


| Basic Information | |
|---|---|
| Family ID | F030842 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 184 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MEVPMTMHGDHHITDAEDAAFDATMKIMGVVMVLVVIAGMALWYIYS |
| Number of Associated Samples | 140 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.11 % |
| % of genes near scaffold ends (potentially truncated) | 21.20 % |
| % of genes from short scaffolds (< 2000 bps) | 85.33 % |
| Associated GOLD sequencing projects | 131 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (51.630 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.891 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.065 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.913 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.00% β-sheet: 0.00% Coil/Unstructured: 52.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF12244 | DUF3606 | 4.89 |
| PF01058 | Oxidored_q6 | 3.26 |
| PF07859 | Abhydrolase_3 | 1.63 |
| PF14196 | ATC_hydrolase | 1.63 |
| PF07884 | VKOR | 1.63 |
| PF04828 | GFA | 1.63 |
| PF09917 | DUF2147 | 1.09 |
| PF01135 | PCMT | 1.09 |
| PF00154 | RecA | 1.09 |
| PF13188 | PAS_8 | 1.09 |
| PF00072 | Response_reg | 0.54 |
| PF00106 | adh_short | 0.54 |
| PF10025 | DUF2267 | 0.54 |
| PF00795 | CN_hydrolase | 0.54 |
| PF04392 | ABC_sub_bind | 0.54 |
| PF00817 | IMS | 0.54 |
| PF05239 | PRC | 0.54 |
| PF02446 | Glyco_hydro_77 | 0.54 |
| PF00400 | WD40 | 0.54 |
| PF07681 | DoxX | 0.54 |
| PF02481 | DNA_processg_A | 0.54 |
| PF08388 | GIIM | 0.54 |
| PF00872 | Transposase_mut | 0.54 |
| PF00005 | ABC_tran | 0.54 |
| PF13517 | FG-GAP_3 | 0.54 |
| PF13361 | UvrD_C | 0.54 |
| PF02411 | MerT | 0.54 |
| PF11749 | DUF3305 | 0.54 |
| PF11604 | CusF_Ec | 0.54 |
| PF04239 | DUF421 | 0.54 |
| PF13505 | OMP_b-brl | 0.54 |
| PF07690 | MFS_1 | 0.54 |
| PF00857 | Isochorismatase | 0.54 |
| PF00346 | Complex1_49kDa | 0.54 |
| PF12867 | DinB_2 | 0.54 |
| PF07366 | SnoaL | 0.54 |
| PF08543 | Phos_pyr_kin | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0377 | NADH:ubiquinone oxidoreductase 20 kD subunit (chain B) or related Fe-S oxidoreductase | Energy production and conversion [C] | 3.26 |
| COG1740 | Ni,Fe-hydrogenase I small subunit | Energy production and conversion [C] | 3.26 |
| COG1941 | Coenzyme F420-reducing hydrogenase, gamma subunit | Energy production and conversion [C] | 3.26 |
| COG3260 | Ni,Fe-hydrogenase III small subunit | Energy production and conversion [C] | 3.26 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 1.63 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 1.63 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 1.63 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 1.09 |
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.09 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.09 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.09 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 1.09 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.09 |
| COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.54 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.54 |
| COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.54 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.54 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.54 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.54 |
| COG1640 | 4-alpha-glucanotransferase | Carbohydrate transport and metabolism [G] | 0.54 |
| COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.54 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.54 |
| COG2323 | Uncharacterized membrane protein YcaP, DUF421 family | Function unknown [S] | 0.54 |
| COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.54 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.54 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.54 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.17 % |
| Unclassified | root | N/A | 47.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16725976 | Not Available | 1210 | Open in IMG/M |
| 3300000956|JGI10216J12902_101864305 | Not Available | 1071 | Open in IMG/M |
| 3300001180|JGI12695J13573_1003819 | Not Available | 1014 | Open in IMG/M |
| 3300001661|JGI12053J15887_10056714 | Not Available | 2182 | Open in IMG/M |
| 3300001867|JGI12627J18819_10004658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5170 | Open in IMG/M |
| 3300001867|JGI12627J18819_10107860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1148 | Open in IMG/M |
| 3300001867|JGI12627J18819_10190983 | Not Available | 828 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100243941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1685 | Open in IMG/M |
| 3300002757|JGI25524J39351_100297 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
| 3300002757|JGI25524J39351_100306 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300002906|JGI25614J43888_10161473 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300002910|JGI25615J43890_1006859 | All Organisms → cellular organisms → Bacteria | 1772 | Open in IMG/M |
| 3300002910|JGI25615J43890_1015460 | Not Available | 1250 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10260763 | Not Available | 704 | Open in IMG/M |
| 3300004479|Ga0062595_101334156 | Not Available | 648 | Open in IMG/M |
| 3300005167|Ga0066672_10663712 | Not Available | 672 | Open in IMG/M |
| 3300005172|Ga0066683_10036282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2864 | Open in IMG/M |
| 3300005174|Ga0066680_10608539 | Not Available | 683 | Open in IMG/M |
| 3300005178|Ga0066688_10173380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1360 | Open in IMG/M |
| 3300005181|Ga0066678_10096274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1783 | Open in IMG/M |
| 3300005187|Ga0066675_10040647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2803 | Open in IMG/M |
| 3300005435|Ga0070714_101888003 | Not Available | 583 | Open in IMG/M |
| 3300005435|Ga0070714_102395039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
| 3300005436|Ga0070713_100718968 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300005437|Ga0070710_11002175 | Not Available | 609 | Open in IMG/M |
| 3300005445|Ga0070708_101693572 | Not Available | 588 | Open in IMG/M |
| 3300005447|Ga0066689_10203686 | Not Available | 1202 | Open in IMG/M |
| 3300005447|Ga0066689_10903910 | Not Available | 546 | Open in IMG/M |
| 3300005467|Ga0070706_102096984 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005471|Ga0070698_100101030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2856 | Open in IMG/M |
| 3300005518|Ga0070699_100428803 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005536|Ga0070697_100003728 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11700 | Open in IMG/M |
| 3300005559|Ga0066700_10478885 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005764|Ga0066903_101283675 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300006173|Ga0070716_101581099 | Not Available | 538 | Open in IMG/M |
| 3300006175|Ga0070712_100147850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1800 | Open in IMG/M |
| 3300006755|Ga0079222_12237922 | Not Available | 544 | Open in IMG/M |
| 3300006797|Ga0066659_10565693 | Not Available | 920 | Open in IMG/M |
| 3300006800|Ga0066660_10463172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Undibacter → Undibacter mobilis | 1061 | Open in IMG/M |
| 3300006804|Ga0079221_11303529 | Not Available | 571 | Open in IMG/M |
| 3300006845|Ga0075421_101281182 | Not Available | 813 | Open in IMG/M |
| 3300006845|Ga0075421_101975586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300006852|Ga0075433_11049782 | Not Available | 709 | Open in IMG/M |
| 3300006854|Ga0075425_100246733 | Not Available | 2054 | Open in IMG/M |
| 3300006854|Ga0075425_100390404 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300006871|Ga0075434_100388471 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300006904|Ga0075424_100341174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Rugamonas → Rugamonas brunnea | 1596 | Open in IMG/M |
| 3300006904|Ga0075424_101678929 | Not Available | 673 | Open in IMG/M |
| 3300006914|Ga0075436_100465898 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300007255|Ga0099791_10436318 | Not Available | 633 | Open in IMG/M |
| 3300007788|Ga0099795_10374137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300009012|Ga0066710_102386069 | Not Available | 767 | Open in IMG/M |
| 3300009038|Ga0099829_10212527 | Not Available | 1569 | Open in IMG/M |
| 3300009088|Ga0099830_10089481 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300009089|Ga0099828_11940435 | Not Available | 516 | Open in IMG/M |
| 3300009090|Ga0099827_10002894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 9659 | Open in IMG/M |
| 3300009090|Ga0099827_10200627 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300009100|Ga0075418_10938034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 936 | Open in IMG/M |
| 3300009137|Ga0066709_101468508 | Not Available | 986 | Open in IMG/M |
| 3300009137|Ga0066709_103326613 | Not Available | 585 | Open in IMG/M |
| 3300009147|Ga0114129_10233980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2473 | Open in IMG/M |
| 3300009147|Ga0114129_12558272 | Not Available | 610 | Open in IMG/M |
| 3300009156|Ga0111538_10278499 | Not Available | 2117 | Open in IMG/M |
| 3300009156|Ga0111538_11933995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 742 | Open in IMG/M |
| 3300009162|Ga0075423_12678826 | Not Available | 545 | Open in IMG/M |
| 3300009651|Ga0105859_1135510 | Not Available | 686 | Open in IMG/M |
| 3300010154|Ga0127503_10219872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 996 | Open in IMG/M |
| 3300010154|Ga0127503_10484987 | Not Available | 519 | Open in IMG/M |
| 3300010303|Ga0134082_10495498 | Not Available | 532 | Open in IMG/M |
| 3300010376|Ga0126381_101182512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300010396|Ga0134126_10830659 | All Organisms → Viruses → Predicted Viral | 1043 | Open in IMG/M |
| 3300010401|Ga0134121_10005838 | Not Available | 9987 | Open in IMG/M |
| 3300011120|Ga0150983_13145517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300011269|Ga0137392_10243762 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300011269|Ga0137392_10505001 | Not Available | 1004 | Open in IMG/M |
| 3300011270|Ga0137391_10509962 | Not Available | 1017 | Open in IMG/M |
| 3300011270|Ga0137391_10709887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 835 | Open in IMG/M |
| 3300011270|Ga0137391_11193465 | Not Available | 609 | Open in IMG/M |
| 3300011271|Ga0137393_10847054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 781 | Open in IMG/M |
| 3300011271|Ga0137393_11079017 | Not Available | 683 | Open in IMG/M |
| 3300012096|Ga0137389_10805396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 807 | Open in IMG/M |
| 3300012096|Ga0137389_11760697 | Not Available | 515 | Open in IMG/M |
| 3300012189|Ga0137388_11413691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 634 | Open in IMG/M |
| 3300012198|Ga0137364_11451382 | Not Available | 506 | Open in IMG/M |
| 3300012199|Ga0137383_10423776 | Not Available | 975 | Open in IMG/M |
| 3300012200|Ga0137382_10062294 | Not Available | 2364 | Open in IMG/M |
| 3300012202|Ga0137363_10063620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2691 | Open in IMG/M |
| 3300012203|Ga0137399_10231363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1511 | Open in IMG/M |
| 3300012203|Ga0137399_10727854 | Not Available | 835 | Open in IMG/M |
| 3300012203|Ga0137399_10815455 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012204|Ga0137374_10047510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4462 | Open in IMG/M |
| 3300012205|Ga0137362_10447392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1118 | Open in IMG/M |
| 3300012205|Ga0137362_10612928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
| 3300012208|Ga0137376_10227252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1617 | Open in IMG/M |
| 3300012208|Ga0137376_11306406 | Not Available | 616 | Open in IMG/M |
| 3300012209|Ga0137379_11494729 | Not Available | 576 | Open in IMG/M |
| 3300012211|Ga0137377_10640701 | Not Available | 999 | Open in IMG/M |
| 3300012212|Ga0150985_107481212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300012212|Ga0150985_110033583 | Not Available | 547 | Open in IMG/M |
| 3300012212|Ga0150985_114041857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300012356|Ga0137371_10550226 | Not Available | 889 | Open in IMG/M |
| 3300012361|Ga0137360_10848122 | Not Available | 787 | Open in IMG/M |
| 3300012362|Ga0137361_11263754 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300012362|Ga0137361_11724952 | Not Available | 545 | Open in IMG/M |
| 3300012363|Ga0137390_10742429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300012363|Ga0137390_10866638 | Not Available | 859 | Open in IMG/M |
| 3300012363|Ga0137390_10913304 | Not Available | 832 | Open in IMG/M |
| 3300012363|Ga0137390_11021325 | Not Available | 778 | Open in IMG/M |
| 3300012363|Ga0137390_11726019 | Not Available | 560 | Open in IMG/M |
| 3300012469|Ga0150984_109137404 | Not Available | 797 | Open in IMG/M |
| 3300012582|Ga0137358_10508001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300012685|Ga0137397_10467370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 940 | Open in IMG/M |
| 3300012923|Ga0137359_10675138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300012924|Ga0137413_11250460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300012929|Ga0137404_10515309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300012929|Ga0137404_12096277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300012930|Ga0137407_11604067 | Not Available | 620 | Open in IMG/M |
| 3300012930|Ga0137407_11748390 | Not Available | 593 | Open in IMG/M |
| 3300012938|Ga0162651_100067311 | Not Available | 585 | Open in IMG/M |
| 3300013503|Ga0120127_10179637 | Not Available | 517 | Open in IMG/M |
| 3300014501|Ga0182024_10066207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5522 | Open in IMG/M |
| 3300015372|Ga0132256_101381053 | Not Available | 816 | Open in IMG/M |
| 3300017934|Ga0187803_10019160 | Not Available | 2731 | Open in IMG/M |
| 3300017993|Ga0187823_10341025 | Not Available | 531 | Open in IMG/M |
| 3300018433|Ga0066667_10021140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3465 | Open in IMG/M |
| 3300018468|Ga0066662_10672922 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300018468|Ga0066662_11044516 | Not Available | 812 | Open in IMG/M |
| 3300018468|Ga0066662_11400324 | Not Available | 723 | Open in IMG/M |
| 3300018468|Ga0066662_11698044 | Not Available | 660 | Open in IMG/M |
| 3300019789|Ga0137408_1477211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2565 | Open in IMG/M |
| 3300020059|Ga0193745_1094624 | Not Available | 641 | Open in IMG/M |
| 3300021086|Ga0179596_10397526 | Not Available | 695 | Open in IMG/M |
| 3300021088|Ga0210404_10243635 | Not Available | 976 | Open in IMG/M |
| 3300021178|Ga0210408_11285873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300021178|Ga0210408_11400541 | Not Available | 527 | Open in IMG/M |
| 3300021432|Ga0210384_10345471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → Sorangium → Sorangium cellulosum | 1340 | Open in IMG/M |
| 3300021432|Ga0210384_11271796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300024330|Ga0137417_1472228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2380 | Open in IMG/M |
| 3300025495|Ga0207932_1067655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 761 | Open in IMG/M |
| 3300025505|Ga0207929_1007520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2105 | Open in IMG/M |
| 3300025829|Ga0209484_10024941 | Not Available | 1228 | Open in IMG/M |
| 3300025888|Ga0209540_10456859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. Root123D2 | 682 | Open in IMG/M |
| 3300025891|Ga0209585_10055763 | Not Available | 1462 | Open in IMG/M |
| 3300025910|Ga0207684_10666073 | Not Available | 886 | Open in IMG/M |
| 3300025939|Ga0207665_10710393 | Not Available | 791 | Open in IMG/M |
| 3300025939|Ga0207665_10766519 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026304|Ga0209240_1002544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6917 | Open in IMG/M |
| 3300026304|Ga0209240_1045973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1649 | Open in IMG/M |
| 3300026304|Ga0209240_1148597 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300026319|Ga0209647_1098515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1399 | Open in IMG/M |
| 3300026319|Ga0209647_1219214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300026557|Ga0179587_10667069 | Not Available | 685 | Open in IMG/M |
| 3300027502|Ga0209622_1069948 | Not Available | 641 | Open in IMG/M |
| 3300027502|Ga0209622_1077502 | Not Available | 608 | Open in IMG/M |
| 3300027629|Ga0209422_1000824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7459 | Open in IMG/M |
| 3300027635|Ga0209625_1071605 | Not Available | 775 | Open in IMG/M |
| 3300027669|Ga0208981_1085448 | Not Available | 805 | Open in IMG/M |
| 3300027748|Ga0209689_1367654 | Not Available | 550 | Open in IMG/M |
| 3300027882|Ga0209590_10000738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 11345 | Open in IMG/M |
| 3300027882|Ga0209590_10215478 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300027903|Ga0209488_10247335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1337 | Open in IMG/M |
| 3300027909|Ga0209382_11518188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300028047|Ga0209526_10139403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1701 | Open in IMG/M |
| 3300028720|Ga0307317_10278817 | Not Available | 565 | Open in IMG/M |
| 3300028878|Ga0307278_10245701 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300028885|Ga0307304_10516901 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300030829|Ga0308203_1031166 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300030830|Ga0308205_1029938 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300030902|Ga0308202_1019515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1049 | Open in IMG/M |
| 3300030903|Ga0308206_1059645 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031058|Ga0308189_10484222 | Not Available | 530 | Open in IMG/M |
| 3300031082|Ga0308192_1035437 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031093|Ga0308197_10104565 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300031545|Ga0318541_10047292 | All Organisms → cellular organisms → Bacteria | 2196 | Open in IMG/M |
| 3300031546|Ga0318538_10051809 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300031679|Ga0318561_10124033 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300031777|Ga0318543_10172813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 954 | Open in IMG/M |
| 3300031820|Ga0307473_10368030 | Not Available | 931 | Open in IMG/M |
| 3300031820|Ga0307473_11022371 | Not Available | 605 | Open in IMG/M |
| 3300031821|Ga0318567_10161776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1241 | Open in IMG/M |
| 3300032174|Ga0307470_10221061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1228 | Open in IMG/M |
| 3300032180|Ga0307471_104117172 | Not Available | 514 | Open in IMG/M |
| 3300032205|Ga0307472_102011653 | Not Available | 579 | Open in IMG/M |
| 3300032893|Ga0335069_12502004 | Not Available | 534 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.89% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.61% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.43% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.72% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.09% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.09% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.54% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.54% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.54% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.54% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002757 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-A | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030830 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031082 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_193 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01244460 | 2088090014 | Soil | MEVPMTMHDHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| JGI10216J12902_1018643052 | 3300000956 | Soil | MTMHSDHHTTDAEDAAFDTTVKIAAMAIVLIAIVGMALWASYAW* |
| JGI12695J13573_10038192 | 3300001180 | Forest Soil | MEVPMAMHSDHHITDTEDAAFDATMKITGMVIVLLVIAGMAFWYIYS* |
| JGI12053J15887_100567141 | 3300001661 | Forest Soil | MTMHGDHRVTDAEDAAFDATMKIGGVIVGLVVIAVVALWYIYS* |
| JGI12627J18819_100046589 | 3300001867 | Forest Soil | MTMRSNHHTTDAEDTAFDTTVKIAGVFIVLGAIAGMALWYSYAW* |
| JGI12627J18819_101078603 | 3300001867 | Forest Soil | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFWYSFAW* |
| JGI12627J18819_101909832 | 3300001867 | Forest Soil | MEVPMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFWYSFAW* |
| JGIcombinedJ26739_1002439412 | 3300002245 | Forest Soil | MTMHDHHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| JGI25524J39351_1002972 | 3300002757 | Soil | MTTHSDHPTTNTEDAAFDATMKITGVVIVLLVIAGMAVWYIS* |
| JGI25524J39351_1003061 | 3300002757 | Soil | MTTHSNHPITNAEDAAFDRTMKIVGSVIVLLVIAGVALTYFYS* |
| JGI25614J43888_101614732 | 3300002906 | Grasslands Soil | MEVPMTMHDNHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| JGI25615J43890_10068591 | 3300002910 | Grasslands Soil | MEVPMTMHRDHHITDAEDAAFDTTVKIAGMVIVLIAIVGMALWYSYAW* |
| JGI25615J43890_10154604 | 3300002910 | Grasslands Soil | MEVPMTMHDHHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| JGIcombinedJ51221_102607632 | 3300003505 | Forest Soil | MTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0062595_1013341562 | 3300004479 | Soil | MTMHDHHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| Ga0066672_106637121 | 3300005167 | Soil | MEVPMTMHGDHHITDAEDAAFDTTMKIMGVIIALAAIAGMALWYVYS* |
| Ga0066683_100362825 | 3300005172 | Soil | MEVPMTMHDHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| Ga0066680_106085391 | 3300005174 | Soil | MTMHDHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| Ga0066688_101733801 | 3300005178 | Soil | MTMHGNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0066678_100962743 | 3300005181 | Soil | MTMHGNHHTTDAEDAAFDTTVKIAGVFIVLGAIAGMALWYSYAW* |
| Ga0066675_100406473 | 3300005187 | Soil | MTMHSNHHTTDAEDAAFDTTVQIAGVVIVLGAIAGMALWYSYAW* |
| Ga0070714_1018880031 | 3300005435 | Agricultural Soil | MTMHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0070714_1023950392 | 3300005435 | Agricultural Soil | VTPVGGLRNHGLLRTMEVPMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSYAW* |
| Ga0070713_1007189682 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0070710_110021752 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSFAW* |
| Ga0070708_1016935721 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSYAW* |
| Ga0066689_102036862 | 3300005447 | Soil | MTMHDHHITDAGDAAFDATMKMVGMGIVLVMIASMMLGYFYL* |
| Ga0066689_109039101 | 3300005447 | Soil | MTMHGNHHTTDAEDAAFDTTVKIAGVLIVLGAIAGMALWYSYAW* |
| Ga0070706_1020969842 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTHSNHPITNAEDAAFDQTMKIVGLVIVLLVIAGVALTYFYS* |
| Ga0070698_1001010306 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVPMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSYAW* |
| Ga0070699_1004288032 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVPMTMHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0070697_1000037285 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTHSNHPITNAEDAAFDRTMKIVGLVIVLLVIAGVALTYFYS* |
| Ga0066700_104788851 | 3300005559 | Soil | MTMHDHHHITDAEDVAFDATMKMVGMGIVLVMIAGMMLGYFYL* |
| Ga0066903_1012836753 | 3300005764 | Tropical Forest Soil | MTQGDPHATDAEDAAFDTTMKIGGVVIGLVVIAGLALWYFYS* |
| Ga0070716_1015810991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AMEVPMTTHSDHPITNTEDAAFDATMKITGMVIVLLVIAGMALWYIL* |
| Ga0070712_1001478503 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MEVPMTMHSDHRTTDVEDAAFDTTMKIIGIVVALLVIAGGAGWYLAG* |
| Ga0079222_122379222 | 3300006755 | Agricultural Soil | AGGFEVTASLLTMEVPMTMHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW |
| Ga0066659_105656933 | 3300006797 | Soil | ADAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0066660_104631723 | 3300006800 | Soil | MTMQGDHHVTEVEDAAFDTTMKITGVVFGLIVIAGMALWYIYS* |
| Ga0079221_113035292 | 3300006804 | Agricultural Soil | MTMHRDHHITDAEGAAFDATMKAAGVVIVLGAIAGMALWYSYAW* |
| Ga0075421_1012811821 | 3300006845 | Populus Rhizosphere | MTMYRDHHHVTDTEDAAFDATMKIMGEIVVLAVIAG |
| Ga0075421_1019755862 | 3300006845 | Populus Rhizosphere | LRTMEVPMTMHRDHHITDAEDAAFDATVKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0075433_110497822 | 3300006852 | Populus Rhizosphere | MEVPMTMHGDHHVTDVEDAAFDITMKIAGVVIVLVVIAGLAFWLTYS* |
| Ga0075425_1002467334 | 3300006854 | Populus Rhizosphere | MEVPMTMHDHHQIADAGDAAFDATMKMVRMGIVLVMIAGMVLGYFYL* |
| Ga0075425_1003904042 | 3300006854 | Populus Rhizosphere | MTTHSNHPITNAEDAAFDRTMKIVGLVIVLLVIAGGALTYFYS* |
| Ga0075434_1003884711 | 3300006871 | Populus Rhizosphere | MTTHSDHPVTDAENAAFDTTMKITGTVIGLVVAAIAVIWYFAG* |
| Ga0075424_1003411742 | 3300006904 | Populus Rhizosphere | GPLRAMEVLMTTHSDHPTTNTEDAAFDATMKITGVVIVLLVIAGMAVWYIS* |
| Ga0075424_1016789292 | 3300006904 | Populus Rhizosphere | MTMHSDHHVTDAEDTAFDATMKIAGALMVLVGIAGVAVWYLYS* |
| Ga0075436_1004658982 | 3300006914 | Populus Rhizosphere | MTTHSNHPITNAEDAAFDRTMKIVGMVIVLLVIAGVALTYFYS* |
| Ga0099791_104363182 | 3300007255 | Vadose Zone Soil | MEVSMTTHSDHPITDTENAAFDATMKITGMVLVLLVIAGMAFWYLS* |
| Ga0099795_103741372 | 3300007788 | Vadose Zone Soil | MEVPITMHSNHHTTDAEDAAFDTTVKIAGMVIVLIAIVGMALWYSYAW* |
| Ga0066710_1023860691 | 3300009012 | Grasslands Soil | MEVPMTMQGDHHTTDLEDAAFDTTMKIGGMVIVLAAIAGMVLWYFYS |
| Ga0099829_102125272 | 3300009038 | Vadose Zone Soil | MEVSMTMHRDHHVTNTEDAAFDATMKIMGVIVVLAAIAGTALWYIYS* |
| Ga0099830_100894811 | 3300009088 | Vadose Zone Soil | MEVSMTMHRDHHVTNTEDAAFDATMKIMGVIVVLAAIAGIALWYIYS* |
| Ga0099828_119404351 | 3300009089 | Vadose Zone Soil | MEVSMTTHSDHPMTDTENAAFDATMKITGMVIVLLVIAGMAFWYLS* |
| Ga0099827_100028949 | 3300009090 | Vadose Zone Soil | MEVSMTTHSDHPMTDTENAAFDATMKIAGMVIVLLVIAGMAFWYLS* |
| Ga0099827_102006273 | 3300009090 | Vadose Zone Soil | MEVPMTMHGDHHITDAEDAAFDATMKIMGVVMVLVVIAGMALWYIYS* |
| Ga0075418_109380343 | 3300009100 | Populus Rhizosphere | MVVPMTMYRDHHHVTDTEDAAFDATMKIMGEIVVLAVIAGAALWYIYS* |
| Ga0066709_1014685081 | 3300009137 | Grasslands Soil | MHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0066709_1033266132 | 3300009137 | Grasslands Soil | MEVPMTMQGDHHTTDVEDAAFDTTMKIGGMVIVLAAIAGMVLWYFYS* |
| Ga0114129_102339802 | 3300009147 | Populus Rhizosphere | MEVPMTMHRDHHVTDTEDAAFDATMKIMGEIVVLAVIAGAALWYIYS* |
| Ga0114129_125582721 | 3300009147 | Populus Rhizosphere | MEVPMTMHDHHHITDAGDAAFDATMKMVGMGIVLVMIAGMMLGYFYL* |
| Ga0111538_102784992 | 3300009156 | Populus Rhizosphere | MEVPMTTMHRDHHITDADDAAFDSSVKAVVVVIVLISIAGMGFWYSYAW* |
| Ga0111538_119339952 | 3300009156 | Populus Rhizosphere | RTMEVPMTMHRDHHHVTDTEDAAFDATMKIMGVIVVLAVIAGAALWYIYL* |
| Ga0075423_126788261 | 3300009162 | Populus Rhizosphere | MEVPMTMHDHHHITDAGDAAFDATMKMVRMGIVLVMIAGMVLGYFYL* |
| Ga0105859_11355102 | 3300009651 | Permafrost Soil | MEVPMAMHSDHHVTDTEDAAFDATMKIAGTVIGLLVIAVVAFW |
| Ga0127503_102198721 | 3300010154 | Soil | MEVPMTMHGDHRVTDAEDAAFDATMKIGGVILGLVVIAVVALWYIYS* |
| Ga0127503_104849871 | 3300010154 | Soil | GLRNHGLLRTMEVPMTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0134082_104954982 | 3300010303 | Grasslands Soil | NHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0126381_1011825123 | 3300010376 | Tropical Forest Soil | MEVPMTQGDPHATDAEDAAFDTTMKIGGVVIGLVVIAGLALWYFYS* |
| Ga0134126_108306593 | 3300010396 | Terrestrial Soil | MEVPMTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0134121_100058381 | 3300010401 | Terrestrial Soil | MEVLMTTHSDHPTTNTEDAAFDATMKITGVVIVLLVIAGMAVWYIS* |
| Ga0150983_131455173 | 3300011120 | Forest Soil | AAFEITASCEMEVPMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSFAW* |
| Ga0137392_102437621 | 3300011269 | Vadose Zone Soil | QWRFPMTTHSDHPITDTENAAFDATMKITGMVLVLLVIAGMAWWYLS* |
| Ga0137392_105050011 | 3300011269 | Vadose Zone Soil | MEVPMTTHSDHPITNTEDAAFDATMKITGMVIVLFVIAGMALWYIS* |
| Ga0137391_105099621 | 3300011270 | Vadose Zone Soil | MEVPMTMHSDHRITDAEDAAFDTTMKIMGVVIMLAVIAGTALWYIYP* |
| Ga0137391_107098873 | 3300011270 | Vadose Zone Soil | MTMHRDHHITDAEGAAFGATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0137391_111934651 | 3300011270 | Vadose Zone Soil | TMEVSMTMHRDHHVTNTEDAAFDATMKIMGVIVVLAAIAGTALWYIYS* |
| Ga0137393_108470542 | 3300011271 | Vadose Zone Soil | MEVPMTTDSDHPITNTENAAFDATMKITGMVIVLFVIAGMALWYIS* |
| Ga0137393_110790174 | 3300011271 | Vadose Zone Soil | DHHITDAEDAAFDATMKITGVVIALVVIAGMALWYIYS* |
| Ga0137389_108053962 | 3300012096 | Vadose Zone Soil | MEVPMTMHSDHRVTDAEDAAFDTTMKIMGVVIVLAVIAGTALWYIYS* |
| Ga0137389_117606972 | 3300012096 | Vadose Zone Soil | MEVPMTMHSDHHITDTEDAAFDATMKITGVVIALVGIAGMALWYIYS* |
| Ga0137388_114136912 | 3300012189 | Vadose Zone Soil | MEVPMTMHSDHRVTDAEDAAFDTTMKIMGVIIVLAVIAGTALWYIYS* |
| Ga0137364_114513821 | 3300012198 | Vadose Zone Soil | LLTMEVPMTMHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0137383_104237762 | 3300012199 | Vadose Zone Soil | MTMHSNHHTTDAEDAAFDTTVKIAGVFIVLGAIAGMALWYSYAW* |
| Ga0137382_100622942 | 3300012200 | Vadose Zone Soil | MTMHSNHHTTDAEDAAFDTTVKIAGVLIVLGAIAGMALWYSYAW* |
| Ga0137363_100636202 | 3300012202 | Vadose Zone Soil | MEVPMTMHGDHHTTDVEDAAFDATMKIGGVVIGLLVIAGMALWYMYS* |
| Ga0137399_102313631 | 3300012203 | Vadose Zone Soil | MEVPMTMHDHHHITDAEDAAFDAMKMVGMGIVLVMIAGMVLVYFYL* |
| Ga0137399_107278542 | 3300012203 | Vadose Zone Soil | MEVSMTTHSDHPITDTENAAFDATMKITGMVLALLVIAGMAFWYLS* |
| Ga0137399_108154553 | 3300012203 | Vadose Zone Soil | MEVPMTMHGDHHITETEDAAFDATMKVGGTIVGLAVIVTMALWYFYS* |
| Ga0137374_100475102 | 3300012204 | Vadose Zone Soil | MEVPMTMHGDHHITDAEDAAFDATIKIMGVVMVLVVIAGMAAWYIYS* |
| Ga0137362_104473922 | 3300012205 | Vadose Zone Soil | MEVPMTMHGNHHTTDAEDAAFDTTVKIAGVLIVLGAIAGMALWYSYAW* |
| Ga0137362_106129282 | 3300012205 | Vadose Zone Soil | MEVSMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0137376_102272525 | 3300012208 | Vadose Zone Soil | MAVPMTMHDHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| Ga0137376_113064061 | 3300012208 | Vadose Zone Soil | MEVPMTMHGDHHITDTEDAAFDATMKIGGAIVGLVVIATMALWYFYS* |
| Ga0137379_114947291 | 3300012209 | Vadose Zone Soil | MTMHGDHHITDAEDAAFDATIKIMGVVMVLVVIAGMAAWYIYS* |
| Ga0137377_106407012 | 3300012211 | Vadose Zone Soil | MEVPMTMHDDHHITDVEDAAFDATMKMVGVGIVLVMIAGMTLGYFYL* |
| Ga0150985_1074812122 | 3300012212 | Avena Fatua Rhizosphere | MEVPMTMHSDHVTDTEDSAFDATWKTSATVLGLIVIAVAAFWYFS* |
| Ga0150985_1100335831 | 3300012212 | Avena Fatua Rhizosphere | HITDNHHITDAEDAAFDTTMKIVGVILALAVIAGVAFWYVYS* |
| Ga0150985_1140418572 | 3300012212 | Avena Fatua Rhizosphere | EVPMTMHSDHVTDAEDSAFDATWKTTAMVLGFVVIAVAAFWYFS* |
| Ga0137371_105502261 | 3300012356 | Vadose Zone Soil | TMEVPMTMHDHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL* |
| Ga0137360_108481222 | 3300012361 | Vadose Zone Soil | LLTMEVPMTMHGNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW* |
| Ga0137361_112637541 | 3300012362 | Vadose Zone Soil | MEVLMAMHSDHHVTDTEDAAFDATMKISGIVMGLVVIAIAAFWYFS* |
| Ga0137361_117249522 | 3300012362 | Vadose Zone Soil | MEVPMTMHDDHHITDAEDAAFDATMKMVGVGIVLVMIAGMALGYFYL* |
| Ga0137390_107424293 | 3300012363 | Vadose Zone Soil | KVTPAGGLRNHGLLRTMEVPMTMHRDHHITDAEGAAFGATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0137390_108666382 | 3300012363 | Vadose Zone Soil | MEVPMTMHSDHHITDAEDAAFDATMKIMGVITALVVIAGMALWYIYS* |
| Ga0137390_109133042 | 3300012363 | Vadose Zone Soil | MEVPMTMHSDHRVTDAEDAAFDTTMKIMGVVIMLAVIAGTALWYIYP* |
| Ga0137390_110213251 | 3300012363 | Vadose Zone Soil | MEVSMTMHSDHHTTDTEDAAFDTTVKIAGMVIMLGAIVGTAFWFTYAW* |
| Ga0137390_117260191 | 3300012363 | Vadose Zone Soil | MEVPMTMHSDHHVTDTEDAAFDATMKIMGVVMVLVVIAGMALWYVYS* |
| Ga0150984_1091374042 | 3300012469 | Avena Fatua Rhizosphere | MEVPMTTMHGDHHITDAEDAAFDTTMKIMGVIIALAAIAGMALWYIYS* |
| Ga0137358_105080012 | 3300012582 | Vadose Zone Soil | MEVPMTMHGDHHSTDAEDAAFDRTMKIGGAVIALVVIAGLALWYFYS* |
| Ga0137397_104673703 | 3300012685 | Vadose Zone Soil | MEVPMTMHDDHHVTDTEDAAFDATMKAMGVVIVLVVFAGMGLWYIYS* |
| Ga0137359_106751382 | 3300012923 | Vadose Zone Soil | MEVPMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFWYSYAW* |
| Ga0137413_112504602 | 3300012924 | Vadose Zone Soil | MEVPMTMHGDHHVTDAEDAAFDATVKVGGAIVGLVVVATMALWYFYS* |
| Ga0137404_105153092 | 3300012929 | Vadose Zone Soil | MTMHRDHHITETEDAAFDATMKIGGAVLGVVIAAMALWYIFS* |
| Ga0137404_120962772 | 3300012929 | Vadose Zone Soil | TDAEDAAFDATVKVGGAIVGLVVVATMALWYFYS* |
| Ga0137407_116040671 | 3300012930 | Vadose Zone Soil | MEVPMTMHRDHRTTDVENAAFDTTMKITGIVVALLVIAGAAVWYLAG* |
| Ga0137407_117483902 | 3300012930 | Vadose Zone Soil | MAMHSDHHVNDTEDAAFDATMKIAGTVIGVLVLAVLAYWYFYS* |
| Ga0162651_1000673112 | 3300012938 | Soil | MTMHRDHNITDPEDAAFDTTMKIMGVVIVLVAIAGMALWYIYS* |
| Ga0120127_101796371 | 3300013503 | Permafrost | MHSDHPVTDAEDAAFDTTMKITGIVIGLVVVAFAVIWYFS* |
| Ga0182024_100662072 | 3300014501 | Permafrost | MEVPMAMHSDHHVTDTEDAAFDATMKIAGTVIGLLVIAGVAFWYIYS* |
| Ga0132256_1013810531 | 3300015372 | Arabidopsis Rhizosphere | MTMHDDHHITDAEDALFDKTIKIVGVVIALVVIAGMAMALWS |
| Ga0187803_100191602 | 3300017934 | Freshwater Sediment | MTMHSDHSVTDTEDTAFDATMKIAGIVIGLLVIAAVAFWYFYS |
| Ga0187823_103410251 | 3300017993 | Freshwater Sediment | MTMHSDHSVTGTENAAFDTTMKITGIVIGLIVIAVAAFWYFS |
| Ga0066667_100211403 | 3300018433 | Grasslands Soil | MTMHSNHHTTDAEDAAFDTTVKIAGVVIVLGAIAGMALWYSYAW |
| Ga0066662_106729221 | 3300018468 | Grasslands Soil | MTMHDHHHITDAEDVAFDATMKMVGMGIVLVMIAGMMLGYFYL |
| Ga0066662_110445161 | 3300018468 | Grasslands Soil | MTMHRDHHVTNTEDAAFDATMKIMGVIVALAAIAGIALWYIYS |
| Ga0066662_114003242 | 3300018468 | Grasslands Soil | MEVPMTMQGDHHTTDVEDAAFDTTMKIGGMVIVLAAIAGMVLWYFYS |
| Ga0066662_116980442 | 3300018468 | Grasslands Soil | MEVPMTMHSDHHVTDVEDAAFDTTMKIVGGIMGLVVIAGMALWYIYS |
| Ga0137408_14772115 | 3300019789 | Vadose Zone Soil | MTMHRDHNITDPEDAAFDTTMKIIGVVIVLVAIAGMALWYIYS |
| Ga0193745_10946242 | 3300020059 | Soil | MTMHGDHVTEVEDAAFDSTMKVVGVIVGLIVIVGGAFWYLYS |
| Ga0179596_103975261 | 3300021086 | Vadose Zone Soil | MEVPMTMHRDHHITDAEDAAFDTTVKIAGMVIVLIAIVGMALWYSYAW |
| Ga0210404_102436352 | 3300021088 | Soil | MEVPMTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMGFWYSYAW |
| Ga0210408_112858731 | 3300021178 | Soil | HHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSFAW |
| Ga0210408_114005412 | 3300021178 | Soil | LLTMEVPMTMHGNHHTTDAEDAAFDTTVKIAGVFIVLGAIAGMALWYSYAW |
| Ga0210384_103454711 | 3300021432 | Soil | MTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMG |
| Ga0210384_112717961 | 3300021432 | Soil | ASCEMEVPMTMHRDHHITDAEGAAFDATMKAVGVVIVLIAIAGMGFWYSYAW |
| Ga0137417_14722283 | 3300024330 | Vadose Zone Soil | MATHSYHRITDAEDAAFDATMKVMGIGTALLVIVGIALWFIYS |
| Ga0207932_10676551 | 3300025495 | Arctic Peat Soil | MTMHHDHVTDTEDAVFDATMKISGSVIGALVIAFAAFWYLYS |
| Ga0207929_10075203 | 3300025505 | Arctic Peat Soil | MATHSDHHITDTEDAAFDATMKIMGAVIVVLVIAGVALWYFYS |
| Ga0209484_100249411 | 3300025829 | Arctic Peat Soil | MHHDHVTDTEDAAFDATMKISGSVIGALVIAFAVFWYLYS |
| Ga0209540_104568591 | 3300025888 | Arctic Peat Soil | MTMHHDHVTDTEDAAFDATMKISGSVIGALVIAFAAFWYLYS |
| Ga0209585_100557631 | 3300025891 | Arctic Peat Soil | MTMHHDHVTDTEDAAFDATMKISGSVIGALVIAFAVFWYLYS |
| Ga0207684_106660732 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSYAW |
| Ga0207665_107103932 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMHSDHHVTDAEDTAFDATMKITGALMVLVGIAGVAFWYIYS |
| Ga0207665_107665191 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | PMTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSFAW |
| Ga0209240_100254414 | 3300026304 | Grasslands Soil | MTMHRDHHITDAEDAAFDTTVKIAGMVIVLIAIVGMALWYSYAW |
| Ga0209240_10459734 | 3300026304 | Grasslands Soil | MEVPMTMHDHHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| Ga0209240_11485972 | 3300026304 | Grasslands Soil | MTMHDNHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| Ga0209647_10985153 | 3300026319 | Grasslands Soil | MEVPMTMHDNHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| Ga0209647_12192142 | 3300026319 | Grasslands Soil | MEVPMTMHGDHHTTDVEDAAFDATMKIGGVVIGLLVIAGMALWYMYS |
| Ga0179587_106670692 | 3300026557 | Vadose Zone Soil | MTMHDHHHITDAGDAAFDATMKMVGMGIVLVMIAGMVLG |
| Ga0209622_10699481 | 3300027502 | Forest Soil | MTMRSNHHTTDAEDTAFDTTVKIAGVFIVLGAIAGMALWYSYAW |
| Ga0209622_10775021 | 3300027502 | Forest Soil | MEVPMTMHRDHHITDAEGAAFGATMKAVGVVIVLIAIAGMGFWYSYAW |
| Ga0209422_10008241 | 3300027629 | Forest Soil | MAMHSDHHITDTEDAAFDATMKITGMVIVLLVIAGMAFWYIYS |
| Ga0209625_10716051 | 3300027635 | Forest Soil | MEVPMTMHDHHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| Ga0208981_10854482 | 3300027669 | Forest Soil | MTMHGDHRVTDAEDAAFDATMKIGGVIVGLVVIAVVALWYIYS |
| Ga0209689_13676542 | 3300027748 | Soil | MTMHGNHHTTDAEDAAFDTTVKIAGVFIVLGAIAGMALWYSYAW |
| Ga0209590_1000073812 | 3300027882 | Vadose Zone Soil | MTTHSDHPMTDTENAAFDATMKIAGMVIVLLVIAGMAFWYLS |
| Ga0209590_102154782 | 3300027882 | Vadose Zone Soil | MTMHGDHHITDAEDAAFDATMKIMGVVMVLVVIAGMALWYIYS |
| Ga0209488_102473352 | 3300027903 | Vadose Zone Soil | MTMHRDHHITETEDAAFDATMKIGGAVLGVVIAAMALWYIFS |
| Ga0209382_115181881 | 3300027909 | Populus Rhizosphere | MEVPMTMYRDHHHVTDTEDAAFDATMKIMGEIVVLAVIAGTALWYIYS |
| Ga0209526_101394033 | 3300028047 | Forest Soil | MTMHDHHHITDAEDVAFDATMKMVGMGIVLVMIAGMVLGYFYL |
| Ga0307317_102788171 | 3300028720 | Soil | MTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0307278_102457012 | 3300028878 | Soil | MTMHRDHNITDPEDAAFDTTMKIMGVVIVLVAIAGMALWYIYS |
| Ga0307304_105169011 | 3300028885 | Soil | MHGDHRVTDAEDAAFDATMKIGGVILGLVVIAVVALWYIYS |
| Ga0308203_10311661 | 3300030829 | Soil | TMEVPMTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0308205_10299381 | 3300030830 | Soil | RNHGSWRTMEVPMTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0308202_10195151 | 3300030902 | Soil | PMTMHGDHRVTDAEDAAFDATMKIGGVILGLVVIAVVALWYIYS |
| Ga0308206_10596452 | 3300030903 | Soil | GGLRNHGSWRTMEVPMTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0308189_104842222 | 3300031058 | Soil | RNHGSWRTMEVPMTMHGDHRVTDAEDAAFDATMKIGGVILGLVVIAVVALWYIYS |
| Ga0308192_10354372 | 3300031082 | Soil | LRNHGSWRTMEVPMTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0308197_101045652 | 3300031093 | Soil | MEVPMTMHGDHRVTDAEDAAFDATMKIGGAILGLVVIAVVALWYIYS |
| Ga0318541_100472923 | 3300031545 | Soil | MTQGDPHATDAEDAAFDTTMKIGGVVIGLVVIAGLALWYFYS |
| Ga0318538_100518093 | 3300031546 | Soil | MEVPMTQGDPHATDAEDAAFDTTMKIGGVVIGLVVIAGLALWYFYS |
| Ga0318561_101240333 | 3300031679 | Soil | MTQGDPHATDAEDAAFDTIMKIGGVVIGLVVIAGLALWYFYS |
| Ga0318543_101728131 | 3300031777 | Soil | MEVPMTQGDPHATDAEDAAFDTIMKIGGVVIGLVVIAGLALWYFYS |
| Ga0307473_103680302 | 3300031820 | Hardwood Forest Soil | MHSDHHVTNTEDAAFDATMKISGLVIGLVVIAVAAFWYFS |
| Ga0307473_110223711 | 3300031820 | Hardwood Forest Soil | MEVPMTMHSDHHVTDAEDTAFDATMKITGALMVLVGIAGVAFWYIYS |
| Ga0318567_101617761 | 3300031821 | Soil | MTQGDPHATDAEDAAFDTTMKIGGVVIGLVVIAGL |
| Ga0307470_102210612 | 3300032174 | Hardwood Forest Soil | MTMHRDHHITDAEDAAFDATMKAVGVVIVLIAIAGMGFLYSL |
| Ga0307471_1041171722 | 3300032180 | Hardwood Forest Soil | MEVPMTMHGDHHITDAEDAAFDATMKIMGVVMVLVVIAGMALWYVYS |
| Ga0307472_1020116531 | 3300032205 | Hardwood Forest Soil | MTMHSDHHVTNTEDAAFDATMKISGLVIGLVVIAVAAFWYFS |
| Ga0335069_125020041 | 3300032893 | Soil | MTMHSDHPVTNTEDAAFDATMKISGIVIVLIAIAGVALWYFAG |
| ⦗Top⦘ |