|Ga0066693_10100836 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300005574|Ga0066694_10448408 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005577|Ga0068857_101427744 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005764|Ga0066903_100515835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2033 | Open in IMG/M |
| 3300005842|Ga0068858_100303717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1523 | Open in IMG/M |
| 3300005950|Ga0066787_10048216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300006032|Ga0066696_10179076 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
| 3300006057|Ga0075026_100772839 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300006059|Ga0075017_100322695 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300006102|Ga0075015_100244897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300006102|Ga0075015_100395280 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006354|Ga0075021_10945400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300006791|Ga0066653_10166052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300006800|Ga0066660_11067677 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300007255|Ga0099791_10212179 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300007255|Ga0099791_10248090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300007258|Ga0099793_10101659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1331 | Open in IMG/M |
| 3300007258|Ga0099793_10300454 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300007265|Ga0099794_10595372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009012|Ga0066710_101432589 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300009038|Ga0099829_10156353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1823 | Open in IMG/M |
| 3300009088|Ga0099830_10481556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300009089|Ga0099828_10278563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1503 | Open in IMG/M |
| 3300009090|Ga0099827_11664790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
| 3300009093|Ga0105240_10136543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2937 | Open in IMG/M |
| 3300009098|Ga0105245_10700536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1046 | Open in IMG/M |
| 3300009137|Ga0066709_101435043 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300009137|Ga0066709_101786982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300009148|Ga0105243_10845349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300009545|Ga0105237_10186950 | Not Available | 2072 | Open in IMG/M |
| 3300010304|Ga0134088_10168263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300010325|Ga0134064_10220175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
| 3300010325|Ga0134064_10349482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300010335|Ga0134063_10062865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1640 | Open in IMG/M |
| 3300010366|Ga0126379_12634222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300010366|Ga0126379_12705424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300010373|Ga0134128_11084258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300010376|Ga0126381_100021524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7557 | Open in IMG/M |
| 3300010396|Ga0134126_12517336 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300011120|Ga0150983_14060816 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
| 3300011270|Ga0137391_11019191 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300011271|Ga0137393_10969302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300011271|Ga0137393_11410665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300011271|Ga0137393_11521527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300012096|Ga0137389_11235844 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300012189|Ga0137388_10125970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 2237 | Open in IMG/M |
| 3300012198|Ga0137364_10095206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2087 | Open in IMG/M |
| 3300012198|Ga0137364_10792510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300012199|Ga0137383_10452657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300012201|Ga0137365_11333044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300012202|Ga0137363_10365738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300012202|Ga0137363_10461047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300012202|Ga0137363_11086434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300012205|Ga0137362_10206149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1693 | Open in IMG/M |
| 3300012207|Ga0137381_11512717 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300012209|Ga0137379_10001276 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 23059 | Open in IMG/M |
| 3300012210|Ga0137378_10000642 | All Organisms → cellular organisms → Bacteria | 27482 | Open in IMG/M |
| 3300012210|Ga0137378_11210494 | Not Available | 671 | Open in IMG/M |
| 3300012210|Ga0137378_11465324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300012211|Ga0137377_10231846 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300012361|Ga0137360_10749856 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
| 3300012361|Ga0137360_11217434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012361|Ga0137360_11760907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300012363|Ga0137390_11953502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012683|Ga0137398_10121258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1670 | Open in IMG/M |
| 3300012683|Ga0137398_10491957 | Not Available | 843 | Open in IMG/M |
| 3300012917|Ga0137395_10071831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2237 | Open in IMG/M |
| 3300012925|Ga0137419_10171942 | All Organisms → cellular organisms → Bacteria | 1582 | Open in IMG/M |
| 3300012927|Ga0137416_10174375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1705 | Open in IMG/M |
| 3300012930|Ga0137407_11462331 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300012930|Ga0137407_11809888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300012964|Ga0153916_12069420 | Not Available | 639 | Open in IMG/M |
| 3300012976|Ga0134076_10629434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300012987|Ga0164307_11595027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 552 | Open in IMG/M |
| 3300012988|Ga0164306_11387130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300013104|Ga0157370_10772371 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 875 | Open in IMG/M |
| 3300014157|Ga0134078_10280700 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300014157|Ga0134078_10444230 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300015054|Ga0137420_1266569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1790 | Open in IMG/M |
| 3300015241|Ga0137418_10921209 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300015241|Ga0137418_10987980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300015262|Ga0182007_10238121 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300015358|Ga0134089_10120238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300015373|Ga0132257_100652463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1304 | Open in IMG/M |
| 3300017657|Ga0134074_1269202 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017942|Ga0187808_10597762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300017972|Ga0187781_10242135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1276 | Open in IMG/M |
| 3300018012|Ga0187810_10006394 | All Organisms → cellular organisms → Bacteria | 4096 | Open in IMG/M |
| 3300018431|Ga0066655_10315041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1021 | Open in IMG/M |
| 3300018431|Ga0066655_10996110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300018433|Ga0066667_10212049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1434 | Open in IMG/M |
| 3300019789|Ga0137408_1117013 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300019890|Ga0193728_1006003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 6146 | Open in IMG/M |
| 3300020004|Ga0193755_1003016 | All Organisms → cellular organisms → Bacteria | 5353 | Open in IMG/M |
| 3300020061|Ga0193716_1236962 | Not Available | 667 | Open in IMG/M |
| 3300020170|Ga0179594_10299785 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300020583|Ga0210401_10083189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3011 | Open in IMG/M |
| 3300021086|Ga0179596_10705733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300021088|Ga0210404_10300589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300021168|Ga0210406_11230952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300021171|Ga0210405_10446003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300021178|Ga0210408_10827619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300021405|Ga0210387_10933792 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300021432|Ga0210384_10300587 | Not Available | 1445 | Open in IMG/M |
| 3300021432|Ga0210384_10961991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
| 3300021433|Ga0210391_10959869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300021478|Ga0210402_10250018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1637 | Open in IMG/M |
| 3300021478|Ga0210402_10550826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1070 | Open in IMG/M |
| 3300021478|Ga0210402_10690993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 943 | Open in IMG/M |
| 3300021479|Ga0210410_11704538 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300025911|Ga0207654_10292769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1105 | Open in IMG/M |
| 3300025913|Ga0207695_10106556 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
| 3300025927|Ga0207687_11151261 | Not Available | 666 | Open in IMG/M |
| 3300025972|Ga0207668_11905182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300026035|Ga0207703_11757555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 596 | Open in IMG/M |
| 3300026035|Ga0207703_12041971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 549 | Open in IMG/M |
| 3300026300|Ga0209027_1073880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300026318|Ga0209471_1070973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300026322|Ga0209687_1248416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300026327|Ga0209266_1231358 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300026328|Ga0209802_1327479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300026538|Ga0209056_10555237 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026550|Ga0209474_10085706 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300026557|Ga0179587_10009345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 5041 | Open in IMG/M |
| 3300027565|Ga0209219_1110129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300027663|Ga0208990_1140573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300027678|Ga0209011_1068517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300027783|Ga0209448_10052681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1369 | Open in IMG/M |
| 3300027862|Ga0209701_10538236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300027869|Ga0209579_10101658 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300027874|Ga0209465_10611308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300027882|Ga0209590_10825481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027898|Ga0209067_10386641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300028047|Ga0209526_10194478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1407 | Open in IMG/M |
| 3300028047|Ga0209526_10195336 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300028731|Ga0302301_1057092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300028759|Ga0302224_10079161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1250 | Open in IMG/M |
| 3300028871|Ga0302230_10447028 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300031128|Ga0170823_16995365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 899 | Open in IMG/M |
| 3300031446|Ga0170820_16740104 | Not Available | 675 | Open in IMG/M |
| 3300031708|Ga0310686_105640414 | Not Available | 867 | Open in IMG/M |
| 3300031720|Ga0307469_10145295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1765 | Open in IMG/M |
| 3300031720|Ga0307469_10185619 | Not Available | 1605 | Open in IMG/M |
| 3300031720|Ga0307469_10296163 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300031720|Ga0307469_12517317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031754|Ga0307475_10263933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1380 | Open in IMG/M |
| 3300031820|Ga0307473_10933034 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031954|Ga0306926_12108582 | Not Available | 631 | Open in IMG/M |
| 3300031962|Ga0307479_11029742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300032001|Ga0306922_11433869 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300032174|Ga0307470_10047428 | All Organisms → cellular organisms → Bacteria | 2175 | Open in IMG/M |
| 3300032180|Ga0307471_100084539 | All Organisms → cellular organisms → Bacteria | 2808 | Open in IMG/M |
| 3300032180|Ga0307471_102501444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
| 3300032421|Ga0310812_10005691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4042 | Open in IMG/M |
| 3300033433|Ga0326726_10006656 | All Organisms → cellular organisms → Bacteria | 10399 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.83% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.83% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.28% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.19% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.19% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.64% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.64% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.09% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.09% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.09% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.55% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.55% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.55% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.55% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.55% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028731 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028871 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_104421202 | 3300000953 | Soil | AIGDRPDNWSNDFFLNLLGGGIRWAIRDANASLDHNLTQSAPGYAVIPPKK* |
| soilH1_100495704 | 3300003321 | Sugarcane Root And Bulk Soil | GDRPENWSSPFFLNLLGGGIRWSIGDAKASLTQNIKQAAPGYAEIPPR* |
| JGIcombinedJ51221_101117711 | 3300003505 | Forest Soil | PENWEIPFFVNLLGGGIRWAIGDVNAKVDSNIAQAAPGYAVIPPKYPASAAK* |
| Ga0062384_1007006272 | 3300004082 | Bog Forest Soil | LLAGGIRWAIGDANASVSPNLKTAAPGYAEIPPPYPPRAK* |
| Ga0062595_1009468261 | 3300004479 | Soil | PFFLNLLGGGIRWTIGDAQASLTQNLVQAAPGYAEIPPKPKD* |
| Ga0066677_101393201 | 3300005171 | Soil | RPENWKNEFFLNLLGGGTRWAIGDVNAKVETNLKEAAPGYAEIPPKEPARN* |
| Ga0066683_107987532 | 3300005172 | Soil | SNPFFLNLLGGGIRWSIGGVKASLDQNLKQAAPGYAEIPPKPKPKT* |
| Ga0070687_1000190814 | 3300005343 | Switchgrass Rhizosphere | ENWSNPFFLNLLGGGIRWATGNTKASVAENLTQAAPGYAEIPPK* |
| Ga0070710_111922622 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LLAGGIRWSLGDAKASIPTNLKTAAPGYAEIPPKYPPETK* |
| Ga0066682_103055794 | 3300005450 | Soil | NLLAGGIRWTIGDASAQLDRNLKQAAPGYEEIPPKFPSEK* |
| Ga0070685_105915051 | 3300005466 | Switchgrass Rhizosphere | PENWSNPFFLNLLGGGIRWAMGGARASLEQNLKQAAPGYGEIPPK* |
| Ga0070741_111661202 | 3300005529 | Surface Soil | LAGGIRWAIRDVDASSQVNLKEAAPGYATIPPKETRN* |
| Ga0070735_100866623 | 3300005534 | Surface Soil | ENWEIPFFVNLLGGGLRWAIGDVNATLTKNIKQAAPGYATIPPKYKTKEE* |
| Ga0070731_100573831 | 3300005538 | Surface Soil | NLLAGGIRWSIGDAKATLTRNLAEATPGYAEIPPKPAKTT* |
| Ga0066697_106244521 | 3300005540 | Soil | LLGGGIRWAIGDANANVETNLKEAAPGYAEIPPKQTAAK* |
| Ga0066661_100928274 | 3300005554 | Soil | GIRWSIGDASAQVNVNLKEAAPGYADIPPRFPAAK* |
| Ga0066661_106506731 | 3300005554 | Soil | ENWKNEFFLNLLAGGIRWSIGDASAQVNVNLKEATPGFAEIPPKYPPAK* |
| Ga0066692_108327122 | 3300005555 | Soil | VLDGGIRWAVGDAEAKLDVNLKEAAPGYADIPPKSPTAK* |
| Ga0066692_108475361 | 3300005555 | Soil | LAGGIRWSIGDASAQVNVNLKEAALGYAEIPPKFPPAK* |
| Ga0066670_106946852 | 3300005560 | Soil | ENWSNPLFVNLLGGGIRWATGSAKASLAQNLTEVTPGYNVIPPKPE* |
| Ga0066693_101008361 | 3300005566 | Soil | GIRWSIGDANATLTHNLTQAAPGYAEIPPKPKAKG* |
| Ga0066694_104484083 | 3300005574 | Soil | GIRWTIGDASAQLDRNLKQAAPGYEEIPPRFPSEK* |
| Ga0068857_1014277441 | 3300005577 | Corn Rhizosphere | FFLNLLGGGIRWSIGDAKASLNKNLAQATPGYAEIPPKPPAKA* |
| Ga0066903_1005158351 | 3300005764 | Tropical Forest Soil | GGGIRWAIGDVNANVESNLKEAAPGYAEIPPKEPAKN* |
| Ga0068858_1003037172 | 3300005842 | Switchgrass Rhizosphere | SNAFFLNLLGGGIRWSIGDAKASLTKNLAQATPGYAEIPPKLPAKT* |
| Ga0066787_100482161 | 3300005950 | Soil | NVVGGGVRWAIGDVSAKLTQNIKEAAPGYAVIPPKFPPETK* |
| Ga0066696_101790762 | 3300006032 | Soil | WSEPFFLNLLGGGIRWSIGDANATLTHNLTQAAPGYAEIPPKPKAKG* |
| Ga0075026_1007728391 | 3300006057 | Watersheds | DSFFLNLLGGGIRWAIGDVKASLDQNLTQAAPGYAEIPPKVKPKG* |
| Ga0075017_1003226952 | 3300006059 | Watersheds | FLNHLAGGIGWSIGNAKASVDTNLAQATPGYAEIPPKG* |
| Ga0075015_1002448973 | 3300006102 | Watersheds | IRWAIGDANAQVDVNLKQAAPGYAEIPPKFPPEKK* |
| Ga0075015_1003952803 | 3300006102 | Watersheds | GGIRWAIGDASAQVDVNLKQATPGYAEIPPKFPPEKK* |
| Ga0070765_1005971432 | 3300006176 | Soil | DRPENWEIPFFVNVLGGGIRWAISDVNAKIDGNITQAAPGYAVIPPKFPPKST* |
| Ga0075021_109454002 | 3300006354 | Watersheds | GIRWAIGDANAQVDGNLKQAAPGYAEIPPKFPPEKK* |
| Ga0066653_101660523 | 3300006791 | Soil | IRWAIGDVNPNVETNLKEAVPGYAEIPPREPAKN* |
| Ga0066660_110676772 | 3300006800 | Soil | LNLLGGGIRWATGNAKASVEQNLTQVAPGYNVIPPKSE* |
| Ga0099791_102121792 | 3300007255 | Vadose Zone Soil | RPENWKNEFFLNLLGGGIRWTIGDGSAQLEANLKQAAPGYAEIPPPQPAGK* |
| Ga0099791_102480901 | 3300007255 | Vadose Zone Soil | MGDRPENWKNEFFLNSLAGGMRWGIGDAGAQVDVNLKKAAPRYAEIPPKFPEKK* |
| Ga0099793_101016592 | 3300007258 | Vadose Zone Soil | KNEFFMNSLAGGIRWSIGDASAQVDVNLKQAAPGYAEIPPKFPEKK* |
| Ga0099793_103004542 | 3300007258 | Vadose Zone Soil | KNEFFLNLLGGGIRWAIGDANAQLDANLKQAAPGHAEIPPKQPPGK* |
| Ga0099794_105953721 | 3300007265 | Vadose Zone Soil | NAFHLNLLAGGIRWSLGDVKADLSKNLSAAAPGYADIPPKFPPKAAS* |
| Ga0066710_1014325891 | 3300009012 | Grasslands Soil | TFFQNLLGGGIRWAIGNADASLDQNLMQAAPGYAEIPPRR |
| Ga0099829_101563533 | 3300009038 | Vadose Zone Soil | LAGGIRWIVGDANAHLNANLKQATPGYAEIPPKFPA* |
| Ga0099830_104815564 | 3300009088 | Vadose Zone Soil | WKDEFFLKVLDGGIRWAASDAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0099830_112170181 | 3300009088 | Vadose Zone Soil | TWEDGFFLNLLAGGIRWAIRDVEAQIPLNLRSAAPGYAEIPPKSPPEN* |
| Ga0099828_102785633 | 3300009089 | Vadose Zone Soil | LAGGIRWSIGDASAQVDVNLKQAAPGYEEIPPKFPEKK* |
| Ga0099827_116647902 | 3300009090 | Vadose Zone Soil | NSLDGGIRWSIGDASAQVDVNLKRAAPGYAEIPPKFPEKK* |
| Ga0105240_101365435 | 3300009093 | Corn Rhizosphere | FFLNLLGGGIRWSIGDAKASLAQNIKQAAPGYSEIPPR* |
| Ga0105245_107005361 | 3300009098 | Miscanthus Rhizosphere | ENWLSPFFLNLLGGGIRWVIGDAKASVQQNLQQAAPGYAEIPPKG* |
| Ga0066709_1014350431 | 3300009137 | Grasslands Soil | TFFQNLLGGGIRWAIGNADASLDQNLMQAAPGYAEIPPRR* |
| Ga0066709_1017869821 | 3300009137 | Grasslands Soil | AGGIRWSIGDASAQVKVNLKEAAPGYADIPPKYPPAK* |
| Ga0105243_108453492 | 3300009148 | Miscanthus Rhizosphere | GIRWSIGDARASLQKNLAQATPGYAEIPPKPPAKA* |
| Ga0105237_101869501 | 3300009545 | Corn Rhizosphere | FFLNLLGGGIRWAMGDAKASLTQNIKQSAPGYAEIPPK* |
| Ga0134088_101682631 | 3300010304 | Grasslands Soil | DRPENWKDEFFLKVLDGGIRWAASDAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0134064_102201752 | 3300010325 | Grasslands Soil | ENWKNEFFLNLLAGGIRWTIGDASAQLDRNLKQAAPGYEEIPPRFPSEK* |
| Ga0134064_103494821 | 3300010325 | Grasslands Soil | ENWKNEFFTKLLGGGIRWAIGDVNPNVETNLKEAAPGYAEIPPREPAKN* |
| Ga0134063_100628653 | 3300010335 | Grasslands Soil | GIRWSIGDASAQVDVNLKQAAPGYAEIPPKFPEKK* |
| Ga0126379_126342222 | 3300010366 | Tropical Forest Soil | GGIRWAIGDATASIPANLQAAAPGYAEIPPPYPPPEKK* |
| Ga0126379_127054241 | 3300010366 | Tropical Forest Soil | NWKDEFFLNLLGGGIRWAIGDASANVETNLKEAAPGYSEIPPKESAAK* |
| Ga0134128_110842581 | 3300010373 | Terrestrial Soil | NTFFLNLLGGGIRWSIGDAKASLNKNLAQATPGYAEIPPKPPAKD* |
| Ga0126381_1000215241 | 3300010376 | Tropical Forest Soil | EFLLSLLGGGIRWAIGDVNPDVETNLKEAAPGFAEIPPKQPAKN* |
| Ga0134126_125173362 | 3300010396 | Terrestrial Soil | LGGGIRWAIRDADASLDHNLARVAPGYNVIPPKS* |
| Ga0150983_140608161 | 3300011120 | Forest Soil | RPENWQNQFHLNLLAGGIRWAMGDAKASVSPNLKTAAPGYAEIPAPYPPPAK* |
| Ga0137391_110191912 | 3300011270 | Vadose Zone Soil | LLAGGIRWSIGEASAQLDVNLKQTAPGYAEIPPKFPSEK* |
| Ga0137393_109693023 | 3300011271 | Vadose Zone Soil | IRWAIGNDSAQLDVNLKQAAPGYAEIPPKFPAEK* |
| Ga0137393_114106652 | 3300011271 | Vadose Zone Soil | VLGGGIRWAIGDTKAESDANLKQAAPGYAEIPPKFPPAQK* |
| Ga0137393_115215271 | 3300011271 | Vadose Zone Soil | DRPENWKDEFFLKVLDGGIRWAAGDAEAQLDVNLKQVAPGYAEIPPKSPTAK* |
| Ga0137389_112358442 | 3300012096 | Vadose Zone Soil | GGIRWAIGDASAQLDANLKQAAPGYAEIPPKQPPGK* |
| Ga0137388_101259704 | 3300012189 | Vadose Zone Soil | LAGGIRWATGEAKASLDKNLTQAAPGYAEIPPKPQPKQ* |
| Ga0137364_100952061 | 3300012198 | Vadose Zone Soil | LAGGIRWTIGDASAQSDRNLKQAAPGYEEIPPRFPSEK* |
| Ga0137364_107925101 | 3300012198 | Vadose Zone Soil | NWKNEFFLNVLAGGIRWSIGAASAQVNVNLKEATPGYAEIPPKFPATK* |
| Ga0137383_104526573 | 3300012199 | Vadose Zone Soil | KNEFFLNLLAGGIRWTIGDARVQLDRNLKQAAPGYEQIPPRFPSEK* |
| Ga0137365_113330442 | 3300012201 | Vadose Zone Soil | LNLLGGGIRWAIGDTKASINPNLKQAAPGYAEIPPK* |
| Ga0137363_103657383 | 3300012202 | Vadose Zone Soil | WKNEFFLNSLAGGIRWSIGDASAQVNVNLKEAAPGYAEIPPKFPEKK* |
| Ga0137363_104610471 | 3300012202 | Vadose Zone Soil | ENWKNEFFVNVLGGGIRWAIGDASAQVDVNLKQAAPGYAEIPPKFPPEKK* |
| Ga0137363_110864343 | 3300012202 | Vadose Zone Soil | NLLAGGIRWSIGDASAQVNVNLKEAAPGYAEIPPKFPAAK* |
| Ga0137362_102061491 | 3300012205 | Vadose Zone Soil | PENWKNEFFLNLLAGGIRWSIGDAGAEVNVNLKEATPGYAEIPPKFPAAK* |
| Ga0137381_115127171 | 3300012207 | Vadose Zone Soil | EFFLNLLAGGIRWVIGEASAQLDVNLKQAAPGYAEFPPKFPPEK* |
| Ga0137379_1000127624 | 3300012209 | Vadose Zone Soil | FFLKVLDGGIRWAASDAEAKLDVNLKEAAPGYADIPPKPPATK* |
| Ga0137378_1000064229 | 3300012210 | Vadose Zone Soil | GIRWAASEAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0137378_112104942 | 3300012210 | Vadose Zone Soil | GIRWATGDANAVLDKNLAQVAPGYAEIPPKPQPKQ* |
| Ga0137378_114653241 | 3300012210 | Vadose Zone Soil | KVLNGGIRWAASDAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0137377_102318461 | 3300012211 | Vadose Zone Soil | DRPENWKNEFFLSLLGGGISWAIGQVNPSVETNLKEAAPGYADIPPKEPAKN* |
| Ga0137360_107498562 | 3300012361 | Vadose Zone Soil | MNSLAGGIRWSIGDASAQVDVNLKQAAPGYKEIPPKFPEKK* |
| Ga0137360_112174341 | 3300012361 | Vadose Zone Soil | NEFFLNSLAGGMRWSIGDAGAQVDVNLKQAAPRYAEIPPKFPEKK* |
| Ga0137360_117609072 | 3300012361 | Vadose Zone Soil | AGGIRWSIGDASAQVDVNLKQAAPGYAEIPPKFPEKK* |
| Ga0137390_119535021 | 3300012363 | Vadose Zone Soil | PENWKNEFFLNLLAGGIRWSIGEASAQLDVNLKQAAPGYAEIPPKFPPEK* |
| Ga0137398_101212583 | 3300012683 | Vadose Zone Soil | PENWKNEFFLNLLAGGIRWSIGEASAQLDVNLKRAAPGYAEIPPKFPSEK* |
| Ga0137398_104919572 | 3300012683 | Vadose Zone Soil | GGIRWSIGDAKASLNQNLTQAAPGYAEIPPRPKPKG* |
| Ga0137395_100718315 | 3300012917 | Vadose Zone Soil | ENWKNEFFLNLLAGGIRWSIGEASAQLDVNLKQAAPGYAEIPPKFPSEK* |
| Ga0137419_101719422 | 3300012925 | Vadose Zone Soil | LNLLGGGIRWAMGDANAQLDTNLKQAAPGYAEIPPKQPPGK* |
| Ga0137416_101743751 | 3300012927 | Vadose Zone Soil | WKNEFFLNSLAGGIRWGIGNANAQVDVNLKQAAPGYADIPQKFPVAN* |
| Ga0137407_114623312 | 3300012930 | Vadose Zone Soil | GIRWAIGDASVQLDANLKQAAPGYAEIPPKQPPRK* |
| Ga0137407_118098881 | 3300012930 | Vadose Zone Soil | LNSLAGGMRWGIGNANAQVDVNLKQAAPGYAEIPPKFPAAK* |
| Ga0153916_120694202 | 3300012964 | Freshwater Wetlands | NLLGGGIRWAIGDVNVPLDADLKQAAPGYAEIPPPQPPGK* |
| Ga0134076_106294342 | 3300012976 | Grasslands Soil | LKVLDGGIRWAASDAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0164307_115950271 | 3300012987 | Soil | LLGGGIRWSIGDAKASLTKNLAQATPGYAEIPPKLPAKT* |
| Ga0164306_113871302 | 3300012988 | Soil | NWSNTFFLNLLGGGIRWSIGDVKASLQKNLAQATPGYAEIPPKPPAKA* |
| Ga0157370_107723712 | 3300013104 | Corn Rhizosphere | TFFLNLLGGGIRWSIGDAKASLNKNLAQATPGYAEIPPKPPAKA* |
| Ga0134078_102807001 | 3300014157 | Grasslands Soil | PENWSNPLFLNLLGGGIRWATGSAKASLAQNLIEVTPGYNVIPPRPE* |
| Ga0134078_104442301 | 3300014157 | Grasslands Soil | IRWAIGDVKANVETTLKEAAPGYAEIPPKEPPKESPRK* |
| Ga0182015_104758312 | 3300014495 | Palsa | EIPFMVSVVGGGIRWAIDEANAKLDHNITQAAPGYAVIPPKFPPATK* |
| Ga0137420_12665691 | 3300015054 | Vadose Zone Soil | LAGGIRWSIGEASAQLDVNLKQAAPGYAEIPPKFSPEK* |
| Ga0137418_109212092 | 3300015241 | Vadose Zone Soil | MGDRPENWQNTFFLNLLDGGIRWSLGEAKADLSQNLLAAAPGYADIPPKFPPAPPK* |
| Ga0137418_109879802 | 3300015241 | Vadose Zone Soil | WKNEFFLNLLAGGIRWSVGDAGAEVNVNLKEATPGYAEIPPKFPAAK* |
| Ga0182007_102381211 | 3300015262 | Rhizosphere | WSSPFFLNLLGGGIRWSIGDAKASLAQNIKQAAPGYSEIPPR* |
| Ga0134089_101202383 | 3300015358 | Grasslands Soil | ENWKDEFFLKVLDGGIRWAASDAEAKLDVNLKEAAPGYADIPPKSPAAK* |
| Ga0132257_1006524633 | 3300015373 | Arabidopsis Rhizosphere | PENWSSPFFLNLLGGGIRWAIGDAQATLRENIKLAAPGYAEIPPKNK* |
| Ga0134074_12692022 | 3300017657 | Grasslands Soil | TKLLGGGIRWAIGDVNPNVETNLKEAAPGYAEIPPREPAKN |
| Ga0187808_105977621 | 3300017942 | Freshwater Sediment | RPEHWQNVFYLNLLGGGIRWSIGDVSASLDQNLKQAAPGYAEIPPKPQTTK |
| Ga0187781_102421351 | 3300017972 | Tropical Peatland | LNLLGGGIRWSIGDAQASLGQNLKQVAPGYDVIPPKPAATK |
| Ga0187810_100063945 | 3300018012 | Freshwater Sediment | NDFFLNLLGGGSRWSIGNATASLEQNLKQAAPGYDVIPPKPQATK |
| Ga0066655_103150411 | 3300018431 | Grasslands Soil | NSLAGGIRLSIGDASAQVDANLKQAAPGYAEIPPKFPEKK |
| Ga0066655_109961102 | 3300018431 | Grasslands Soil | ALFLNLLAGGIRWAIGDATATTTANLQQVAPGSNAIPPK |
| Ga0066667_102120491 | 3300018433 | Grasslands Soil | NWKNEFFLNLLAGGIRWTIGDASAQLDRNLKQAAPGYEEIPPKFPSEK |
| Ga0137408_11170131 | 3300019789 | Vadose Zone Soil | FLNLLGGGIRWAIGDASAQLDANLKQAAPGYAEIPPKQPPRK |
| Ga0193728_10060031 | 3300019890 | Soil | ENWQDTFFLNVLGGGIRWSIGDAKATLNKNLTEVAPGYATIPPKNAPAKK |
| Ga0193755_10030161 | 3300020004 | Soil | WKNEFFVNLLGGGIRWAIGDASAQVDANLKQAAPGYAEIPPPQPPGK |
| Ga0193716_12369622 | 3300020061 | Soil | FFLNLLGGGIRWSIGDVKAKLDHNLKTAAPGYAEIPPKFPPEKK |
| Ga0179594_102997851 | 3300020170 | Vadose Zone Soil | ANWKNEFFLNLLGGGIRWAIGDANAQLDTNLMQAAPGYAEIPPKQPPGK |
| Ga0210401_100831897 | 3300020583 | Soil | ENWKNDFFLNLLGGGIRWALGDASAHLDANLKEAAPGYAEIPPKYPAEK |
| Ga0179596_107057332 | 3300021086 | Vadose Zone Soil | GIRWSIGDASAQVDVNLKQAAPGYEEIPPKFPEKK |
| Ga0210404_103005891 | 3300021088 | Soil | NWKNDFFLNLLGGGIRWALGDASAHLDANLKEAAPGYAEIPPKYPAEK |
| Ga0210406_112309521 | 3300021168 | Soil | FVNLLGGGIRWAIGDVKAKVDGNITQAAPGYAVIPPKFPPAK |
| Ga0210405_104460033 | 3300021171 | Soil | NLLAGGIRWSIGEASAQLDANLKEAAPGYAEIPPKFPEKK |
| Ga0210408_108276192 | 3300021178 | Soil | AMGDRPENWKNEFFLNSLAGGMRWGIGDAGAQVDVNLKQAAPGYTEIPPKFPEKK |
| Ga0210397_109051492 | 3300021403 | Soil | WEIPFFVNVLGGGIRWAISDVNTKIDSNITQAAPGYAVIPPKFPPSTK |
| Ga0210387_109337921 | 3300021405 | Soil | LLGGGFKWALGDAKAQLDQNIKQVTPGYAEIPPKNPPAPPK |
| Ga0210384_103005871 | 3300021432 | Soil | LAGGIRWATRGANASLDSNLKQAAPGYAEIPPKPQPKQ |
| Ga0210384_109619911 | 3300021432 | Soil | WKNEFFLNLLGGGIRWAIGDASAQLEANLKQAAPGYAEIPPKYPADK |
| Ga0210391_109598691 | 3300021433 | Soil | GGGIRWSIGEASAQLDENLKEAAPGYAEIPPKQAPEK |
| Ga0210390_109376432 | 3300021474 | Soil | NWEIPFFVNVLGGGIRWAISDVNAKIDSNITQAAPGYAVIPPKFPPSTK |
| Ga0210402_102500183 | 3300021478 | Soil | LGGGIRWAIGDASAQLDANLKQAAPGYAEIPPKYPPGK |
| Ga0210402_105508262 | 3300021478 | Soil | LGGGIRWSIGDAEASLDPNLAKAAPGYAEIPPRPKPKE |
| Ga0210402_106909931 | 3300021478 | Soil | WSNPFFLHLLGGGIRWAIRDAQASVDQNLQQAAPGYAEIPSKPKSKA |
| Ga0210402_111578242 | 3300021478 | Soil | PENWEIPFFVNLLGGGIRWAIGDVNAKVDGNITQAAPGYAVIPPKFPAAK |
| Ga0210410_117045382 | 3300021479 | Soil | LLAGGIRWAMGDASASVSPNLKSAAPGYAEIPPPYPPPAK |
| Ga0207654_102927692 | 3300025911 | Corn Rhizosphere | SNAFFLNLLGGGIRWSIGDAKASLTKNLAQATPGYAEIPPKLPAKT |
| Ga0207695_101065561 | 3300025913 | Corn Rhizosphere | LFMNILGGGIRWAIGDANASLEKNLTQVAPGYNVIPPKA |
| Ga0207687_111512611 | 3300025927 | Miscanthus Rhizosphere | LWAQRRGGGIRWAMGGARASLEQNLKQAAPGYGEIPPK |
| Ga0207668_119051822 | 3300025972 | Switchgrass Rhizosphere | LLGGGIRWSIGDAKASLQRNLAQATPGYAEIPPKPPAKA |
| Ga0207703_117575551 | 3300026035 | Switchgrass Rhizosphere | NWQNEFHLHLLAGGIRWSMGDATASIPVNLKTAAPGYAEIPPKYPPDAK |
| Ga0207703_120419711 | 3300026035 | Switchgrass Rhizosphere | WSNAFFLNLLGGGIRWSIGDAKASLTKNLAQATPGYAEIPPKLPAKT |
| Ga0209027_10738802 | 3300026300 | Grasslands Soil | WSSQFFLNLLGGGIRWSIGDAKASLTQNLTQVAPGYKVIPPKS |
| Ga0209471_10709732 | 3300026318 | Soil | GGIRWAIGDAKASLDQNLMQAAPGYAEIPPRPKPKG |
| Ga0209687_12484161 | 3300026322 | Soil | NLLAGGIRWAIGDATATTTANLQQVAPGSNAIPPK |
| Ga0209266_12313582 | 3300026327 | Soil | FQNLLGGGIRWAIGNADASLDQNLMQAAPGYAEIPPRR |
| Ga0209802_13274792 | 3300026328 | Soil | KVLDGGIRWAVGDAEANLDVNLKEAAPGYADIPPKSPAAK |
| Ga0209056_105552371 | 3300026538 | Soil | ENWSNPFFLNLLGGGIRWSIGDVKASLDHNLTQAAPGYAEIPPKPKPKS |
| Ga0209474_100857061 | 3300026550 | Soil | FFLNLLAGGIRWSIGDASAQVKVNLKEAAPGYAEIPPKYPPAK |
| Ga0179587_100093457 | 3300026557 | Vadose Zone Soil | FFLNLLGGGIRWSIGDAKASLNQNLTQAAPGYAEIPPRPKPKG |
| Ga0209219_11101291 | 3300027565 | Forest Soil | AGGIRWAIGDANASVSPNLKTAAPGYAEIPPPYPPPAK |
| Ga0208990_11405732 | 3300027663 | Forest Soil | FFLNLLAGGIRWSLGDAKADLSQNLLTAAPGYADIPPKFPPAPAK |
| Ga0209011_10685171 | 3300027678 | Forest Soil | LNSLAGGIRWSIGDASAQVDVNLKQAAPGYAEIPPKFPEKK |
| Ga0209448_100526811 | 3300027783 | Bog Forest Soil | LGGGIRWSIGDVDAKVDVNLKEAAPGYAEIPPKFPPEK |
| Ga0209701_105382361 | 3300027862 | Vadose Zone Soil | NLLAGGIRWSIADASAQLDANLKQAAPGYAEIPPKFPAKK |
| Ga0209579_101016581 | 3300027869 | Surface Soil | FFRNLLAGGIRWSIGDAKATLTRNLAEATPGYAEIPPKPAKTT |
| Ga0209465_106113082 | 3300027874 | Tropical Forest Soil | TVVLGGGIRWAIGDASANVETNLKEAAPGYSEIPPKESAAK |
| Ga0209590_108254811 | 3300027882 | Vadose Zone Soil | ENWKNEFFLNLLAGGIRWTIGNASARLDANLKQAAPGYAEIPPKFPGEK |
| Ga0209067_103866411 | 3300027898 | Watersheds | FFLNVLGGGIRWAIGDANAQVDVNLKQAAPGYAEIPPKFPPEKK |
| Ga0209006_109425611 | 3300027908 | Forest Soil | QPENWEIPFFVNVLGGGIRWAISDVNAKIDGNIAQAAPGYAVIPPKFPPKST |
| Ga0209526_101944782 | 3300028047 | Forest Soil | GGGIRWSIRDAKASLDKNLAQATPGYAEIPPKSPAKT |
| Ga0209526_101953361 | 3300028047 | Forest Soil | ENWKNEFFVNLLGGGIRWAIGDASGQLDANLKRAAPGYAEIPPPQPPGK |
| Ga0302301_10570922 | 3300028731 | Palsa | VGGGIRWAIGDASAALDQNLIKVAPGYSTIPPEFPPKK |
| Ga0302224_100791612 | 3300028759 | Palsa | FVNVVGGGIRWAIGDASAALDQNLIKVAPGYSTIPPEFPPKK |
| Ga0302230_104470282 | 3300028871 | Palsa | PFFVNVVGGGIRWAIGDASAALDQNLIKVAPGYSTIPPEFPPKK |
| Ga0170823_169953652 | 3300031128 | Forest Soil | IRWAISDVNAKIDSNITQAAPGYAVIPPKFPPSTK |
| Ga0170820_167401042 | 3300031446 | Forest Soil | FVNLLGGGLRWAIGDVKADLTKNIKQAAPGFATIPPKYKTKEE |
| Ga0310686_1056404142 | 3300031708 | Soil | AMGDLAENWEIPFFVNVVGGGIRWAIGDANAKLDSNVTQAAPGYAVIPPKFPPSAK |
| Ga0307474_104604692 | 3300031718 | Hardwood Forest Soil | IPFFVNVLGGGIRWAISDVNAKIDGNITQAAPGYAVIPPKFPPKST |
| Ga0307469_101452953 | 3300031720 | Hardwood Forest Soil | LGGGIRWAIGDAKAQVDVNLKEAAPGYADIPPKFPPEKK |
| Ga0307469_101856192 | 3300031720 | Hardwood Forest Soil | TFFLNVLGGGIRWSIGDAKASLDKNLAQATPGYAEIPPKPPAKA |
| Ga0307469_102961632 | 3300031720 | Hardwood Forest Soil | FFLNLLGGGIRWAIGDASAQVDANLKQAAPGYAEIPPPQPPGK |
| Ga0307469_125173171 | 3300031720 | Hardwood Forest Soil | WQNEFHLHLLAGGIRWSMGDAKASIPVNLKTAAPGYAEIPPKYPPDTK |
| Ga0307475_102639331 | 3300031754 | Hardwood Forest Soil | FLNLLAGGIRWSIGDAAAQLDANVKQAAPGYAEIPPKFPEKK |
| Ga0307473_109330341 | 3300031820 | Hardwood Forest Soil | PENWPIPFFVNHLAGGIGWSIGNAKASVDKNLAQATPGYAEIPPKG |
| Ga0306926_121085821 | 3300031954 | Soil | ENWSNDFFLNLLGGGIRWAIGDAQTSLTQNLMQVAPGYAEIPPKPLPKT |
| Ga0307479_110297421 | 3300031962 | Hardwood Forest Soil | NKFFLNLLAGGIRWSIGDADAQLDANLKQAAPGYAEIPPKFPAAK |
| Ga0306922_114338691 | 3300032001 | Soil | LAGGIRWATRDVDASNPPNLQTAAPGYAEIPPKYPSEK |
| Ga0307470_100474281 | 3300032174 | Hardwood Forest Soil | IPFFVNLLGGGIRWSIGDVNAKVDGNITQAAPGYAVIPPKFPAAKK |
| Ga0307471_1000845391 | 3300032180 | Hardwood Forest Soil | NWSSPFFLNVLGGGIRWAIGDAKASLNQNLMQAAPGYAEIPPKPKPKG |
| Ga0307471_1025014441 | 3300032180 | Hardwood Forest Soil | FLNLLGGGIRWSIGDAKASLTKNLAQATPGYAEIPPKLPAKT |
| Ga0310812_100056911 | 3300032421 | Soil | NEFFLNLLSGGIRWTIGDVKASLQSNIKQAAPGYAEIPPKS |
| Ga0326726_100066561 | 3300033433 | Peat Soil | GGIRWSIGDAKASLDKNLAQATPGYAEIPPKPPAKA |
| ⦗Top⦘ |