


| Basic Information | |
|---|---|
| Family ID | F031018 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 183 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MQGTAEFHHQIADALLPQADPVFHDATALDTAVDMLDPQPT |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 183 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 88.89 % |
| % of genes near scaffold ends (potentially truncated) | 69.95 % |
| % of genes from short scaffolds (< 2000 bps) | 86.34 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.596 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (38.251 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.180 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.481 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 183 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 2.73 |
| PF12759 | HTH_Tnp_IS1 | 2.19 |
| PF00496 | SBP_bac_5 | 1.64 |
| PF13610 | DDE_Tnp_IS240 | 1.09 |
| PF16868 | NMT1_3 | 1.09 |
| PF01850 | PIN | 1.09 |
| PF13613 | HTH_Tnp_4 | 1.09 |
| PF13546 | DDE_5 | 1.09 |
| PF13358 | DDE_3 | 1.09 |
| PF03400 | DDE_Tnp_IS1 | 1.09 |
| PF01797 | Y1_Tnp | 1.09 |
| PF06114 | Peptidase_M78 | 1.09 |
| PF00106 | adh_short | 0.55 |
| PF13470 | PIN_3 | 0.55 |
| PF04255 | DUF433 | 0.55 |
| PF04365 | BrnT_toxin | 0.55 |
| PF03743 | TrbI | 0.55 |
| PF14294 | DUF4372 | 0.55 |
| PF02852 | Pyr_redox_dim | 0.55 |
| PF05239 | PRC | 0.55 |
| PF02669 | KdpC | 0.55 |
| PF13359 | DDE_Tnp_4 | 0.55 |
| PF00534 | Glycos_transf_1 | 0.55 |
| PF13592 | HTH_33 | 0.55 |
| PF00078 | RVT_1 | 0.55 |
| PF12695 | Abhydrolase_5 | 0.55 |
| PF14104 | DUF4277 | 0.55 |
| PF07859 | Abhydrolase_3 | 0.55 |
| PF03781 | FGE-sulfatase | 0.55 |
| PF03050 | DDE_Tnp_IS66 | 0.55 |
| PF07042 | TrfA | 0.55 |
| PF01927 | Mut7-C | 0.55 |
| PF13586 | DDE_Tnp_1_2 | 0.55 |
| PF01656 | CbiA | 0.55 |
| PF14319 | Zn_Tnp_IS91 | 0.55 |
| PF01609 | DDE_Tnp_1 | 0.55 |
| PF02371 | Transposase_20 | 0.55 |
| PF05567 | Neisseria_PilC | 0.55 |
| PF00872 | Transposase_mut | 0.55 |
| PF00589 | Phage_integrase | 0.55 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.55 |
| PF11455 | MazE-like | 0.55 |
| PF00076 | RRM_1 | 0.55 |
| PF04909 | Amidohydro_2 | 0.55 |
| PF00296 | Bac_luciferase | 0.55 |
| PF00691 | OmpA | 0.55 |
| PF00480 | ROK | 0.55 |
| PF00079 | Serpin | 0.55 |
| PF01610 | DDE_Tnp_ISL3 | 0.55 |
| PF13683 | rve_3 | 0.55 |
| PF10282 | Lactonase | 0.55 |
| PF10431 | ClpB_D2-small | 0.55 |
| PF01047 | MarR | 0.55 |
| PF01527 | HTH_Tnp_1 | 0.55 |
| PF07040 | DUF1326 | 0.55 |
| PF01425 | Amidase | 0.55 |
| PF00126 | HTH_1 | 0.55 |
| PF13506 | Glyco_transf_21 | 0.55 |
| PF00561 | Abhydrolase_1 | 0.55 |
| COG ID | Name | Functional Category | % Frequency in 183 Family Scaffolds |
|---|---|---|---|
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 1.09 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.09 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 1.09 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.55 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.55 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG1656 | Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domain | General function prediction only [R] | 0.55 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.55 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 0.55 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.55 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.55 |
| COG2948 | Type IV secretory pathway, VirB10 component | Intracellular trafficking, secretion, and vesicular transport [U] | 0.55 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.55 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.55 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.55 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.55 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.55 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.55 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.55 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.55 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.60 % |
| Unclassified | root | N/A | 22.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10012229 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300000955|JGI1027J12803_102345553 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300000955|JGI1027J12803_103297572 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300000956|JGI10216J12902_123282216 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300001686|C688J18823_10845916 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100503316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1088 | Open in IMG/M |
| 3300004268|Ga0066398_10223654 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004633|Ga0066395_10298581 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300005179|Ga0066684_10899377 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005187|Ga0066675_10409687 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300005294|Ga0065705_10444303 | Not Available | 832 | Open in IMG/M |
| 3300005364|Ga0070673_101994930 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005445|Ga0070708_102214814 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005467|Ga0070706_100978439 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300005518|Ga0070699_100151651 | All Organisms → cellular organisms → Bacteria | 2050 | Open in IMG/M |
| 3300005518|Ga0070699_100203211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia carboxidovorans → Afipia carboxidovorans OM5 | 1762 | Open in IMG/M |
| 3300005547|Ga0070693_101428394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum | 539 | Open in IMG/M |
| 3300005713|Ga0066905_101800655 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300006049|Ga0075417_10210717 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300006845|Ga0075421_102339203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300006854|Ga0075425_100208089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2249 | Open in IMG/M |
| 3300006854|Ga0075425_101052524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 927 | Open in IMG/M |
| 3300006854|Ga0075425_102160795 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300006871|Ga0075434_100252987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1781 | Open in IMG/M |
| 3300006969|Ga0075419_11178104 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009012|Ga0066710_101480472 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300009038|Ga0099829_10045757 | All Organisms → cellular organisms → Bacteria | 3215 | Open in IMG/M |
| 3300009038|Ga0099829_11222574 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300009038|Ga0099829_11535567 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300009088|Ga0099830_10814513 | Not Available | 771 | Open in IMG/M |
| 3300009089|Ga0099828_10217532 | All Organisms → cellular organisms → Bacteria | 1707 | Open in IMG/M |
| 3300009089|Ga0099828_11467202 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300009090|Ga0099827_10452111 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300009090|Ga0099827_10638867 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300009090|Ga0099827_10847765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 791 | Open in IMG/M |
| 3300009090|Ga0099827_11030814 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009090|Ga0099827_11425803 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009090|Ga0099827_11689169 | Not Available | 552 | Open in IMG/M |
| 3300009094|Ga0111539_10127034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2987 | Open in IMG/M |
| 3300009094|Ga0111539_11349328 | Not Available | 827 | Open in IMG/M |
| 3300009094|Ga0111539_11999137 | Not Available | 672 | Open in IMG/M |
| 3300009098|Ga0105245_13270508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae → Methylocaldum | 502 | Open in IMG/M |
| 3300009100|Ga0075418_11222892 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300009100|Ga0075418_11941656 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300009100|Ga0075418_12707536 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300009100|Ga0075418_12761670 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009101|Ga0105247_10021421 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
| 3300009143|Ga0099792_10353962 | Not Available | 887 | Open in IMG/M |
| 3300009143|Ga0099792_11117721 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009147|Ga0114129_12358846 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009553|Ga0105249_11544039 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300009815|Ga0105070_1006466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1842 | Open in IMG/M |
| 3300009818|Ga0105072_1096163 | Not Available | 591 | Open in IMG/M |
| 3300009820|Ga0105085_1078802 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300009821|Ga0105064_1038297 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300009836|Ga0105068_1011951 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300010046|Ga0126384_10496605 | Not Available | 1051 | Open in IMG/M |
| 3300010047|Ga0126382_11530953 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300010358|Ga0126370_11969921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 570 | Open in IMG/M |
| 3300010359|Ga0126376_10689153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 981 | Open in IMG/M |
| 3300010359|Ga0126376_12613334 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010360|Ga0126372_10858232 | Not Available | 906 | Open in IMG/M |
| 3300010361|Ga0126378_13207666 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300010397|Ga0134124_12071049 | Not Available | 607 | Open in IMG/M |
| 3300010398|Ga0126383_12764785 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010399|Ga0134127_13172731 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011119|Ga0105246_11962415 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300011271|Ga0137393_11067295 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300012096|Ga0137389_10601345 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300012096|Ga0137389_11051726 | Not Available | 697 | Open in IMG/M |
| 3300012096|Ga0137389_11703226 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012167|Ga0137319_1116274 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300012189|Ga0137388_11415995 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012199|Ga0137383_10113793 | All Organisms → cellular organisms → Bacteria | 1970 | Open in IMG/M |
| 3300012199|Ga0137383_10466418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 925 | Open in IMG/M |
| 3300012199|Ga0137383_10639581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium AC-409-J13_OGT_754m | 778 | Open in IMG/M |
| 3300012199|Ga0137383_10810548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300012201|Ga0137365_10497258 | Not Available | 896 | Open in IMG/M |
| 3300012201|Ga0137365_10500922 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012204|Ga0137374_10684048 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012206|Ga0137380_11544955 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012207|Ga0137381_10158832 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300012207|Ga0137381_10295573 | All Organisms → cellular organisms → Bacteria | 1410 | Open in IMG/M |
| 3300012209|Ga0137379_10850439 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012210|Ga0137378_10955313 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300012212|Ga0150985_109458671 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300012212|Ga0150985_120216393 | Not Available | 854 | Open in IMG/M |
| 3300012349|Ga0137387_10584399 | Not Available | 810 | Open in IMG/M |
| 3300012353|Ga0137367_11053242 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012354|Ga0137366_10420395 | Not Available | 972 | Open in IMG/M |
| 3300012356|Ga0137371_10691016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 781 | Open in IMG/M |
| 3300012357|Ga0137384_10849037 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012358|Ga0137368_10537936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 749 | Open in IMG/M |
| 3300012359|Ga0137385_11347569 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300012360|Ga0137375_10620420 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300012361|Ga0137360_10078642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2466 | Open in IMG/M |
| 3300012362|Ga0137361_10140617 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 2147 | Open in IMG/M |
| 3300012362|Ga0137361_10890364 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300012362|Ga0137361_11389046 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012362|Ga0137361_11429951 | Not Available | 614 | Open in IMG/M |
| 3300012363|Ga0137390_10427747 | Not Available | 1301 | Open in IMG/M |
| 3300012469|Ga0150984_112196969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1297 | Open in IMG/M |
| 3300012469|Ga0150984_116251819 | Not Available | 1032 | Open in IMG/M |
| 3300012483|Ga0157337_1002016 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300012532|Ga0137373_10975149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 616 | Open in IMG/M |
| 3300012912|Ga0157306_10389673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012914|Ga0157297_10417253 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012918|Ga0137396_10423641 | Not Available | 987 | Open in IMG/M |
| 3300012929|Ga0137404_10997109 | Not Available | 766 | Open in IMG/M |
| 3300012930|Ga0137407_10919543 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300012944|Ga0137410_10102772 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 2121 | Open in IMG/M |
| 3300012944|Ga0137410_10360477 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300012948|Ga0126375_10231490 | Not Available | 1237 | Open in IMG/M |
| 3300012987|Ga0164307_10111150 | Not Available | 1737 | Open in IMG/M |
| 3300015053|Ga0137405_1330322 | Not Available | 6918 | Open in IMG/M |
| 3300015053|Ga0137405_1397029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3649 | Open in IMG/M |
| 3300015245|Ga0137409_10243213 | All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Candidatus Omnitrophica bacterium | 1601 | Open in IMG/M |
| 3300015245|Ga0137409_10860269 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300015358|Ga0134089_10351099 | Not Available | 621 | Open in IMG/M |
| 3300017940|Ga0187853_10423406 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300018056|Ga0184623_10377295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 630 | Open in IMG/M |
| 3300018466|Ga0190268_10707224 | Not Available | 741 | Open in IMG/M |
| 3300018466|Ga0190268_11321113 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300018481|Ga0190271_12805635 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300019255|Ga0184643_1035377 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021086|Ga0179596_10626434 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300021406|Ga0210386_11450448 | Not Available | 574 | Open in IMG/M |
| 3300025910|Ga0207684_10067434 | All Organisms → cellular organisms → Bacteria | 3041 | Open in IMG/M |
| 3300025910|Ga0207684_10622626 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300025910|Ga0207684_11160183 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300025939|Ga0207665_10810376 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300026041|Ga0207639_10960229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 800 | Open in IMG/M |
| 3300026075|Ga0207708_10720568 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300027032|Ga0209877_1003268 | Not Available | 1290 | Open in IMG/M |
| 3300027646|Ga0209466_1083807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 644 | Open in IMG/M |
| 3300027671|Ga0209588_1153438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 729 | Open in IMG/M |
| 3300027846|Ga0209180_10422858 | Not Available | 753 | Open in IMG/M |
| 3300027846|Ga0209180_10553449 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300027873|Ga0209814_10271624 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027874|Ga0209465_10412866 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300027875|Ga0209283_10512564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 770 | Open in IMG/M |
| 3300027875|Ga0209283_10621955 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300027880|Ga0209481_10173248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1072 | Open in IMG/M |
| 3300027882|Ga0209590_10084983 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300027882|Ga0209590_10415325 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300027882|Ga0209590_10652146 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027882|Ga0209590_10731847 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300027882|Ga0209590_10820637 | Not Available | 590 | Open in IMG/M |
| 3300027907|Ga0207428_10754303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 693 | Open in IMG/M |
| 3300028597|Ga0247820_10963898 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300029951|Ga0311371_10956880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1026 | Open in IMG/M |
| 3300030829|Ga0308203_1037833 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300030904|Ga0308198_1090738 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031093|Ga0308197_10347505 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031094|Ga0308199_1000655 | All Organisms → cellular organisms → Bacteria | 3243 | Open in IMG/M |
| 3300031114|Ga0308187_10039083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300031125|Ga0308182_1002725 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. | 1124 | Open in IMG/M |
| 3300031682|Ga0318560_10323379 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300031824|Ga0307413_10632951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella aerolata | 880 | Open in IMG/M |
| 3300031852|Ga0307410_10833684 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300031901|Ga0307406_10918027 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300031901|Ga0307406_11395098 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300031995|Ga0307409_102916593 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300032002|Ga0307416_100591773 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1188 | Open in IMG/M |
| 3300032004|Ga0307414_12012728 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032005|Ga0307411_12108374 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032013|Ga0310906_10052902 | All Organisms → cellular organisms → Bacteria | 2011 | Open in IMG/M |
| 3300032080|Ga0326721_10187883 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300032080|Ga0326721_10746540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 609 | Open in IMG/M |
| 3300032180|Ga0307471_100753776 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300032205|Ga0307472_101346777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 690 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 38.25% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.65% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.46% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 4.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.28% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.73% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.09% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.55% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.55% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.55% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.55% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.55% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012167 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT333_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031125 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_153 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032080 | Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_100122291 | 3300000858 | Soil | MQGTAQFHHEITDARLPQPDPVFHNAAALDAAVDMLNPQPAV |
| JGI1027J12803_1023455532 | 3300000955 | Soil | MQGTADFHNDIADALLPQPDPIFDDAATLDTAVDMLDPEPAIVQCLVGELLLQQ* |
| JGI1027J12803_1032975721 | 3300000955 | Soil | MVQGTTACQDEITDALLPQADPVLHDAAALDTAVDMLDPQ |
| JGI10216J12902_1232822162 | 3300000956 | Soil | MQGTADLHHQIADALLPQPDPVFDKATALHTAVHMLA |
| C688J18823_108459162 | 3300001686 | Soil | MQGTADFHHDITDALLPQVDPVFDDAATLDTAVDMLDPQSAGVEGLVGSLLRQWQLVVSWSA* |
| JGIcombinedJ26739_1005033162 | 3300002245 | Forest Soil | MQXTADFHHQITDAPLPQPNPIFDDATALDTTIDMLNSKTAVMQ* |
| Ga0066398_102236541 | 3300004268 | Tropical Forest Soil | VQGTAQFHHEIADTLLPQAHAVFDDATALDTAVDMLDPEPPLVER |
| Ga0066395_102985813 | 3300004633 | Tropical Forest Soil | MMQITAEFHHQSADTLLPQAEPVFDNATALHTAVDMLDP* |
| Ga0066684_108993771 | 3300005179 | Soil | MERTTEFHHEITDAVLPQPEPVFRDAAALDTAVDRLDPQPTLV |
| Ga0066675_104096872 | 3300005187 | Soil | MQATADFHHEIADTRLPQADPVLHDPTVLDTAVDMLDPQPTLVQ |
| Ga0065705_101580644 | 3300005294 | Switchgrass Rhizosphere | MQGTADLHHQSADTLLPQADAVFDDATALDTAIDMLDPQP |
| Ga0065705_104443033 | 3300005294 | Switchgrass Rhizosphere | MQGTADFHNDIADALLPQPDPIFDDAATLDTAVDMLDPEPAIVQCLVGELLLQQ |
| Ga0070673_1019949302 | 3300005364 | Switchgrass Rhizosphere | MQGTADFHHDITNALFPQADPIFDDATTLDTAVDMLDPQSA |
| Ga0070708_1022148141 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTTEFHDQIADTLLPQADPVLHDAAALDTAIDVLDAQPTL |
| Ga0070706_1009784391 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTAEFHHEIAHAVLPQPDPVFDDATTLHATVDMLDPQPT |
| Ga0070698_1007846542 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTADLHHHIADALLPEADPIFHNATTLHATVDMLDAERVSISD* |
| Ga0070699_1001516511 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTTDFHHEIADALLPQAEPVFDHAATLDTTVDMLDPQP |
| Ga0070699_1002032113 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTTEFHHQITDPLFPQADPVFHDATALHTTIDMLDPEPPL |
| Ga0070693_1014283941 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MVQGTTARQDEITDALLPQADPVFDDATALDTAVDMLDPQSAGVERLVGSLLRR* |
| Ga0066905_1018006551 | 3300005713 | Tropical Forest Soil | MQGTAEFHHQIADALLPQADPVFHDATALDTAVDMLDPQPT |
| Ga0075417_102107172 | 3300006049 | Populus Rhizosphere | MQGTADLHHHIADALLPQADPVFDDATALDTAVDRLDP* |
| Ga0075421_1023392032 | 3300006845 | Populus Rhizosphere | MQGTADFHHDIPDALLPQADPVFDDATALDAAVDMLDPQSAGVERLVGSLL |
| Ga0075425_1002080892 | 3300006854 | Populus Rhizosphere | MQGTVEFHPEIADTVHPQPDPVFDDTTALDAAVDMLDP* |
| Ga0075425_1010525243 | 3300006854 | Populus Rhizosphere | MQGAADFHHQIADTRLPQADPVFDDAAALDTAVDMLD |
| Ga0075425_1021607951 | 3300006854 | Populus Rhizosphere | QGTAQFHHYITDTCFPQADPVFHDATALHATVDMLN* |
| Ga0075434_1002529871 | 3300006871 | Populus Rhizosphere | MQRTADFHDEIADALLPQTDPVFDDATTFHTAVDMLNPQP |
| Ga0075419_111781042 | 3300006969 | Populus Rhizosphere | MQGTAEFHHQITNPLLPQAEPVLHNATTLDAAVHMLDPE |
| Ga0066710_1014804721 | 3300009012 | Grasslands Soil | MQGTADFHHDIADTFLPQAEPIFHDTAALDTAVDMLDPQ |
| Ga0099829_100457571 | 3300009038 | Vadose Zone Soil | MQGTTDLHDQIADVLFPQADPVFHNATALDTPVDMLNAQSAIVQGL |
| Ga0099829_101298002 | 3300009038 | Vadose Zone Soil | MQGTADVHHQIADTLLPQAESVFDDATALHTPVDMLDPQPT |
| Ga0099829_112225741 | 3300009038 | Vadose Zone Soil | MQSTTDLHHQIADALLPQADPVFDDATALDTTIDMLNPQPAVGERLIGPE* |
| Ga0099829_115355672 | 3300009038 | Vadose Zone Soil | VQGTTEFHHEITDAILPQADPVFDNATTLHAAVDMLDP |
| Ga0099830_108145132 | 3300009088 | Vadose Zone Soil | VQGTTEFHHEIADALLPQADPVLDDAATLDTPVDMLNPQPTLV |
| Ga0099828_102175323 | 3300009089 | Vadose Zone Soil | MERTAAFHHESADALLPEADPVFDEATALDTAVDLLDP* |
| Ga0099828_114672021 | 3300009089 | Vadose Zone Soil | MQGTTECHHEIADAVLPQPDAVFHNAAALDAAIDMLD |
| Ga0099827_104521112 | 3300009090 | Vadose Zone Soil | MQGTADFHYDIADTLFPQPDPIFHDAATFDTAVHMLDPEPAIV* |
| Ga0099827_106388671 | 3300009090 | Vadose Zone Soil | MQGTTAFHHQIADTRLPEADSVFDDATALDTAVHVLDSVTGG |
| Ga0099827_108477651 | 3300009090 | Vadose Zone Soil | TAEFHHQIADALLPQADAVFDNPTVLHTAVDMLDPHRR* |
| Ga0099827_110308141 | 3300009090 | Vadose Zone Soil | MQGTAQFHHEITDALLPEPDPVFHNATTLHATVDM |
| Ga0099827_114258031 | 3300009090 | Vadose Zone Soil | MQGTAQFHDEIANAGLPQADAVFDDATTLHAAVDMLDPEPAIV* |
| Ga0099827_116891692 | 3300009090 | Vadose Zone Soil | MQGTADVHHDITEALLPQTNPVFDKATALDTAVARLAPQPA |
| Ga0111539_101270343 | 3300009094 | Populus Rhizosphere | MLGTADFHHEIAAAVLPQPHPVFDDPTALDAAVDMLDSAADAD* |
| Ga0111539_113493281 | 3300009094 | Populus Rhizosphere | MQGTAQFHHELSDTRLPQPNPVFDDPTTLDTAIHMLDA |
| Ga0111539_119991371 | 3300009094 | Populus Rhizosphere | MQGTAAFHHEIAAPGLPPAAPVFDDAAARDADVDRLAPPPTVV |
| Ga0105245_132705082 | 3300009098 | Miscanthus Rhizosphere | MVQGTTARQDEITDALLPQADPVFDDATALDTAVDMLDPQSAGVE |
| Ga0075418_112228921 | 3300009100 | Populus Rhizosphere | MQGAAEFHHQIADALFPQADAVFDNATALDTAGDMRDPQPAAEQFYALAA* |
| Ga0075418_119416562 | 3300009100 | Populus Rhizosphere | MQCTAEFHHQIAYALVPEADPVFDTATALDTAIDMLNPQPALVQRLVRHVLLQC* |
| Ga0075418_127075361 | 3300009100 | Populus Rhizosphere | MESTTEFHHEITDALLPQADPVFDDATALHTAVDMLNAQSTIVQGLIGQLL |
| Ga0075418_127616702 | 3300009100 | Populus Rhizosphere | TTELHDEITNPHFPQADPIFDDATALHTAIDVLDPPSAMV* |
| Ga0075418_127995921 | 3300009100 | Populus Rhizosphere | RSQPHPDVMQGTATCHHQSTDAVLPQADPVFHNPTALDAAVDMLDS* |
| Ga0105247_100214218 | 3300009101 | Switchgrass Rhizosphere | MQGTADFHYDIADTLFPQPDPIFHDAATLDTAVNMLDPEPTIV* |
| Ga0099792_103539622 | 3300009143 | Vadose Zone Soil | MQGTTEFHHQIADARLSQADPVFDDAAALDTALDRLDPQ |
| Ga0099792_111177211 | 3300009143 | Vadose Zone Soil | VQGTAEFHHQITNARLPQTDPVFDDATAFDATVHMLDAEPALV* |
| Ga0114129_123588461 | 3300009147 | Populus Rhizosphere | MQGTAELHHQITNALLPQADPVFHQTTALDTAIDMLDPQPTLVQGL |
| Ga0075423_106811141 | 3300009162 | Populus Rhizosphere | MQGTTDVHHDIADALLPEADPVFDNATALHATIHVL |
| Ga0105249_115440392 | 3300009553 | Switchgrass Rhizosphere | MVQGTAELHHEIADALLPQADPVLHDATTLDAAVDM |
| Ga0105070_10064661 | 3300009815 | Groundwater Sand | MQSTADLHHNIPHARLPQPDPVFDDATALDTAEGGRP |
| Ga0105072_10961632 | 3300009818 | Groundwater Sand | MQGTTDFHYQIADALLPQTDPVFDDATALDAAVDMLNPQPTAVQ |
| Ga0105085_10788022 | 3300009820 | Groundwater Sand | VQGTAYFHHNITDTLLPQTDPVFDDATTLDTTIDMLDPQPAVVQRLVGHLL |
| Ga0105064_10382973 | 3300009821 | Groundwater Sand | MQSTADLHHNIPDIRLPQPDPVFDDATALDTAVDMLNAEPTLVQCL |
| Ga0105068_10119511 | 3300009836 | Groundwater Sand | MQGTADLHHHIADTRLPQAQPVFDNATALDTTVDMLDA |
| Ga0126384_104966052 | 3300010046 | Tropical Forest Soil | QRATECHHQITDALLPQADTVFHDATAFDTAVDVLDP* |
| Ga0126382_115309531 | 3300010047 | Tropical Forest Soil | MQSTAEFHDQITDAFFPQADAVFDDATPLDTTIDMLDP |
| Ga0126370_119699212 | 3300010358 | Tropical Forest Soil | MEGTAEFHHEITDALFPQAEPVFHNATTLDAAVDMLDPEPPLV |
| Ga0126376_106891533 | 3300010359 | Tropical Forest Soil | VQGAAEFHHESADALFPQADPVFDDTTTLDTAVDMLDPQPAIVQSLVG* |
| Ga0126376_126133342 | 3300010359 | Tropical Forest Soil | MVQGTAACHHESADALLPQADPVLHHATPFDAAADMLDPQ |
| Ga0126372_108582323 | 3300010360 | Tropical Forest Soil | VEGTAAFHQQIADARLLQAEPVFHDTTALHTAVDMLDPEP |
| Ga0126378_132076661 | 3300010361 | Tropical Forest Soil | MQGATEFHHEITDALLPQPHPVFDNTTTLDTTVDMLDPQ |
| Ga0126377_122785751 | 3300010362 | Tropical Forest Soil | VQGTTEFHHQITDSLLPQADAVFDDATPLDTTIDMLDPQSTL |
| Ga0134124_120710491 | 3300010397 | Terrestrial Soil | MVQGTTARQDEITDALLPQADPVLHDAAALDTAVDMRDPQ |
| Ga0126383_127647851 | 3300010398 | Tropical Forest Soil | MQGTAQFHHEITDALLPQTDPVFDNAAALDTTVDM |
| Ga0134127_131727311 | 3300010399 | Terrestrial Soil | MQGTAAFHHQITDALLPQADAVFHNAIAFDTAVDVLDPSSAIVQ |
| Ga0105246_119624151 | 3300011119 | Miscanthus Rhizosphere | MQGTADFHHDITDILLPQADAVFDDTATLDAAVDMLDPQSAGVERLVGSLLRR |
| Ga0137393_110672951 | 3300011271 | Vadose Zone Soil | MQGTTDFHHQIADALLPQADPVFDDATALDTTIDMLNPQPAVGERLIGPE* |
| Ga0137389_106013451 | 3300012096 | Vadose Zone Soil | MQGTTDFHHQIADALLPQADPVFDDATALDTSIDMLNPQPAVGERLIGPE* |
| Ga0137389_110517262 | 3300012096 | Vadose Zone Soil | MQGTADFHHQIADALLPQAKPVFDDATTLDTPVDMLDAQPTLVQRLVG |
| Ga0137389_117032263 | 3300012096 | Vadose Zone Soil | MQGTTDVHHEIADAVLPQAEPVFPNATALDAPVDLLDPQPTVMQGLV |
| Ga0137319_11162741 | 3300012167 | Soil | VHPEVVQGAAAFHRQIADAFFPEASAVFDNATPLDTAVHVL |
| Ga0137388_114159951 | 3300012189 | Vadose Zone Soil | MQGTAKFHHEIADAVLPQPDPVFDDAAALDAPVDML |
| Ga0137383_101137935 | 3300012199 | Vadose Zone Soil | MQRTAQFHHNIPDPLLPQTDPVFDDATPLDTTIDML |
| Ga0137383_104664181 | 3300012199 | Vadose Zone Soil | MQGTAAFHHEIADALLPQPDPVFDDAAALDAAFDML |
| Ga0137383_106395812 | 3300012199 | Vadose Zone Soil | MQRPAEFHHEIADALLLQAAPVFDDATAFDPAVDMLDP* |
| Ga0137383_108047831 | 3300012199 | Vadose Zone Soil | MQRTTDGHHQIANTLLPQADAVFDDATALATPVAMLDS |
| Ga0137383_108105481 | 3300012199 | Vadose Zone Soil | MQGTADFHHQIADTLLPQADPVFHDATAFDTAVDMLDP* |
| Ga0137365_104972582 | 3300012201 | Vadose Zone Soil | MERTAEFHHNIPDPFLPEADPVFDNATALDTPVDMLNA* |
| Ga0137365_105009221 | 3300012201 | Vadose Zone Soil | MQGTTDFHHEIADALLPQAEPVFDNATTLDTAIDMLDPQ |
| Ga0137374_106840483 | 3300012204 | Vadose Zone Soil | VQGTAQFHHEITDALLPQADPVFHNATALDTAVDMLDPQPTLV |
| Ga0137380_115449552 | 3300012206 | Vadose Zone Soil | MQGTAEFHHEIADTLLPQAEPVLHNTAALDTAIDVLDAQPT |
| Ga0137381_101588323 | 3300012207 | Vadose Zone Soil | MQGTAEFHHEIADAVLPQPDPVFDDTAALDAAVDMLDPEPTVVQ |
| Ga0137381_102955731 | 3300012207 | Vadose Zone Soil | MQGTAQFPHEITDAVLPQPAAVFDDAAAFDAAVDMLDPQPSL |
| Ga0137379_108504391 | 3300012209 | Vadose Zone Soil | MQGTTECQHEIADAVLPQPDAVFHNAAALDAAIDMLDP* |
| Ga0137378_109553131 | 3300012210 | Vadose Zone Soil | MQGTADFHHEIADTGLPQADPVFDDTTALDAAVDMLDPQPTVV |
| Ga0150985_1094586711 | 3300012212 | Avena Fatua Rhizosphere | MQGTADFHHDITNTLLPQADPVFDDATALDTTVDMLDPQSAIVEQ* |
| Ga0150985_1202163931 | 3300012212 | Avena Fatua Rhizosphere | MQGTADFHHAIPDTLLPQADPVFDDATALDAAVDMLDPQSA |
| Ga0137387_105843991 | 3300012349 | Vadose Zone Soil | MQGTAEFHHEIADAVLPQPDPVFDDAAALDAAVDMLDPQPTVV |
| Ga0137367_110532421 | 3300012353 | Vadose Zone Soil | MQGTAEFHHQITNALLPQAEPVLHDAAALDTAVDMLDPQPTVMQGMVG |
| Ga0137366_104203952 | 3300012354 | Vadose Zone Soil | MQGTAEFHHQIANALLPQTDPVFDDATALDATVDMLDAQPTLVQGAA* |
| Ga0137371_106910162 | 3300012356 | Vadose Zone Soil | MQGTTEFHHEIADAVLPQPDAVFHNAAALDAAIDMLDP* |
| Ga0137384_108490371 | 3300012357 | Vadose Zone Soil | MQGTTDFHHEIAYALLPQTDPVFDDATALDTTVHVLDPQPT |
| Ga0137384_108826551 | 3300012357 | Vadose Zone Soil | MQGTADLHHHIADALLPEADPIFHNATALHATVDMLDAEPTLVQ |
| Ga0137368_105379363 | 3300012358 | Vadose Zone Soil | MQGTTEFHHDIADAVLPQPNAVFHDAAALDAAVDMLDAESAMVQ |
| Ga0137385_113475691 | 3300012359 | Vadose Zone Soil | MQGTAAFHHEIADALLPQPDPVFDDAAALDAAVDMLDPQPTV |
| Ga0137375_106204201 | 3300012360 | Vadose Zone Soil | VEGTTDFHHDIADALLPEADPGFDTATALDTAVDMFD |
| Ga0137360_100786424 | 3300012361 | Vadose Zone Soil | MQGTTDFHHEIAGAFLLQAKPVFDDATALHTAVHMLDPQPT |
| Ga0137361_101406172 | 3300012362 | Vadose Zone Soil | MQGTAQFHHDIADALLPQPDPVFDNATALDTAVDMLDP |
| Ga0137361_108903641 | 3300012362 | Vadose Zone Soil | MQDTAEFHHDIADALLPEADPVFDDPTALHTAVDMLDPEPAVVQCLV |
| Ga0137361_113890461 | 3300012362 | Vadose Zone Soil | MERTTDFHHEIADALLPQSDPAFDDATALDTTVDMLDPQPTL |
| Ga0137361_114299511 | 3300012362 | Vadose Zone Soil | VQGTAEFHHQIADILLPQAEPVFDDAATLDTTVATLDPQ |
| Ga0137390_104277473 | 3300012363 | Vadose Zone Soil | MQGTTEFHHEIADAILPQPDPVFHDAAALDAAVDM |
| Ga0150984_1121969691 | 3300012469 | Avena Fatua Rhizosphere | MQGTADFHHDISNALLPQADPVFDDATALDAAVDMLDPQSAGVERLVG |
| Ga0150984_1162518192 | 3300012469 | Avena Fatua Rhizosphere | MQGTADFHHDITDALLPQADFDDATALDTAVDMLDPQSAVVERLVDSLLCQWQLVVSWSA |
| Ga0157337_10020161 | 3300012483 | Arabidopsis Rhizosphere | GTAEFHHQIADACLPQADAVVHDAATLDTTIDMLNP* |
| Ga0137373_109751491 | 3300012532 | Vadose Zone Soil | VQGTAAFHHQITDPLLPQADPVLHYAAALDAPVDRLDPQPTL |
| Ga0157306_103896733 | 3300012912 | Soil | MQGTTDFHHDIPDALFPQADPVFDDTATLDAAVDMLDPQ |
| Ga0157297_104172533 | 3300012914 | Soil | MQGTADFHYDIPDALLPQADAVFDDTATLDAAVDMLDPRAA |
| Ga0137396_104236413 | 3300012918 | Vadose Zone Soil | MQGAAEFHHDITDTLLPQTEAVFDNATTLHAAVDMLDP* |
| Ga0137404_109971092 | 3300012929 | Vadose Zone Soil | MQGTADFHHDIADTFLPQAEPIFHDTAALDTAVDMLDPQPTLV* |
| Ga0137407_109195432 | 3300012930 | Vadose Zone Soil | MQGTAEFHHEIADTVLPQPDPVFDDAAALDAAVDM |
| Ga0137410_101027723 | 3300012944 | Vadose Zone Soil | MQGTVDFYHDIADTLLPQTDPVFDDTTALHAAVDMLDPQPAIVAQI* |
| Ga0137410_103604771 | 3300012944 | Vadose Zone Soil | MQGTAQFHHEIADAVLPQPDPVFDDAAALDATVDM |
| Ga0126375_102314901 | 3300012948 | Tropical Forest Soil | MERTTEFHHEIADTLLPQADPVFDDATALHTAVDMLNA |
| Ga0164307_101111501 | 3300012987 | Soil | MQGTADFHHDITDALLPQADPVFDDATTLDTAVDMLDPQSAIVEHL |
| Ga0137405_13303221 | 3300015053 | Vadose Zone Soil | VQGTAAFHHQITDARLPQADPVFHDATALHTTIDMLDPDIS |
| Ga0137405_13970295 | 3300015053 | Vadose Zone Soil | MQGTTDFHHQIANTLLPQADPVFDDATALHTAVDMLDP* |
| Ga0137409_102432133 | 3300015245 | Vadose Zone Soil | FYHDIADTLLPQTDPVFDDTTALHAAVDMLDPQPAIVAQI* |
| Ga0137409_108602693 | 3300015245 | Vadose Zone Soil | MQGAAEFHHDITDTLLPQTDAVFDNATTLHAAVDML |
| Ga0137403_114080761 | 3300015264 | Vadose Zone Soil | MMQSTTDGHHQTANTLLPQADAVFDEATARDTPVDMLDPPPAV* |
| Ga0134089_103510992 | 3300015358 | Grasslands Soil | VQGATYFHHQIADALLPQANPVFDDATTLDTAVDMLDPQP |
| Ga0182032_105664262 | 3300016357 | Soil | MWGTADLHHQVTDTLLPQANAVFDDPTAFDDTVDMLDLQPTLVELLV |
| Ga0187853_104234062 | 3300017940 | Peatland | MQCAADFHHQISDALLPQPNPIFDDATALDTTIDMLNPKTA |
| Ga0184623_103772951 | 3300018056 | Groundwater Sediment | MERPAEFHHEIADTCLPQADPVFDDATALDTAVDVLDP |
| Ga0190268_107072242 | 3300018466 | Soil | MQGTAEFHHQITDALLPQAYPVLHDAAALDAAVDVL |
| Ga0190268_113211132 | 3300018466 | Soil | VQGTAEFHEQIADALFPQPEAIFDDAAALDTAIDVLD |
| Ga0190271_128056352 | 3300018481 | Soil | MQGTADFHHDIADALLPQADPVFDDAATLDAAVDMLDPQPAGVERLAGSLLRR |
| Ga0184643_10353771 | 3300019255 | Groundwater Sediment | MQGTAEFHDQIADTLLPQADPVFHDATALDATVDML |
| Ga0179596_106264341 | 3300021086 | Vadose Zone Soil | MVQGTAELPHEIADARLPQADPVFDDATALHTAVDMLDPQPTLVERQV |
| Ga0210386_114504481 | 3300021406 | Soil | MQSTADFHHQITDAPLPQPNPIFDDATALDTTIDMLNAKTAVMQ |
| Ga0207684_100674343 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTAEFHHDIADALLPQADPVFDDATALHTTVDMLDP |
| Ga0207684_106226261 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | KVMERTAEFHHEIADALLPEADPVFDDATALDTAVHMLDP |
| Ga0207684_111601832 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTAEFHHEITDALLPQADPVFDDATALHTAVDVLDP |
| Ga0207646_116684061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTADLHHHIADALLPEADPIFHNATTLHATVDMLDAERVSISD |
| Ga0207665_108103762 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDVQGTAECQHDITDSLFPQMEPVFDDAAALDTTVDMLDA |
| Ga0207639_109602292 | 3300026041 | Corn Rhizosphere | MQGTTEFHHEIADAVLPQPDPVFHDTAALDTAVDMLIRS |
| Ga0207708_107205682 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MQGTADFHYDIADTLFPQPEPIFHDAATLDTAVNMLDPEPTIV |
| Ga0209877_10032683 | 3300027032 | Groundwater Sand | MQGTTEFHHKIADAFLPQPDPVLHDAAALDAAVDMLDPQ |
| Ga0209466_10838071 | 3300027646 | Tropical Forest Soil | MQRAADFHHQIADARLPQAAGIVDDATALDTAVDMLDA |
| Ga0209588_11534383 | 3300027671 | Vadose Zone Soil | MQGTADFHHDIADTFLPQAEPIFHDTAALDTAVDMLDPQP |
| Ga0209180_104228582 | 3300027846 | Vadose Zone Soil | MQGTTEFHHQIADARLPQADPVFDDAAALDTALDRLDP |
| Ga0209180_105534492 | 3300027846 | Vadose Zone Soil | MQGTAEFHHQIADARLPQADPVFHDATALDTAVDMLDP |
| Ga0209814_102716242 | 3300027873 | Populus Rhizosphere | MQGTADLHHHIADALLPQADPVFDDATALDTAVDRLDP |
| Ga0209465_104128662 | 3300027874 | Tropical Forest Soil | MMQITAEFHHQSADTLLPQAEPVFDNATALHTAVDMLDP |
| Ga0209283_105125641 | 3300027875 | Vadose Zone Soil | MQSTTDFHHEITDTLLPQPDPVFDDATALDTTVDMLDP |
| Ga0209283_106219551 | 3300027875 | Vadose Zone Soil | MQGTAEFHHQIADTLLPQADPVFDDAATLDTTVDM |
| Ga0209481_101732482 | 3300027880 | Populus Rhizosphere | MWGTTDFHHQITDARLPQTDSVFHDAAALDTTVDMLDPQPTLV |
| Ga0209590_100849831 | 3300027882 | Vadose Zone Soil | MQGTAEFHHEIADAVLPQPDPVFDDAAALDATVDML |
| Ga0209590_104153252 | 3300027882 | Vadose Zone Soil | MQRTADFHHEIADALLPQTDPVFDDATTLHTAVHMLDP |
| Ga0209590_106521461 | 3300027882 | Vadose Zone Soil | MQGTAQFHHEITDALLPEPDPVFHNATTLHATVDMLD |
| Ga0209590_107318472 | 3300027882 | Vadose Zone Soil | VQGTTEFHHQIADALLPEAKAVFDDATALDTTINMLDAQPSVVQRL |
| Ga0209590_108206372 | 3300027882 | Vadose Zone Soil | MQGTTDFHHQITDARLPQADPVFHDATALHTTVDMLD |
| Ga0207428_107543032 | 3300027907 | Populus Rhizosphere | MLGTADFHHEIAAAVLPQPHPVFDDPTALDAAVDMLDSAADAD |
| Ga0247820_109638981 | 3300028597 | Soil | MQRTADFHYDITDTLLPQADAVFDDATALDTAVDMLDPQSARVERLVGSLLRR |
| Ga0311371_109568803 | 3300029951 | Palsa | MKSTAEFHHQIADALPPQADTVFDDPTTFDTTVDMFDPQPAVMQRPD |
| Ga0308203_10378331 | 3300030829 | Soil | MQGTTEFHHEIADAVLPQPDPVFDDTAALDAAVDMLDP |
| Ga0308198_10907381 | 3300030904 | Soil | MQGTAEFHHQITDALFPQAHPVFDDATALDTAVDVLDA |
| Ga0308197_103475052 | 3300031093 | Soil | MQGTTKFHHEIADAVLPQPDPVFHDAAALDAAVHMLDP |
| Ga0308199_10006554 | 3300031094 | Soil | MQGTAEFHHQITDALFPQAHPVFDDATALDTAVDVLD |
| Ga0308187_100390831 | 3300031114 | Soil | MQGTADFHHEIADTFLPQTDPIFNDATALDTTVGMLDPKPMLVQRLV |
| Ga0308182_10027253 | 3300031125 | Soil | MELTAEFHHEIADALLPQANPVFDDAAALDTTVDMLDPQ |
| Ga0318560_103233793 | 3300031682 | Soil | QRVMQGTAEFHHEIADPLLPQADTVFDDAAALDVE |
| Ga0307413_106329511 | 3300031824 | Rhizosphere | MQGTADFHHDITDTLLPQADPVFDDATTLDAAVDMLDPQSAGMERLVGSLLRQW |
| Ga0307410_108336842 | 3300031852 | Rhizosphere | MQGTADFHHDIADALLPQADPVLDDATALDTAVDMLDPQPAG |
| Ga0306919_106847852 | 3300031879 | Soil | MQGTAELHREIADALLPQADPVFHHATTEDVSEVL |
| Ga0307406_109180273 | 3300031901 | Rhizosphere | HHAITDALLPQADPVFDDATALDTAVDRLDPQSAGVERLVGSLLRP |
| Ga0307406_113950981 | 3300031901 | Rhizosphere | MQGTAEFHHQIADARLPQADPVFHNAAALDTAVDML |
| Ga0307409_1029165932 | 3300031995 | Rhizosphere | MQGTADFHHDIPDALLPQADPVLDDATALDTAVDMLDPQSARVER |
| Ga0307416_1005917731 | 3300032002 | Rhizosphere | MQGTAEFHHQIADARHPQAEPVCDDTTALATPVDRLDPQPAVREGLI |
| Ga0307414_120127281 | 3300032004 | Rhizosphere | MQGTADFHHDITDTLLPQVDPVFDDATALDAAVDVLDPQSAGVERLGGSLL |
| Ga0307411_121083741 | 3300032005 | Rhizosphere | MQGTADFHYDIPDALLPQADPVFDDATALDTAVDRLD |
| Ga0310906_100529021 | 3300032013 | Soil | MQGAAEFHHQIADALFPQADAVFDNATALDTAGDMRDPQPAAEQFY |
| Ga0326721_101878831 | 3300032080 | Soil | MQGTADFHHAITDAPLPQADPVFDDATALDAAVDMLDPQSAGVERLVGS |
| Ga0326721_107465401 | 3300032080 | Soil | MQGTADFHHDIPDALLPQADPVLDDAATLDTAVDMLDP |
| Ga0307471_1007537763 | 3300032180 | Hardwood Forest Soil | MEGTAEFHYQIADALLPQANPVFHDATTLDTAVDVLDP |
| Ga0307472_1013467772 | 3300032205 | Hardwood Forest Soil | HPEVVQGTTEFHHEITDAVLPQSDPVFDDTTALHAAIDMLDA |
| ⦗Top⦘ |