


| Basic Information | |
|---|---|
| Family ID | F030800 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 184 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VPAGAIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKGNHDG |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 184 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.80 % |
| % of genes near scaffold ends (potentially truncated) | 92.93 % |
| % of genes from short scaffolds (< 2000 bps) | 86.96 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.348 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.08% Coil/Unstructured: 85.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 184 Family Scaffolds |
|---|---|---|
| PF07746 | LigA | 59.24 |
| PF02900 | LigB | 23.91 |
| PF07883 | Cupin_2 | 3.26 |
| PF13474 | SnoaL_3 | 2.17 |
| PF12900 | Pyridox_ox_2 | 1.63 |
| PF03972 | MmgE_PrpD | 0.54 |
| PF01451 | LMWPc | 0.54 |
| PF00501 | AMP-binding | 0.54 |
| PF03928 | HbpS-like | 0.54 |
| PF03795 | YCII | 0.54 |
| PF13518 | HTH_28 | 0.54 |
| PF03070 | TENA_THI-4 | 0.54 |
| PF01243 | Putative_PNPOx | 0.54 |
| PF03069 | FmdA_AmdA | 0.54 |
| PF04542 | Sigma70_r2 | 0.54 |
| PF01553 | Acyltransferase | 0.54 |
| PF01590 | GAF | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 184 Family Scaffolds |
|---|---|---|---|
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.54 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.54 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.54 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.54 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.54 |
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 0.54 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.50 % |
| Unclassified | root | N/A | 12.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000443|F12B_10034194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 724 | Open in IMG/M |
| 3300000559|F14TC_100704772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1079 | Open in IMG/M |
| 3300000953|JGI11615J12901_11588686 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 964 | Open in IMG/M |
| 3300000955|JGI1027J12803_105428684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 534 | Open in IMG/M |
| 3300000955|JGI1027J12803_109115512 | All Organisms → cellular organisms → Bacteria | 2088 | Open in IMG/M |
| 3300000955|JGI1027J12803_109272835 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1124 | Open in IMG/M |
| 3300001139|JGI10220J13317_12231234 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300002886|JGI25612J43240_1073252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
| 3300002912|JGI25386J43895_10200150 | Not Available | 501 | Open in IMG/M |
| 3300003267|soilL1_10014153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1066 | Open in IMG/M |
| 3300003999|Ga0055469_10170288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300004052|Ga0055490_10215829 | Not Available | 584 | Open in IMG/M |
| 3300004267|Ga0066396_10041425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300004479|Ga0062595_101252148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 663 | Open in IMG/M |
| 3300004480|Ga0062592_101274413 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300005178|Ga0066688_10341011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300005329|Ga0070683_101036610 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005332|Ga0066388_102405780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300005332|Ga0066388_103217725 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300005332|Ga0066388_108005444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 528 | Open in IMG/M |
| 3300005345|Ga0070692_10748649 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
| 3300005406|Ga0070703_10526537 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005445|Ga0070708_101334178 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300005446|Ga0066686_10414597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300005468|Ga0070707_100570531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1094 | Open in IMG/M |
| 3300005468|Ga0070707_101256534 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005518|Ga0070699_101073714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 739 | Open in IMG/M |
| 3300005518|Ga0070699_101680368 | Not Available | 581 | Open in IMG/M |
| 3300005543|Ga0070672_100474538 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005549|Ga0070704_102250221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300005556|Ga0066707_10039915 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300005561|Ga0066699_10414580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300005569|Ga0066705_10949171 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300005574|Ga0066694_10215351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 911 | Open in IMG/M |
| 3300005578|Ga0068854_100462076 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300005598|Ga0066706_10082606 | All Organisms → cellular organisms → Bacteria | 2284 | Open in IMG/M |
| 3300005598|Ga0066706_11043961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300005617|Ga0068859_102949028 | Not Available | 520 | Open in IMG/M |
| 3300005718|Ga0068866_10768313 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300005719|Ga0068861_102029220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
| 3300005764|Ga0066903_108876931 | Not Available | 510 | Open in IMG/M |
| 3300005841|Ga0068863_101728565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 635 | Open in IMG/M |
| 3300005843|Ga0068860_101218786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005875|Ga0075293_1005182 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300005883|Ga0075299_1025831 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006049|Ga0075417_10096293 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300006058|Ga0075432_10477348 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300006196|Ga0075422_10012496 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300006806|Ga0079220_10237138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1081 | Open in IMG/M |
| 3300006845|Ga0075421_101855294 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300006871|Ga0075434_101628135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300006881|Ga0068865_102200572 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300006903|Ga0075426_10567832 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 846 | Open in IMG/M |
| 3300006914|Ga0075436_100262541 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300006954|Ga0079219_10092967 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300006969|Ga0075419_11478165 | Not Available | 509 | Open in IMG/M |
| 3300007255|Ga0099791_10603968 | Not Available | 536 | Open in IMG/M |
| 3300009012|Ga0066710_100385910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2083 | Open in IMG/M |
| 3300009088|Ga0099830_10177286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1656 | Open in IMG/M |
| 3300009090|Ga0099827_11369773 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009100|Ga0075418_10110211 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300009137|Ga0066709_102274649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 744 | Open in IMG/M |
| 3300009147|Ga0114129_11558516 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009156|Ga0111538_12131091 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300009156|Ga0111538_12591577 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300009162|Ga0075423_12981296 | Not Available | 519 | Open in IMG/M |
| 3300009553|Ga0105249_10089880 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
| 3300009777|Ga0105164_10144351 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1222 | Open in IMG/M |
| 3300009803|Ga0105065_1026984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 715 | Open in IMG/M |
| 3300009808|Ga0105071_1082614 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 562 | Open in IMG/M |
| 3300009816|Ga0105076_1097349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300009836|Ga0105068_1057782 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 710 | Open in IMG/M |
| 3300009837|Ga0105058_1112692 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010046|Ga0126384_11308396 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300010047|Ga0126382_10730303 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 835 | Open in IMG/M |
| 3300010047|Ga0126382_11602783 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300010304|Ga0134088_10640969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 530 | Open in IMG/M |
| 3300010321|Ga0134067_10134758 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 871 | Open in IMG/M |
| 3300010325|Ga0134064_10110694 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 913 | Open in IMG/M |
| 3300010359|Ga0126376_11901805 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 635 | Open in IMG/M |
| 3300010359|Ga0126376_12006105 | Not Available | 620 | Open in IMG/M |
| 3300010360|Ga0126372_10639703 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300010360|Ga0126372_11272832 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300010362|Ga0126377_13517467 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 507 | Open in IMG/M |
| 3300010366|Ga0126379_10553491 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
| 3300010376|Ga0126381_103006824 | Not Available | 670 | Open in IMG/M |
| 3300011270|Ga0137391_10005726 | All Organisms → cellular organisms → Bacteria | 9632 | Open in IMG/M |
| 3300011429|Ga0137455_1107500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 820 | Open in IMG/M |
| 3300012096|Ga0137389_10273192 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300012189|Ga0137388_11969450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300012198|Ga0137364_11447567 | Not Available | 507 | Open in IMG/M |
| 3300012204|Ga0137374_10300040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
| 3300012204|Ga0137374_10310537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300012208|Ga0137376_10502197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1052 | Open in IMG/M |
| 3300012226|Ga0137447_1114447 | Not Available | 542 | Open in IMG/M |
| 3300012285|Ga0137370_10184981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300012351|Ga0137386_11216333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300012355|Ga0137369_10005532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12832 | Open in IMG/M |
| 3300012357|Ga0137384_10040981 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3821 | Open in IMG/M |
| 3300012359|Ga0137385_10788631 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300012685|Ga0137397_10093903 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300012904|Ga0157282_10427030 | Not Available | 504 | Open in IMG/M |
| 3300012948|Ga0126375_10555679 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300012977|Ga0134087_10007992 | All Organisms → cellular organisms → Bacteria | 3544 | Open in IMG/M |
| 3300013308|Ga0157375_13602453 | Not Available | 515 | Open in IMG/M |
| 3300014154|Ga0134075_10222659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300014259|Ga0075311_1033459 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 959 | Open in IMG/M |
| 3300014308|Ga0075354_1116634 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300014885|Ga0180063_1069274 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300014968|Ga0157379_10829353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 874 | Open in IMG/M |
| 3300014968|Ga0157379_11687300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300015053|Ga0137405_1282887 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1316 | Open in IMG/M |
| 3300015371|Ga0132258_13785414 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300015372|Ga0132256_101780117 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300015372|Ga0132256_102984049 | Not Available | 569 | Open in IMG/M |
| 3300015372|Ga0132256_103397735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300016341|Ga0182035_11001802 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300017973|Ga0187780_11059019 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300018063|Ga0184637_10453323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 754 | Open in IMG/M |
| 3300018064|Ga0187773_10057500 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300018077|Ga0184633_10200908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300018079|Ga0184627_10303461 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300018431|Ga0066655_10468993 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 832 | Open in IMG/M |
| 3300018468|Ga0066662_11916874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 620 | Open in IMG/M |
| 3300019259|Ga0184646_1458170 | All Organisms → cellular organisms → Bacteria | 2003 | Open in IMG/M |
| 3300020170|Ga0179594_10207455 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300020580|Ga0210403_10257050 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1433 | Open in IMG/M |
| 3300020583|Ga0210401_11643857 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300025560|Ga0210108_1101573 | Not Available | 575 | Open in IMG/M |
| 3300025899|Ga0207642_10904554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300025904|Ga0207647_10749025 | Not Available | 529 | Open in IMG/M |
| 3300025914|Ga0207671_11221712 | Not Available | 587 | Open in IMG/M |
| 3300025930|Ga0207701_11487092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 549 | Open in IMG/M |
| 3300025937|Ga0207669_11559500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 564 | Open in IMG/M |
| 3300025986|Ga0207658_10661509 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300026088|Ga0207641_11336439 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300026118|Ga0207675_100672105 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1043 | Open in IMG/M |
| 3300026314|Ga0209268_1018610 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300026317|Ga0209154_1093288 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
| 3300026329|Ga0209375_1021217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3718 | Open in IMG/M |
| 3300026330|Ga0209473_1158726 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300026335|Ga0209804_1261380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 627 | Open in IMG/M |
| 3300026343|Ga0209159_1006948 | All Organisms → cellular organisms → Bacteria | 7063 | Open in IMG/M |
| 3300026528|Ga0209378_1000072 | All Organisms → cellular organisms → Bacteria | 65011 | Open in IMG/M |
| 3300026536|Ga0209058_1014417 | All Organisms → cellular organisms → Bacteria | 5438 | Open in IMG/M |
| 3300026537|Ga0209157_1097797 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300026548|Ga0209161_10067828 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300027006|Ga0209896_1046014 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027360|Ga0209969_1066740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 570 | Open in IMG/M |
| 3300027490|Ga0209899_1073506 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300027577|Ga0209874_1137837 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300027646|Ga0209466_1025432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1222 | Open in IMG/M |
| 3300027654|Ga0209799_1040044 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300027765|Ga0209073_10081698 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300027815|Ga0209726_10035259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3773 | Open in IMG/M |
| 3300027882|Ga0209590_10449369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 833 | Open in IMG/M |
| 3300027909|Ga0209382_10858615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 960 | Open in IMG/M |
| 3300028792|Ga0307504_10029729 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| 3300028809|Ga0247824_10215079 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1056 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1036022 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300031546|Ga0318538_10152067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300031682|Ga0318560_10652800 | Not Available | 569 | Open in IMG/M |
| 3300031720|Ga0307469_10071106 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300031720|Ga0307469_10351069 | All Organisms → cellular organisms → Bacteria | 1238 | Open in IMG/M |
| 3300031731|Ga0307405_11188671 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300031770|Ga0318521_10031061 | All Organisms → cellular organisms → Bacteria | 2616 | Open in IMG/M |
| 3300031793|Ga0318548_10268353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 839 | Open in IMG/M |
| 3300031819|Ga0318568_10021242 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
| 3300031820|Ga0307473_10934468 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031820|Ga0307473_11472555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300031947|Ga0310909_10895967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300031949|Ga0214473_11799675 | Not Available | 605 | Open in IMG/M |
| 3300032002|Ga0307416_102751880 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300032076|Ga0306924_10049951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4613 | Open in IMG/M |
| 3300032180|Ga0307471_100618307 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300032180|Ga0307471_103122829 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300032180|Ga0307471_103699644 | Not Available | 541 | Open in IMG/M |
| 3300032205|Ga0307472_101841817 | Not Available | 602 | Open in IMG/M |
| 3300032205|Ga0307472_102032830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
| 3300033433|Ga0326726_10591310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1067 | Open in IMG/M |
| 3300033815|Ga0364946_072788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 738 | Open in IMG/M |
| 3300034155|Ga0370498_022659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1339 | Open in IMG/M |
| 3300034818|Ga0373950_0148784 | Not Available | 534 | Open in IMG/M |
| 3300034820|Ga0373959_0063894 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.33% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.35% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.35% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 4.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.72% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.63% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.63% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.63% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.09% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.09% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.09% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.09% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.54% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.54% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.54% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.54% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.54% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.54% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.54% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.54% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.54% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.54% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004052 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005883 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014259 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034155 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F12B_100341943 | 3300000443 | Soil | VPAGAIVKFPANVPHDVRNLGAERCVIMFLKVNPKVLKAGAGAGA* |
| F14TC_1007047721 | 3300000559 | Soil | GNPLVNEVVVPAGAIVRFPANVPHDVRNLGRERCVIMFLKIXXXXLRVVGGS* |
| JGI11615J12901_115886861 | 3300000953 | Soil | AIVKFPKSVPHDVRNLGPGRCVIMFLKVNPKILKGPADG* |
| JGI1027J12803_1054286842 | 3300000955 | Soil | KFPANVPHDVRNLGRERCVIMFLKINPKVLRVGGS* |
| JGI1027J12803_1091155123 | 3300000955 | Soil | NSVMHDVRNLGVERCVIMFLKINPKLLKGEPLNG* |
| JGI1027J12803_1092728352 | 3300000955 | Soil | EEVVVPAGAIVKFPANVPHDVRNLGADRCVIMFLKVNPKVLKS* |
| JGI10220J13317_122312341 | 3300001139 | Soil | VKFPANVPHDVRNLGRERCVIMFLKINPKVLRAGGS* |
| JGI25612J43240_10732521 | 3300002886 | Grasslands Soil | DGEEVVVEAGSIVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSGKADG* |
| JGI25386J43895_102001502 | 3300002912 | Grasslands Soil | VVPAGAIIKFPANVPHDVRNLQADRCVIMFLKCSPRVLR* |
| soilL1_100141533 | 3300003267 | Sugarcane Root And Bulk Soil | AIIDKKIAGEEIVAPAGSIVKAEAFGTDDVRNLGQTRCVIMFLKLNPKVLKG* |
| Ga0055469_101702881 | 3300003999 | Natural And Restored Wetlands | SIVRFPSRVPHDVRNLSADRCVIMFLKINPKVLQAAADG* |
| Ga0055490_102158292 | 3300004052 | Natural And Restored Wetlands | GEEVVVEAGSIVKFPRSVAHDVRNLGPERCVIMFLKVNPKALSARADG* |
| Ga0066396_100414253 | 3300004267 | Tropical Forest Soil | VVPAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKILKGTSDG* |
| Ga0062595_1012521483 | 3300004479 | Soil | VVVPAGAIVKFPANVPHDVRNLGTERCVIMFLKINPKVLKAGS* |
| Ga0062592_1012744131 | 3300004480 | Soil | AGSIVKFPSNVPHDVRNLGSERCVIMFLKVNPKVLKGAAGG* |
| Ga0066688_103410113 | 3300005178 | Soil | GQEVVVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG* |
| Ga0070683_1010366101 | 3300005329 | Corn Rhizosphere | EVVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG* |
| Ga0066388_1024057801 | 3300005332 | Tropical Forest Soil | VVPAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKVLKGTIDG* |
| Ga0066388_1032177252 | 3300005332 | Tropical Forest Soil | VPAGSIVRFPSNVMHDVRNLGVERCVIMFLKINPKLLKESRSNG* |
| Ga0066388_1080054442 | 3300005332 | Tropical Forest Soil | PAGAIVKFPANVPHDVRNLGQERCVIMFLKVNPKVLKAGAGAGA* |
| Ga0070692_107486491 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGAIVKFPANVPHDVRNLGQQRCVIMFLKVNPKVLKAGAGA* |
| Ga0070703_105265372 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIDGQEVVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG* |
| Ga0070708_1013341781 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAGAIVKFPAAVPHDVRNLGDDRLVIMFLKVNPKVLKV* |
| Ga0066686_104145971 | 3300005446 | Soil | SIAGEEVVVPAGAIVQFPASVPHDVRNLGADRCVIMFLKVNPKVLKAGADGAGA* |
| Ga0070707_1005705311 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GHEIVLPAGSLAKFPNRVTHDVRNLGPERCVIMFFKVNPRVLKESRDG* |
| Ga0070707_1012565341 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EEVVVPAGAIVKFPAAVPHDVRNLGDDRLVIMFLKVNPKVLKV* |
| Ga0070699_1010737141 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | PAGAMVKFPAAVLHDVRNLGTERCVIMFLKVNPKVLKPA* |
| Ga0070699_1016803682 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FPNAVMHDVRNLGTERCVIMFLKVNPKVLPKTNKDTHDG* |
| Ga0070672_1004745381 | 3300005543 | Miscanthus Rhizosphere | YMSIDGQEVVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG* |
| Ga0070704_1022502211 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VPAGAIVKFPAAVPHDVRNLGTERCVIMFLKINPKVLKPV* |
| Ga0066707_100399151 | 3300005556 | Soil | VVVPAGSIVNFPNNVAHDVRNLGAERCVIMFLKVNPKVLKSTMNG* |
| Ga0066699_104145801 | 3300005561 | Soil | EVVVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG* |
| Ga0066705_109491711 | 3300005569 | Soil | IVKFPNAVLHDVRNLGTERCVIMFIKVNPKVLKG* |
| Ga0066694_102153513 | 3300005574 | Soil | VKFPSNVPHDVRNLRNERCVIMFIKANPKILRGVSDG* |
| Ga0068854_1004620761 | 3300005578 | Corn Rhizosphere | IDGLEVVVEAGSIVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSAKTDG* |
| Ga0066706_100826064 | 3300005598 | Soil | FPNSVPHDVRNLGTERCVIMFLKVNPRVLKGSADG* |
| Ga0066706_110439613 | 3300005598 | Soil | GQEVIVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG* |
| Ga0068859_1029490281 | 3300005617 | Switchgrass Rhizosphere | GQEVVVPAGALVKFPTQVLHDVRNLGSERCVIMFVKVNPKVLGRGQQEDRDGSRRAL* |
| Ga0068866_107683131 | 3300005718 | Miscanthus Rhizosphere | VPAGAIVKFPANVPHDVRNLGRERCVIMFLKINPKVLRVGGS* |
| Ga0068861_1020292201 | 3300005719 | Switchgrass Rhizosphere | VEAGSIVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSAKADG* |
| Ga0066903_1088769312 | 3300005764 | Tropical Forest Soil | IRFPNNVMHDVRNLGRERCVIMFLKVNPKLLKEPRHG* |
| Ga0068863_1017285653 | 3300005841 | Switchgrass Rhizosphere | FPANVPHDVRNLGTERCVIMFLKINPKLLRSGDGAGA* |
| Ga0068860_1012187863 | 3300005843 | Switchgrass Rhizosphere | IVRFPNSVMHDVRNLGVERCVIMFLKINPKLLKGEPLNG* |
| Ga0075293_10051823 | 3300005875 | Rice Paddy Soil | GQEVVVPAGSIVRFPRRVMHDVRNPGPGRCVIMFLKVNPKVLRDG* |
| Ga0075299_10258313 | 3300005883 | Rice Paddy Soil | DGQAVVVPAGSIVQFPRRVLHDVRNPGPGRCVIMFLKVNPKALRDG* |
| Ga0075417_100962931 | 3300006049 | Populus Rhizosphere | MSIDGHEITVPAGSIVKFPDNVLHDVRNLGTDRCVIMFVKVNPKILKATGGG* |
| Ga0075432_104773481 | 3300006058 | Populus Rhizosphere | TVPAGAIVKFPANVPHDVRNLSQERCVIMFLKVNPKVLKAGAGA* |
| Ga0075422_100124961 | 3300006196 | Populus Rhizosphere | HMSIGGEDVVVPAGAIVQFPNAVLHDVRNPGPGRCVIMFVKVNPKVLKTSAEEAAHG* |
| Ga0079220_102371381 | 3300006806 | Agricultural Soil | PAGSIVKFPNNVPHDVRNLGQERCVIMFMKVNPKVLRG* |
| Ga0075421_1018552941 | 3300006845 | Populus Rhizosphere | IVKFPHNVPHDVRNLGRERCVIMFIKVNPKVLKG* |
| Ga0075434_1016281353 | 3300006871 | Populus Rhizosphere | HEITVPAGSIVKFPNSVPHDVRNLGADRCVIMFVKVNPKVLKGGADG* |
| Ga0068865_1022005722 | 3300006881 | Miscanthus Rhizosphere | IVPAGAIVKFPANVPHDVRNLGQQRCVIMFLKVNPKVLKAGAGA* |
| Ga0075426_105678321 | 3300006903 | Populus Rhizosphere | VPAGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG* |
| Ga0075436_1002625411 | 3300006914 | Populus Rhizosphere | MSIDGQEVVVPAGSIVHFPDRVLHDVRNLGPGRCVIMFVKINPKVLRDG* |
| Ga0079219_100929673 | 3300006954 | Agricultural Soil | SIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG* |
| Ga0075419_114781651 | 3300006969 | Populus Rhizosphere | GGIVRFPHAVPHDVRNLGPDRCVIMFVKLNPKVLKGGGAADG* |
| Ga0099791_106039682 | 3300007255 | Vadose Zone Soil | AGAIVKFPAAVPHDVRNLGDDRLVIMFIKVNPKLLKG* |
| Ga0066710_1003859105 | 3300009012 | Grasslands Soil | DGQEVVVNAGAIVKFPNAVLHDVRNLGPGRCVIMFLKVNPKVLKTVDGHGPSRST |
| Ga0099830_101772861 | 3300009088 | Vadose Zone Soil | QEVVVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG* |
| Ga0099827_113697733 | 3300009090 | Vadose Zone Soil | EAGSIVKFPRSVMHDVRNLGPERCVIMFIKVNPKVLRDG* |
| Ga0075418_101102111 | 3300009100 | Populus Rhizosphere | VPAGAIVKFPANVPHDVRNLGQQRCVIMFLKVNPKVLKAGAGA* |
| Ga0066709_1022746493 | 3300009137 | Grasslands Soil | EATDTMSFAGEEVVVPAGAIVQFPASVPRDDRNLGADRCVIMFLKVNPKVLKAGADGAGA |
| Ga0114129_115585163 | 3300009147 | Populus Rhizosphere | VLHDVRNPGPGRCVIMFVKVNPKVLKASAEEAAHG* |
| Ga0111538_121310911 | 3300009156 | Populus Rhizosphere | NVPHDVRNLGSDRCVIMFVKVNPKLLKNAEPARDG* |
| Ga0111538_125915771 | 3300009156 | Populus Rhizosphere | FPSNVPHDVRNLGSERCVIMFLKVNPKVLKGAAGG* |
| Ga0075423_129812961 | 3300009162 | Populus Rhizosphere | VVVPAGAIVKFPAAVPHDVRNLGDDRLVIMFLKVNPKVFRA* |
| Ga0105249_100898806 | 3300009553 | Switchgrass Rhizosphere | AMVKFPAAVLHDVRNLGTERCVIMFLKVNPKVLSAKADG* |
| Ga0105164_101443513 | 3300009777 | Wastewater | VKFPAAVPHDVRNLGSDRLVIMFVKVNPKVLKGPAHG* |
| Ga0105065_10269841 | 3300009803 | Groundwater Sand | VKFPASVPHDVQNRGADRCVIMFLKVNPKVLNARADGAGA* |
| Ga0105071_10826141 | 3300009808 | Groundwater Sand | AGAIVKFPATVPHDVRNLGADRCVIMFLKVNPKVLKAGGDSTGA* |
| Ga0105076_10973491 | 3300009816 | Groundwater Sand | DGQEVVVPAGALVKFPNRVLHDVRNLGAERCVIMFIKVNPKVLKEGRDG* |
| Ga0105068_10577823 | 3300009836 | Groundwater Sand | KFPKSVPHDVRNLGTERCVIMFLKVNPKVISVNG* |
| Ga0105058_11126921 | 3300009837 | Groundwater Sand | IVWFPNNIPHDVRNLESERCVIMFIKVNPKVLRGGADG* |
| Ga0126384_113083963 | 3300010046 | Tropical Forest Soil | DGQEVVVPAGSIVRFPSNVMHDVRNLGVERCVIMFLKINPKVLKESRSNG* |
| Ga0126382_107303033 | 3300010047 | Tropical Forest Soil | SIVRFPNNVMHDVRNVGTERCVIMFLKINPKLLKESRNG* |
| Ga0126382_116027831 | 3300010047 | Tropical Forest Soil | MSIDGAEVVVPSGAIVKFPANVPHDVRNLGAERCVIMFLKINPKVLRAGADTAGA* |
| Ga0134088_106409692 | 3300010304 | Grasslands Soil | PAGAIVKFPANVPHDVRNLGAERCVIMFLKVNPKVLKAGADGAGA* |
| Ga0134067_101347581 | 3300010321 | Grasslands Soil | EVVVPAGSIVTFPNSVPHDVRNLGTERCVIMFLKVNPRVLKGSADG* |
| Ga0134064_101106941 | 3300010325 | Grasslands Soil | EIAVDAGSIVKFASNVPHDVRNLRGERCVIMFVKVNPKVLKGSGDG* |
| Ga0126376_119018051 | 3300010359 | Tropical Forest Soil | GSVVKFPNQVLHDVRNLGGERCVIMFVKVNPKVLKENRDG* |
| Ga0126376_120061053 | 3300010359 | Tropical Forest Soil | EEVVVPAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKVLKGTIDG* |
| Ga0126372_106397033 | 3300010360 | Tropical Forest Soil | VVPAGSIVRFPSNVMHDVRNLGVERCVIMFLKINPKLLKESRSNG* |
| Ga0126372_112728323 | 3300010360 | Tropical Forest Soil | AHMAIDGQELVVPAGSIVKFPNAVMHDVRNLGPDRCVIMFLKVNPKVLPKDARADG* |
| Ga0126377_135174671 | 3300010362 | Tropical Forest Soil | IVKFPNAVLHDVRNLGTTRCVIMFIKVNPKVLKGTSDG* |
| Ga0126379_105534913 | 3300010366 | Tropical Forest Soil | QELVVPAGSIVKFPNSVMHDVRNLGPDRCVIMFLKVNPKVLPKDARADG* |
| Ga0126381_1030068243 | 3300010376 | Tropical Forest Soil | EVVVPAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKVLKGASDG* |
| Ga0137391_1000572612 | 3300011270 | Vadose Zone Soil | EVVVPAGTIVKFPASVPHDVRNLGADRCVIMFLKVNPKVLKAQADGAGA* |
| Ga0137455_11075003 | 3300011429 | Soil | IDGEEVVAAAGSIVKFPRSVMHDVRHLGPERCVIMFLKVNPKVLTAKADG* |
| Ga0137389_102731924 | 3300012096 | Vadose Zone Soil | GSIVKFPNAVMHDVRNLGAERCVIMFLKVNPKVLKAGHDG* |
| Ga0137388_119694502 | 3300012189 | Vadose Zone Soil | VVVPAGSIVKFPKSVSHDVRNLGSERCVIMFLKVNPRVLKGSADG* |
| Ga0137364_114475671 | 3300012198 | Vadose Zone Soil | VPAGAIIKFPANVPHDVRNLQSERCVIMFLKCNPRVLK* |
| Ga0137374_103000403 | 3300012204 | Vadose Zone Soil | TANMSIDGHEVVVRAGSIVKFPNAVMHDVRNLGPGRCVIMFLKVNPKVLKGSHHG* |
| Ga0137374_103105371 | 3300012204 | Vadose Zone Soil | KFPNAVPHDVRNLTGERAVIMFLKVNPKVLKGGADG* |
| Ga0137376_105021973 | 3300012208 | Vadose Zone Soil | FPANVPHDVRNLGRERCVIMFLKINPKVLKAGGS* |
| Ga0137447_11144472 | 3300012226 | Soil | KFPAAVPHDVRNLGTERCVIMFLKVNPKVLTAKADG* |
| Ga0137370_101849811 | 3300012285 | Vadose Zone Soil | IDGREVVVPAGSIVKFPRNVLHDVRNLGPERCVIMFVKVNPRILRGAADG* |
| Ga0137386_112163332 | 3300012351 | Vadose Zone Soil | SVPHDVRNLGADRCVIMFLKVNPKVLKAGADGAGA* |
| Ga0137369_1000553219 | 3300012355 | Vadose Zone Soil | VPAGAIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKGNHDG* |
| Ga0137384_100409811 | 3300012357 | Vadose Zone Soil | AGSIVKFPNAVLHDVRNLGPERCVIMFLKVNPKVLPKATKDGHDG* |
| Ga0137385_107886313 | 3300012359 | Vadose Zone Soil | FPNAVMHDVRNLGPERCVIMFLKVNPKVLKGNQDG* |
| Ga0137397_100939034 | 3300012685 | Vadose Zone Soil | TVPAGAIVKFPANVPHDVRNLGAERCVIMFLKVNPKVLKAGADGAGA* |
| Ga0157282_104270302 | 3300012904 | Soil | IVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSAKADG* |
| Ga0126375_105556793 | 3300012948 | Tropical Forest Soil | PAGAIVKFPANVPHDVRNLGRERCVIMFLKVNPKVLRAGTGAGA* |
| Ga0134087_100079926 | 3300012977 | Grasslands Soil | EEVVVPAGAIVKFPSNVPHDVRNVQNARCVIMFVKANPKLLRRSSDG* |
| Ga0157375_136024532 | 3300013308 | Miscanthus Rhizosphere | DGHEVVVRAGSIVKFPQAVMHDVRNLGPERCVIMFLKVNPKVLKGQHDG* |
| Ga0134075_102226591 | 3300014154 | Grasslands Soil | GEEYVVPAGAIIKFPANVDHDVRNLQSERCVIMFLKCNPKVLK* |
| Ga0075311_10334591 | 3300014259 | Natural And Restored Wetlands | IVQFPRNVPHDVRNPGPGRCVIMFLKVNPKVLRGQVDG* |
| Ga0075354_11166343 | 3300014308 | Natural And Restored Wetlands | VKFPRSVMHDVRNLGPERCVIMFLKVNPRVLSTKADG* |
| Ga0180063_10692743 | 3300014885 | Soil | AIVKFPRNVPHDVRNLGPGRCVIMFLKVNPKLFKGQADG* |
| Ga0157379_108293531 | 3300014968 | Switchgrass Rhizosphere | EVVVPAGALVKFPTQVLHDVRNLGSERCVIMFIKVNPKVLRGGQQEGRDG* |
| Ga0157379_116873003 | 3300014968 | Switchgrass Rhizosphere | GSIVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSAKADG* |
| Ga0137405_12828871 | 3300015053 | Vadose Zone Soil | VVVRAGSIVKFPNAVLHDVRNLGPERCVIMFLKVNPKVLKGSHDG* |
| Ga0132258_137854143 | 3300015371 | Arabidopsis Rhizosphere | EVPAGSIVKFPSNVPHDVRNLGSERCVIMFLKVNPKVLKGAAGG* |
| Ga0132256_1017801173 | 3300015372 | Arabidopsis Rhizosphere | AGSIVHFPDRVLHDVRNLGPGRCVIMFVKINPKVLRDG* |
| Ga0132256_1029840493 | 3300015372 | Arabidopsis Rhizosphere | AGAIVQFPSAVLHDVRNPGPDRCVIMFLKLNPKVLKASEAAGG* |
| Ga0132256_1033977352 | 3300015372 | Arabidopsis Rhizosphere | NMSIDGEEGVVPAGAIVKFPNNVPHDVRNLGPERCVIMFLKVNPKVLRG* |
| Ga0182035_110018021 | 3300016341 | Soil | EVVVPAGAIVNFPANVPHDVRNLGAERCVIMFLKINPKVLRAGADTAGA |
| Ga0187780_110590191 | 3300017973 | Tropical Peatland | EVVVEAGSIVQFPNRVMHDVRNPGPGRCVIMFLKVNPKVLRDG |
| Ga0184637_104533231 | 3300018063 | Groundwater Sediment | VEAGSIVKFPKSVMHDVRNLGPERCVIMFVKVNPKVLRDG |
| Ga0187773_100575001 | 3300018064 | Tropical Peatland | VVPAGAIVKFPANVPHDVRNLGTDRCVIMFLKINPKLLRAGGEAARA |
| Ga0184633_102009083 | 3300018077 | Groundwater Sediment | VVVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKGSHDG |
| Ga0184627_103034613 | 3300018079 | Groundwater Sediment | FPASVPHDVRNLGADRCVIMFLKVNPKVLKARADGAGG |
| Ga0066655_104689931 | 3300018431 | Grasslands Soil | LAKFPNRVMHDVRNLGPGRCVIMFFKVNPRVLKESRDG |
| Ga0066662_119168742 | 3300018468 | Grasslands Soil | MSIAGEEVVVPAGAIVKFPASVPHDVRNLGADRCVIMFLKVNPKVLNARADGAGA |
| Ga0184646_14581704 | 3300019259 | Groundwater Sediment | VPAGAIVTFPASVPHDVRNLGADRCVIMFLKVNPKVLKARADGAGA |
| Ga0179594_102074551 | 3300020170 | Vadose Zone Soil | KFPANVPHDVRNLGSERCVIMFLKINPRLLRAAAS |
| Ga0210403_102570501 | 3300020580 | Soil | REIVVEAGSIVQFPNSVMHDVRNPGPGRCVIMFLKVNPKVLRDG |
| Ga0210401_116438571 | 3300020583 | Soil | AGSIVKFPQSVLHDVRNPGPERCVIMFLKVNPKVLRDG |
| Ga0210108_11015733 | 3300025560 | Natural And Restored Wetlands | EVVVPAGAIVKFPSAVMHDVRNLGTERCVIMFLKVNPKVLKGSHDG |
| Ga0207642_109045541 | 3300025899 | Miscanthus Rhizosphere | EVVVPAGAIVKFPANVPHDVRNLGRERCVIMFLKINPKVLRVGGS |
| Ga0207647_107490252 | 3300025904 | Corn Rhizosphere | KFPQAVMHDVRNLGPERCVIMFLKVNPKVLSAKADG |
| Ga0207671_112217122 | 3300025914 | Corn Rhizosphere | DGQEVVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG |
| Ga0207701_114870923 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | AIVKFPHNVPHDVRNLGPERCVIMFIKLNPKVLKG |
| Ga0207669_115595003 | 3300025937 | Miscanthus Rhizosphere | MNIDGQEVVVPAGALVKFPTQVLHDVRNLGSERCVIMFIKLNPKVLKG |
| Ga0207658_106615091 | 3300025986 | Switchgrass Rhizosphere | IVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG |
| Ga0207641_113364393 | 3300026088 | Switchgrass Rhizosphere | GAEVVVPAGAIVKFPANVPHDVRNLGTERCVIMFLKINPKLLRSGDGAGA |
| Ga0207675_1006721053 | 3300026118 | Switchgrass Rhizosphere | MSIDGLEVGVEAGSIVKFPRSVMHDVRNLGPERCVIMFLKVNPKVLSAKADG |
| Ga0209268_10186101 | 3300026314 | Soil | FPSNVPHDVRNLRNERCVIMFIKANPKILRGVSDG |
| Ga0209154_10932881 | 3300026317 | Soil | IVTFPNSVPHDVRNLGTERCVIMFLKVNPRVLKGSAYG |
| Ga0209375_10212171 | 3300026329 | Soil | GAIVRFPENVPHDVRNLGAERCVIMFLKVNPKVLKAGADGAGA |
| Ga0209473_11587263 | 3300026330 | Soil | IDGREVVVPAGSIVKFPRNVLHDVRNLGPERCVIMFVKVNPKILRGSADG |
| Ga0209804_12613801 | 3300026335 | Soil | IKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG |
| Ga0209159_100694812 | 3300026343 | Soil | EVVVPAGSIVNFPNNVAHDVRNLGAERCVIMFLKVNPKVLKSTMNG |
| Ga0209378_100007270 | 3300026528 | Soil | IVVPAGAIVKFPSNLPHDVRNVQNARCVIMFIKANPKLLRRSSDG |
| Ga0209058_10144171 | 3300026536 | Soil | IVQFPASVPHDVRNLGADRCVIMFLKVNPKVLKAGADGAGA |
| Ga0209157_10977971 | 3300026537 | Soil | AGEEHVVPAGAIIKFPANVPHDVRNLQADRCVIMFLKCNPKVLK |
| Ga0209161_100678285 | 3300026548 | Soil | DGREVVVPAGSIVKFPSAVMHDVRNLGTERCVIMFLKVNPKVLPRTNTDTHDG |
| Ga0209896_10460141 | 3300027006 | Groundwater Sand | SIAGEEVVVPAGGIVKFPKNVPHDVRNLGPGRCVIMFLKVNPKILKSAADG |
| Ga0209969_10667402 | 3300027360 | Arabidopsis Thaliana Rhizosphere | AGGIVKFPNNVPHDVRNLGPGRCVIMFLKINPKILKGGADG |
| Ga0209899_10735061 | 3300027490 | Groundwater Sand | EIVVEAGSIVKFPKSVMHDVRNLGPERCVIMFLKVNPKMLPKGGDG |
| Ga0209874_11378373 | 3300027577 | Groundwater Sand | FPASVPHDVQNRGADRCVIMFLKVNPKVLKAQADGAGA |
| Ga0209466_10254323 | 3300027646 | Tropical Forest Soil | PAGAVVKFPANVPHDVRNLGRERCVIMFLKVNPKVLRAGTGAGA |
| Ga0209799_10400443 | 3300027654 | Tropical Forest Soil | IVKFPNAVLHDVRNLGSTRCVIMFLKVNPKVLKGTSDG |
| Ga0209073_100816983 | 3300027765 | Agricultural Soil | AGSIVKFPNNVPHDVRNLGQERCVIMFMKVNPKVLRG |
| Ga0209726_100352596 | 3300027815 | Groundwater | MSIDGEGVVVEAGSIVKFPRSAMHDVRNLGPERCVIMLLKVSPKVLSGRADG |
| Ga0209590_104493691 | 3300027882 | Vadose Zone Soil | VVPAGSIVKFPNAVMHDVRNLGTERCVIMFLKVNPKVLPKTNKDTHDG |
| Ga0209382_108586153 | 3300027909 | Populus Rhizosphere | GEEVVVPAGAIVKFPNNVPHDVRNLGPERCVIMFLKVNPKVLRG |
| Ga0307504_100297294 | 3300028792 | Soil | SIVRFPNNVMHDVRNLGRERCVIMFIKVNPKTLKGSRDG |
| Ga0247824_102150793 | 3300028809 | Soil | FPKNVPHDVRNRGPGRCVIMFLKVNPRVLKGQADG |
| (restricted) Ga0255311_10360223 | 3300031150 | Sandy Soil | FPANVPHDVRNLGTDRCVIMFLKINPKLLRAGGDGAGA |
| Ga0318538_101520673 | 3300031546 | Soil | IVKFPANVPHDVRNLGAERCVIMFLKINPKVLRAGADTAGA |
| Ga0318560_106528001 | 3300031682 | Soil | EVVVRAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKILKGTSDG |
| Ga0307469_100711064 | 3300031720 | Hardwood Forest Soil | VVVPAGSIVKFPHNVPHDVRNLGADRCVIMFIKVNPKVLKA |
| Ga0307469_103510691 | 3300031720 | Hardwood Forest Soil | AIVKFPANVPHDVRNLGRERCVIMFLKINPKVLRAGVS |
| Ga0307405_111886713 | 3300031731 | Rhizosphere | VPAGSIVKFPHNVPHDVRNLGPERCVIMFIKLNPKVLKG |
| Ga0318521_100310611 | 3300031770 | Soil | FPNAVLHDVRNLGSTRCVIMFLKVNPKILKGTSDG |
| Ga0318548_102683531 | 3300031793 | Soil | VVVRAGSIVKFPNAVLHDVRNLGSTRCVIMFLKVNPKILKGTSDG |
| Ga0318568_100212426 | 3300031819 | Soil | VVVPAGAIVNFPANVPHDVRNLGAERCVIMFLKINPKVLRAGADTAGA |
| Ga0307473_109344683 | 3300031820 | Hardwood Forest Soil | VPAGAIVKFPSNVPHDVRNLGAKRCVIMFLKVNPKVLKG |
| Ga0307473_114725551 | 3300031820 | Hardwood Forest Soil | VVVPAGSIVKFPNGVPHDVRNLGTERCVIMFLKVNPRVLKGSAHG |
| Ga0310909_108959673 | 3300031947 | Soil | EVVVPAGSIVRFPNNVMHDVRNLGVKRCVIMFLKINPKLLKENRNG |
| Ga0214473_117996752 | 3300031949 | Soil | MEDEVAVASTTIVQFPANVPHDVRNLGAERCVIMFVKLNPKVLKGAEGRG |
| Ga0307416_1027518803 | 3300032002 | Rhizosphere | AGAIVKFPNNVPHDVRNLGPERCVIMFLKVNPKVLRA |
| Ga0306924_100499511 | 3300032076 | Soil | DEVVVPAGAIVNFPANVPHDVRNLGAERCVIMFLKINPKVLRAGADTAGA |
| Ga0307471_1006183073 | 3300032180 | Hardwood Forest Soil | EVVVPAGSIVKFPQSVLHDVRNPGPERCVIMFLKVNPKVLRDG |
| Ga0307471_1031228293 | 3300032180 | Hardwood Forest Soil | VSVPAGAIVKFPANVPHDVRNLGAERCVIMFLKVNPKILKS |
| Ga0307471_1036996443 | 3300032180 | Hardwood Forest Soil | VKFPNAVMHDVRNLGTERCVIMFLKVNPKVLKASHDG |
| Ga0307472_1018418171 | 3300032205 | Hardwood Forest Soil | SIDGQEVTVPAGAIVQFPSAVLHDVRNPGPDRCVIMFLKLNPKVLKASEAAGG |
| Ga0307472_1020328301 | 3300032205 | Hardwood Forest Soil | KFPNGVPHDVRNLGTERCVIMFLKVNPRVLKGSAHG |
| Ga0326726_105913103 | 3300033433 | Peat Soil | VKFPKAVMHDVRNLGAERCVIMFLKVNPKVLKGSHDG |
| Ga0364946_072788_604_738 | 3300033815 | Sediment | VLRAGSVAKFPNKVLHDVRNLGAERCVIMFFKVNPKVLKESPDG |
| Ga0370498_022659_11_169 | 3300034155 | Untreated Peat Soil | MSIDGADVVVEAGSIVKFPRSVMHDVRNLGPERCVIMFLKVNPRVLSAKADG |
| Ga0373950_0148784_8_136 | 3300034818 | Rhizosphere Soil | VVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG |
| Ga0373959_0063894_657_806 | 3300034820 | Rhizosphere Soil | MSIDGQEVVVPSGSIVHFPDRVLHDVRNPGPGRCVIMFVKINPKVLRDG |
| ⦗Top⦘ |