


| Basic Information | |
|---|---|
| Family ID | F030125 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 186 |
| Average Sequence Length | 45 residues |
| Representative Sequence | LRRHGAEPRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALA |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 186 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.54 % |
| % of genes near scaffold ends (potentially truncated) | 98.39 % |
| % of genes from short scaffolds (< 2000 bps) | 83.87 % |
| Associated GOLD sequencing projects | 128 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.806 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (36.022 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.484 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.323 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 11.43% Coil/Unstructured: 64.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 186 Family Scaffolds |
|---|---|---|
| PF00221 | Lyase_aromatic | 33.33 |
| PF07704 | PSK_trans_fac | 5.38 |
| PF01850 | PIN | 5.38 |
| PF03061 | 4HBT | 3.76 |
| PF00291 | PALP | 3.23 |
| PF07238 | PilZ | 1.61 |
| PF13614 | AAA_31 | 1.61 |
| PF13560 | HTH_31 | 1.61 |
| PF09346 | SMI1_KNR4 | 1.08 |
| PF00378 | ECH_1 | 1.08 |
| PF07690 | MFS_1 | 1.08 |
| PF01039 | Carboxyl_trans | 1.08 |
| PF01081 | Aldolase | 0.54 |
| PF13432 | TPR_16 | 0.54 |
| PF00682 | HMGL-like | 0.54 |
| PF05598 | DUF772 | 0.54 |
| PF06750 | DiS_P_DiS | 0.54 |
| PF13460 | NAD_binding_10 | 0.54 |
| PF07927 | HicA_toxin | 0.54 |
| PF01527 | HTH_Tnp_1 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 186 Family Scaffolds |
|---|---|---|---|
| COG2986 | Histidine ammonia-lyase | Amino acid transport and metabolism [E] | 33.33 |
| COG4423 | Uncharacterized conserved protein | Function unknown [S] | 5.38 |
| COG1989 | Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase | Cell motility [N] | 1.61 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 1.08 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.08 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 1.08 |
| COG0800 | 2-keto-3-deoxy-6-phosphogluconate aldolase | Carbohydrate transport and metabolism [G] | 0.54 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.81 % |
| Unclassified | root | N/A | 24.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10255928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 868 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100106552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2630 | Open in IMG/M |
| 3300002917|JGI25616J43925_10018833 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3059 | Open in IMG/M |
| 3300003219|JGI26341J46601_10112452 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300005175|Ga0066673_10284314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300005186|Ga0066676_10181395 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300005434|Ga0070709_11714594 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005518|Ga0070699_101216171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300005537|Ga0070730_10437468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
| 3300005586|Ga0066691_10075607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1855 | Open in IMG/M |
| 3300006052|Ga0075029_100307486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1013 | Open in IMG/M |
| 3300006237|Ga0097621_102167845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300006755|Ga0079222_11670548 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300006797|Ga0066659_10585758 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006854|Ga0075425_100031183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5912 | Open in IMG/M |
| 3300006871|Ga0075434_102115847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300006904|Ga0075424_102200196 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300006914|Ga0075436_101541699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium etli | 505 | Open in IMG/M |
| 3300007255|Ga0099791_10074125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
| 3300007258|Ga0099793_10017162 | All Organisms → cellular organisms → Bacteria | 2916 | Open in IMG/M |
| 3300007258|Ga0099793_10452154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300007258|Ga0099793_10683935 | Not Available | 517 | Open in IMG/M |
| 3300007265|Ga0099794_10073351 | Not Available | 1680 | Open in IMG/M |
| 3300007265|Ga0099794_10428738 | Not Available | 692 | Open in IMG/M |
| 3300009012|Ga0066710_100085023 | Not Available | 4149 | Open in IMG/M |
| 3300009012|Ga0066710_100455710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1919 | Open in IMG/M |
| 3300009088|Ga0099830_10631063 | Not Available | 880 | Open in IMG/M |
| 3300009089|Ga0099828_10398482 | Not Available | 1241 | Open in IMG/M |
| 3300009089|Ga0099828_11409554 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009089|Ga0099828_11593270 | Not Available | 575 | Open in IMG/M |
| 3300009137|Ga0066709_100899169 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300009137|Ga0066709_101002235 | Not Available | 1223 | Open in IMG/M |
| 3300009549|Ga0116137_1027052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2051 | Open in IMG/M |
| 3300009792|Ga0126374_10027908 | All Organisms → cellular organisms → Bacteria | 2597 | Open in IMG/M |
| 3300009792|Ga0126374_10309500 | Not Available | 1063 | Open in IMG/M |
| 3300010043|Ga0126380_11601533 | Not Available | 581 | Open in IMG/M |
| 3300010339|Ga0074046_10071406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2265 | Open in IMG/M |
| 3300010358|Ga0126370_10095777 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300010360|Ga0126372_12357961 | Not Available | 582 | Open in IMG/M |
| 3300010376|Ga0126381_103153110 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300011269|Ga0137392_10368545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1191 | Open in IMG/M |
| 3300011269|Ga0137392_11521013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300011270|Ga0137391_10188408 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300011270|Ga0137391_10554230 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 968 | Open in IMG/M |
| 3300011270|Ga0137391_11544575 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300011271|Ga0137393_10712264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 859 | Open in IMG/M |
| 3300011271|Ga0137393_11391381 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012096|Ga0137389_10140262 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1969 | Open in IMG/M |
| 3300012096|Ga0137389_10187908 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300012096|Ga0137389_10360353 | Not Available | 1238 | Open in IMG/M |
| 3300012189|Ga0137388_10277454 | Not Available | 1532 | Open in IMG/M |
| 3300012189|Ga0137388_11263434 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012198|Ga0137364_10533921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 883 | Open in IMG/M |
| 3300012198|Ga0137364_10723377 | Not Available | 752 | Open in IMG/M |
| 3300012199|Ga0137383_10469221 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012202|Ga0137363_10310407 | Not Available | 1297 | Open in IMG/M |
| 3300012202|Ga0137363_10435922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
| 3300012202|Ga0137363_11755467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300012205|Ga0137362_11579744 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012210|Ga0137378_10359749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1352 | Open in IMG/M |
| 3300012351|Ga0137386_10019909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4531 | Open in IMG/M |
| 3300012359|Ga0137385_10263209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1491 | Open in IMG/M |
| 3300012359|Ga0137385_10788141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 790 | Open in IMG/M |
| 3300012361|Ga0137360_10076486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2496 | Open in IMG/M |
| 3300012361|Ga0137360_10749390 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012362|Ga0137361_10288973 | Not Available | 1499 | Open in IMG/M |
| 3300012362|Ga0137361_10876679 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012582|Ga0137358_10236282 | All Organisms → cellular organisms → Bacteria | 1245 | Open in IMG/M |
| 3300012685|Ga0137397_10828757 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012922|Ga0137394_10121981 | All Organisms → cellular organisms → Bacteria | 2207 | Open in IMG/M |
| 3300012922|Ga0137394_11112024 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012923|Ga0137359_10237772 | Not Available | 1626 | Open in IMG/M |
| 3300012923|Ga0137359_11694063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012924|Ga0137413_10332486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300012925|Ga0137419_10825568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012929|Ga0137404_11031484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 753 | Open in IMG/M |
| 3300012929|Ga0137404_11132894 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300012944|Ga0137410_10113453 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300012944|Ga0137410_10198892 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300014151|Ga0181539_1382935 | Not Available | 504 | Open in IMG/M |
| 3300014200|Ga0181526_10758712 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300015053|Ga0137405_1203671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
| 3300015054|Ga0137420_1336951 | Not Available | 8293 | Open in IMG/M |
| 3300015241|Ga0137418_10776353 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300015242|Ga0137412_10328473 | Not Available | 1194 | Open in IMG/M |
| 3300015245|Ga0137409_10632568 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300015264|Ga0137403_10584002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
| 3300016270|Ga0182036_11642019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300016357|Ga0182032_10743006 | Not Available | 826 | Open in IMG/M |
| 3300016357|Ga0182032_11642225 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300016357|Ga0182032_11920142 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300016422|Ga0182039_10560694 | Not Available | 994 | Open in IMG/M |
| 3300017659|Ga0134083_10074071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1313 | Open in IMG/M |
| 3300017924|Ga0187820_1286306 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300017928|Ga0187806_1233751 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300017955|Ga0187817_11048235 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300017999|Ga0187767_10025710 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300018006|Ga0187804_10180908 | Not Available | 896 | Open in IMG/M |
| 3300018013|Ga0187873_1344710 | Not Available | 545 | Open in IMG/M |
| 3300018062|Ga0187784_10356270 | Not Available | 1185 | Open in IMG/M |
| 3300018090|Ga0187770_11588631 | Not Available | 533 | Open in IMG/M |
| 3300018482|Ga0066669_10071511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2294 | Open in IMG/M |
| 3300020140|Ga0179590_1026384 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300020140|Ga0179590_1216082 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300020170|Ga0179594_10063678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300020170|Ga0179594_10187440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300020579|Ga0210407_10624499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
| 3300020580|Ga0210403_10015892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6035 | Open in IMG/M |
| 3300020580|Ga0210403_11033909 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300020580|Ga0210403_11055260 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300020580|Ga0210403_11510300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 505 | Open in IMG/M |
| 3300021088|Ga0210404_10711606 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300021168|Ga0210406_10203597 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300021180|Ga0210396_11363076 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300021405|Ga0210387_10062202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3033 | Open in IMG/M |
| 3300021405|Ga0210387_10539539 | Not Available | 1037 | Open in IMG/M |
| 3300021405|Ga0210387_11596282 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300021406|Ga0210386_10309728 | Not Available | 1354 | Open in IMG/M |
| 3300021475|Ga0210392_10322782 | Not Available | 1111 | Open in IMG/M |
| 3300021477|Ga0210398_10846230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 735 | Open in IMG/M |
| 3300021478|Ga0210402_10066403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3181 | Open in IMG/M |
| 3300024330|Ga0137417_1419346 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300025914|Ga0207671_10481629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300026308|Ga0209265_1207195 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026310|Ga0209239_1072788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1498 | Open in IMG/M |
| 3300026330|Ga0209473_1206596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300026374|Ga0257146_1017114 | Not Available | 1181 | Open in IMG/M |
| 3300026542|Ga0209805_1137627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1138 | Open in IMG/M |
| 3300026817|Ga0207775_115821 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026945|Ga0207743_1007889 | Not Available | 1188 | Open in IMG/M |
| 3300027035|Ga0207776_1013501 | Not Available | 1164 | Open in IMG/M |
| 3300027548|Ga0209523_1053627 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300027575|Ga0209525_1019308 | Not Available | 1669 | Open in IMG/M |
| 3300027643|Ga0209076_1001839 | All Organisms → cellular organisms → Bacteria | 4458 | Open in IMG/M |
| 3300027655|Ga0209388_1016656 | All Organisms → cellular organisms → Bacteria | 2030 | Open in IMG/M |
| 3300027663|Ga0208990_1076172 | Not Available | 960 | Open in IMG/M |
| 3300027680|Ga0207826_1227185 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027846|Ga0209180_10514379 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 669 | Open in IMG/M |
| 3300027846|Ga0209180_10607124 | Not Available | 604 | Open in IMG/M |
| 3300027854|Ga0209517_10320924 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027857|Ga0209166_10052310 | Not Available | 2380 | Open in IMG/M |
| 3300027862|Ga0209701_10728365 | Not Available | 508 | Open in IMG/M |
| 3300027875|Ga0209283_10632679 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027882|Ga0209590_11041700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300027889|Ga0209380_10433312 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300027908|Ga0209006_10405704 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300030844|Ga0075377_11333646 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031057|Ga0170834_101260669 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300031057|Ga0170834_110955899 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031231|Ga0170824_115213910 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300031545|Ga0318541_10401022 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031561|Ga0318528_10031606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2605 | Open in IMG/M |
| 3300031713|Ga0318496_10474335 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300031718|Ga0307474_11609244 | Not Available | 510 | Open in IMG/M |
| 3300031720|Ga0307469_11469155 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031744|Ga0306918_10016143 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4398 | Open in IMG/M |
| 3300031744|Ga0306918_10890433 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300031754|Ga0307475_10522086 | Not Available | 953 | Open in IMG/M |
| 3300031754|Ga0307475_11234983 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300031781|Ga0318547_10480686 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300031820|Ga0307473_10495776 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300031823|Ga0307478_10025921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4186 | Open in IMG/M |
| 3300031823|Ga0307478_11512286 | Not Available | 555 | Open in IMG/M |
| 3300031833|Ga0310917_10490389 | Not Available | 836 | Open in IMG/M |
| 3300031890|Ga0306925_10726562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1037 | Open in IMG/M |
| 3300031893|Ga0318536_10039922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2234 | Open in IMG/M |
| 3300031896|Ga0318551_10843633 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031941|Ga0310912_10453275 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300031941|Ga0310912_10890663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 685 | Open in IMG/M |
| 3300031941|Ga0310912_11218190 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031945|Ga0310913_10067370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2366 | Open in IMG/M |
| 3300031954|Ga0306926_10192759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2529 | Open in IMG/M |
| 3300031962|Ga0307479_10627275 | Not Available | 1056 | Open in IMG/M |
| 3300031962|Ga0307479_10815247 | Not Available | 908 | Open in IMG/M |
| 3300031962|Ga0307479_11408462 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300032035|Ga0310911_10084885 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300032035|Ga0310911_10789495 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300032174|Ga0307470_10025466 | All Organisms → cellular organisms → Bacteria | 2739 | Open in IMG/M |
| 3300032180|Ga0307471_100707075 | Not Available | 1172 | Open in IMG/M |
| 3300032180|Ga0307471_104278549 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300032261|Ga0306920_101838596 | Not Available | 853 | Open in IMG/M |
| 3300032828|Ga0335080_11930319 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 573 | Open in IMG/M |
| 3300032954|Ga0335083_11111021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300032954|Ga0335083_11368273 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300033158|Ga0335077_11147550 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300033158|Ga0335077_11278818 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 36.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.13% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.23% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.23% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.15% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.61% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.61% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.08% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.54% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.54% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.54% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.54% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.54% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026817 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 17 (SPAdes) | Environmental | Open in IMG/M |
| 3300026945 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_102559283 | 3300001661 | Forest Soil | HGKYDPTFLPELTHEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| JGIcombinedJ26739_1001065521 | 3300002245 | Forest Soil | RTMELPVGHYSLELTPFSYIAGYRMFSYFLKALG* |
| JGI25616J43925_100188331 | 3300002917 | Grasslands Soil | QMLDSLRRHGADPRTLELACGHYSLELAPFSYIAGYRMLTFFLQSLA* |
| JGI26341J46601_101124523 | 3300003219 | Bog Forest Soil | EMLMSLRMHGAEPRTLELPVGHYSLELPPFSYIAGYRMFTYFLEALG* |
| Ga0066673_102843141 | 3300005175 | Soil | EMVDALHEHGAKPRTLELPCGHYSLELRPFSYIAGYRMLSYLKSALS* |
| Ga0066676_101813952 | 3300005186 | Soil | HGADPRTLELHCGHYSLELPPFSYIAGYRMLSFFLESLA* |
| Ga0070709_117145942 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | FLPELTHEMLEALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0070699_1012161712 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTSEMVDALHGHGANPRTLELPCGHYSLELRPFSYIAGYRMLTYMRSALA* |
| Ga0070730_104374681 | 3300005537 | Surface Soil | RRTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG* |
| Ga0066691_100756075 | 3300005586 | Soil | GADPRTLELACGHYSLELAPFSYVAGYRMLTFFLESLA* |
| Ga0075029_1003074863 | 3300006052 | Watersheds | RQMLDSLRRHGAHPRTLELVCGHYSLELPPFSHIAGYRMLSFFRSALA* |
| Ga0097621_1021678452 | 3300006237 | Miscanthus Rhizosphere | LPELTHEMLSSLRRHGAEPRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALA* |
| Ga0079222_116705482 | 3300006755 | Agricultural Soil | ETRTLELPVGHYSLELAPFSYIAGWRMFTYFLETLA* |
| Ga0066659_105857583 | 3300006797 | Soil | LRRHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLQSLA* |
| Ga0075425_1000311831 | 3300006854 | Populus Rhizosphere | LRRHGAEPRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALA* |
| Ga0075434_1021158471 | 3300006871 | Populus Rhizosphere | LTSEMVDALHEHGANPRTLELPCGHYSLELTPFSYVAGYRMLTYLRSALA* |
| Ga0075424_1022001962 | 3300006904 | Populus Rhizosphere | TAEMLEALHEHGASPKTLELACGHYSLELAPFSYIAGYRMLSYLRSALA* |
| Ga0075436_1015416991 | 3300006914 | Populus Rhizosphere | RQMLESLRRHGAYPFTLELACGHYSLELAPFSYIAGYRMLTFFLETLA* |
| Ga0099791_100741255 | 3300007255 | Vadose Zone Soil | DSLRRHGADPRTLELPCGHYSLELAPFSYIAGYHMLSFFTQSLA* |
| Ga0099793_100171621 | 3300007258 | Vadose Zone Soil | PRTLELTCGHYSLELAPFSYIAGYRMLTFFIESLA* |
| Ga0099793_104521542 | 3300007258 | Vadose Zone Soil | QMLDSLRHHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0099793_106839352 | 3300007258 | Vadose Zone Soil | PRTLELPCGHYSLELAPFSHLAGYRMLTFFLESLA* |
| Ga0099794_100733512 | 3300007265 | Vadose Zone Soil | PRTLELPCGHYSLELAPFSYIAGYCMLTFFLESLA* |
| Ga0099794_104287381 | 3300007265 | Vadose Zone Soil | LRRHGADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLESLA* |
| Ga0066710_1000850231 | 3300009012 | Grasslands Soil | LDSLRRHGADPRTLELPCGHYSLELAPFSYMAGYRMLTFFLQSLA |
| Ga0066710_1004557101 | 3300009012 | Grasslands Soil | LDSLRRHGADPRTLELPCGHYSLELAPFSYMAGYRMLTFFLESLA |
| Ga0099830_106310631 | 3300009088 | Vadose Zone Soil | RHRAEPRALELPCGHYSLELAPFSYIAGYRMLSFFLESLA* |
| Ga0099828_103984821 | 3300009089 | Vadose Zone Soil | RTLELPCGHYSLELAPFSYIAGYRMLTFFLQSLA* |
| Ga0099828_114095542 | 3300009089 | Vadose Zone Soil | AALEANGSEPRTLGLHCGHYSLELPPFSYVAGYRMGAFFLEALG* |
| Ga0099828_115932703 | 3300009089 | Vadose Zone Soil | AEPKTLELPVGHYSLELRPFSYVAGARMFGYFLGAIG* |
| Ga0066709_1008991691 | 3300009137 | Grasslands Soil | DSLRRHGAEPHTLELACGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0066709_1010022351 | 3300009137 | Grasslands Soil | DSLRRHGAEPHTLELACGHYSLELAPFSYIAGYRMLTFFLDSLA* |
| Ga0116137_10270524 | 3300009549 | Peatland | RTLELPVGHYSLELAPFSYVAGWRMFTYFLAALG* |
| Ga0126374_100279084 | 3300009792 | Tropical Forest Soil | LGALRRNGAETRTLELPVGHYSLELRPFSYIAGWRMFTYFLEALG* |
| Ga0126374_103095001 | 3300009792 | Tropical Forest Soil | LQRHGAETRTLELPVGHYSLELVPFSYIAGYRMITYFLEALG* |
| Ga0126380_116015331 | 3300010043 | Tropical Forest Soil | THQMLGALRRHGAETRTLELPVGHYSLELRPFSYIAGWRMFTYFLEALG* |
| Ga0074046_100714064 | 3300010339 | Bog Forest Soil | ELTREMLAALRRNGAEARTLELPVGHYSLELAPFSYVAGWRMFTYFLEALG* |
| Ga0126370_100957771 | 3300010358 | Tropical Forest Soil | LTGRMLESLRRHGAETRTLELPVGHYSLELPPFSYIAGYRMITYFLEALG* |
| Ga0126372_123579611 | 3300010360 | Tropical Forest Soil | RHGAETRTLELPVGHYSLELRPFSYIAGWRMFTYFLEALG* |
| Ga0126381_1031531102 | 3300010376 | Tropical Forest Soil | FLPELTQQMLGALRKHGAQPRTLELPVGHYSLELLPFSYVAGWRMFTYFMEALG* |
| Ga0137392_103685451 | 3300011269 | Vadose Zone Soil | RTLELPCGHYSLELAPFSYLAGYRMLTFFLESLA* |
| Ga0137392_115210131 | 3300011269 | Vadose Zone Soil | ENMVEALHEHGANPRTLELPCGHYSLELMPFSYIAGYRMLTYLRSALR* |
| Ga0137391_101884081 | 3300011270 | Vadose Zone Soil | GADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLESLA* |
| Ga0137391_105542302 | 3300011270 | Vadose Zone Soil | LDSLRRHGADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLQSLA* |
| Ga0137391_115445752 | 3300011270 | Vadose Zone Soil | TRQMLDSLRRHGAEPRTLELACGHYSLELAPFSYIAGYRMLSFFLESLA* |
| Ga0137393_107122642 | 3300011271 | Vadose Zone Soil | MLDSLRRHGADPRTLELACGHYSLELAPFSYIAGYRMLTFFLQSLA* |
| Ga0137393_113913811 | 3300011271 | Vadose Zone Soil | ELTRQMLDSLRRHGAEPRALELPCVHYSLELVPFSYIAGYRMLTFFLQSLA* |
| Ga0137389_101402621 | 3300012096 | Vadose Zone Soil | ADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLQSLA* |
| Ga0137389_101879084 | 3300012096 | Vadose Zone Soil | LPELTHEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG* |
| Ga0137389_103603533 | 3300012096 | Vadose Zone Soil | RRHGADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLESLA* |
| Ga0137388_102774541 | 3300012189 | Vadose Zone Soil | QMLDSLRRHGADPRTLELPCGHYSLELAPFSYLASYRMLTFFLESLA* |
| Ga0137388_112634342 | 3300012189 | Vadose Zone Soil | YMVYGKYDPTFVPELTSAMLAALEANGSEPRTLGLHCGLYSLELPPFSYVAGYRMGAFFLEALG* |
| Ga0137364_105339213 | 3300012198 | Vadose Zone Soil | RRHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLQSLA* |
| Ga0137364_107233771 | 3300012198 | Vadose Zone Soil | NSLRRHGAEPRTLELACGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0137383_104692211 | 3300012199 | Vadose Zone Soil | HGADPRTLELACGHYSLELAPFSYIAGYRMLTFFLQSLA* |
| Ga0137363_103104072 | 3300012202 | Vadose Zone Soil | THEMLDALRRTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALS* |
| Ga0137363_104359221 | 3300012202 | Vadose Zone Soil | SLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0137363_117554671 | 3300012202 | Vadose Zone Soil | RQMLDSLRRHGADPRTLELSCGHYSLELAPFSYVAGYRMLTFFLESLA* |
| Ga0137362_115797441 | 3300012205 | Vadose Zone Soil | RQMLDSLRCHGADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLESLA* |
| Ga0137378_103597491 | 3300012210 | Vadose Zone Soil | MVDALHEHGANPRTLELPCGHYSLELVPFNYIAGYRMLSYLRSALR* |
| Ga0137386_100199091 | 3300012351 | Vadose Zone Soil | KMLDSLRHHGADPRTLELPCGHYSLELAPFSYIAGYRMFTFFLESLA* |
| Ga0137385_102632091 | 3300012359 | Vadose Zone Soil | GADPRTLELPCGHYSLELVPFSYIAGYRMLSFFLGSLA* |
| Ga0137385_107881413 | 3300012359 | Vadose Zone Soil | DSLRRHGADTRTLELHCGHYSLELAPFSYIAGYRMLSFFLDSLA* |
| Ga0137360_100764861 | 3300012361 | Vadose Zone Soil | GADPRTLELPCGHYSLELPPFSYLAGYRMLTFFLESLA* |
| Ga0137360_107493901 | 3300012361 | Vadose Zone Soil | HSFRRHSADLRTLELHCGHYSLELPPFSYIAGYRMLAFFLESLA* |
| Ga0137361_102889731 | 3300012362 | Vadose Zone Soil | RHGADPRTLELPCGHYSLELAPFSYLASYRMLTFFLESLA* |
| Ga0137361_108766791 | 3300012362 | Vadose Zone Soil | ADPRTLELTCGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0137358_102362824 | 3300012582 | Vadose Zone Soil | KSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137397_108287572 | 3300012685 | Vadose Zone Soil | RHGADPRTLELACGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0137394_101219814 | 3300012922 | Vadose Zone Soil | FLPELTHEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137394_111120243 | 3300012922 | Vadose Zone Soil | EPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137359_102377721 | 3300012923 | Vadose Zone Soil | MLHSLRRHSADPRTLELHCGHYSLELPPFSYIAGYRMLSFFLESLA* |
| Ga0137359_116940632 | 3300012923 | Vadose Zone Soil | PRTLELPCGHYSLELAPFSYIAGYRMLTFFGESLP* |
| Ga0137413_103324864 | 3300012924 | Vadose Zone Soil | YDPTFLPELTHEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137419_108255681 | 3300012925 | Vadose Zone Soil | RQMLDSLRRHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLESLA* |
| Ga0137404_110314841 | 3300012929 | Vadose Zone Soil | QMLDSLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLEFLA* |
| Ga0137404_111328942 | 3300012929 | Vadose Zone Soil | HGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLETLA* |
| Ga0137410_101134534 | 3300012944 | Vadose Zone Soil | LPELTHEMLDALRKTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137410_101988923 | 3300012944 | Vadose Zone Soil | LDSLRRHGADPRTLELPCGHYSLELAPFSYIAGYHMLSFFTQSLA* |
| Ga0181539_13829351 | 3300014151 | Bog | LRKNGAEPRTLELPVGHYSLELAPFSWVAGWRMFTYFLEALG* |
| Ga0181526_107587121 | 3300014200 | Bog | ALRRHGADPRTLELPVGHYSLELAPFSYVAGYGMLMYFLEALG* |
| Ga0137405_12036715 | 3300015053 | Vadose Zone Soil | ADHRTLELPCGHYSLELAPFSHLAGYRMLTFFLESLA* |
| Ga0137420_13369512 | 3300015054 | Vadose Zone Soil | MVYGKYDPTFLPELTHEMLDALRKTGAERARWNFRWGTTRWSWRPFSYIAGWRMFTYFLEALA* |
| Ga0137418_107763531 | 3300015241 | Vadose Zone Soil | MLDSLRRHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLESLA* |
| Ga0137412_103284731 | 3300015242 | Vadose Zone Soil | ALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA* |
| Ga0137409_106325683 | 3300015245 | Vadose Zone Soil | DPRTLELPCGHYSLELAPFSYIAGYHMLSFFTQSLA* |
| Ga0137403_105840021 | 3300015264 | Vadose Zone Soil | MLDSLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA* |
| Ga0182036_116420192 | 3300016270 | Soil | TTQMLDALHKHGADPQTLELACGHYSLELAPFSYIAGYRMLNYFRAKLA |
| Ga0182032_107430062 | 3300016357 | Soil | PEFTERMLESLRRHGSETRTLELPVGHYSLELVPFSYIAGYRMITYFLEALG |
| Ga0182032_116422251 | 3300016357 | Soil | TFLPELTHEMLGSLRRNGAETRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALG |
| Ga0182032_119201422 | 3300016357 | Soil | FLPELTHQMLDSLRRHDADPMTLELPVGHYSLELVPFSYVAGYRMISYFLEALA |
| Ga0182039_105606941 | 3300016422 | Soil | ETRTLELPVGHYSLELAPFSYIAGYRMITYFLEALG |
| Ga0134083_100740713 | 3300017659 | Grasslands Soil | LRRHGAEPRTLELACGHYSLELPPFSYIAGYCMLTFFLEGLA |
| Ga0187820_12863062 | 3300017924 | Freshwater Sediment | LRALRQHGADPRTMELPVGHYSLEVPPFSYIAGYRMFMFFLEALG |
| Ga0187806_12337511 | 3300017928 | Freshwater Sediment | EQMLRALRQHGADPRTMELPVGHYSLEVFPFSYIAGYRMFMFFLEALG |
| Ga0187817_110482352 | 3300017955 | Freshwater Sediment | PELTRKMLESLRRHGAEPRTLELPVGHYSLELAPFSYIAGWRMITYFLEALG |
| Ga0187767_100257101 | 3300017999 | Tropical Peatland | AEPRTMELPVGHYSLELPPFSYVAGYRMFMYFLEALG |
| Ga0187804_101809081 | 3300018006 | Freshwater Sediment | MLRALRQHGADPRTMELPVGHYSLEVLPFSYIAGYRMFMFFLEALG |
| Ga0187873_13447101 | 3300018013 | Peatland | HGSDPRTLGLPCGHYSLELPPFGYIAGIRMGMFFLDALA |
| Ga0187784_103562702 | 3300018062 | Tropical Peatland | QMLRSLRLHGAEPRTMELPVGHYSLELPPFSYVAGYNMFMYLLEALG |
| Ga0187770_115886311 | 3300018090 | Tropical Peatland | LTEQMLRSLCAHRAETRTLELPIGHYSLELPPFSYVAGYRMIMYFLEALG |
| Ga0066669_100715113 | 3300018482 | Grasslands Soil | RHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLQSLA |
| Ga0179590_10263841 | 3300020140 | Vadose Zone Soil | LTNERLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0179590_12160821 | 3300020140 | Vadose Zone Soil | PTFLPELTHEMLDALRKTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0179594_100636783 | 3300020170 | Vadose Zone Soil | RNMLDSLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0179594_101874402 | 3300020170 | Vadose Zone Soil | MLDSLRRHGAEPRTLELACGHYSLELAPFSYIAGYRMLTFFFKSLA |
| Ga0210407_106244991 | 3300020579 | Soil | GAENRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0210403_100158929 | 3300020580 | Soil | LLESGAETRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0210403_110339092 | 3300020580 | Soil | FLPELTHEMLGALRKSGAETRTLELPVGHYSLELAPFSYIAGWRMFSYFLEALA |
| Ga0210403_110552601 | 3300020580 | Soil | CGAELRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0210403_115103001 | 3300020580 | Soil | DSLRRHGADPRTLELPCGHYSLELAPFSYVAGYRMLTFFLESLA |
| Ga0210404_107116062 | 3300021088 | Soil | LTRQMLDSLRRHGADPRTLELACGHYSLELAPFSYIAGYRMLAFFLESLA |
| Ga0210406_102035971 | 3300021168 | Soil | THEMLNALRESGAEARTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0210396_113630762 | 3300021180 | Soil | FLPELTHEMLSSLRRHGAEPRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALA |
| Ga0210387_100622024 | 3300021405 | Soil | EMLGALRKSGAETRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0210387_105395394 | 3300021405 | Soil | LPELTHKMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0210387_115962821 | 3300021405 | Soil | GKYDPTFLPELTHEMLGALRKSGAETRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0210386_103097284 | 3300021406 | Soil | AEPRTLELPVGHYSLELAPFSYVAGWRMFSYFLEALG |
| Ga0210392_103227821 | 3300021475 | Soil | LEALRKSGAETRTLELPVGHYSLELAPFSYIAGWRMFSYFLEALA |
| Ga0210398_108462303 | 3300021477 | Soil | MLRALRQHGADPRTLELPVGHYSLELAPFSYIAGYRMFMYFLEALG |
| Ga0210402_100664033 | 3300021478 | Soil | GAEPRTLELPVGHYSLELPPFSYIAGYRMFTYFLEALA |
| Ga0137417_14193464 | 3300024330 | Vadose Zone Soil | MLDSLRRHGADPRTLELSCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0207671_104816291 | 3300025914 | Corn Rhizosphere | MLEALHEHGASPKTLELACGHYSLELAPFSYIAGYRMLSYLRSALA |
| Ga0209265_12071951 | 3300026308 | Soil | TRQMLDSLRRHGADPRTLELACGHYSLELAPFSYVAGYRMLTFFLQSLA |
| Ga0209239_10727883 | 3300026310 | Grasslands Soil | RRHGAEPRTLELACGHYSLELPPFSYIAGYCMLTFFLEGLA |
| Ga0209473_12065962 | 3300026330 | Soil | GADPRTLELPCGHYSLELVPFSYIAGYRMLTFFLQSLA |
| Ga0257146_10171142 | 3300026374 | Soil | SGAETRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0209805_11376273 | 3300026542 | Soil | ADPRTLELPCGHYSLELVPFSYIAGYRMLTFFLQSLA |
| Ga0207775_1158212 | 3300026817 | Tropical Forest Soil | ESLRRHGSETRTLELPVGHYSLELVPFNYIAGYRMITYFLEALG |
| Ga0207743_10078892 | 3300026945 | Tropical Forest Soil | LTERMLESLRRHGSETRTLELPVGHYSLELVPFNYIAGYRMITYFLEALG |
| Ga0207776_10135011 | 3300027035 | Tropical Forest Soil | FLPELTERMLESLRRHGSETRTLELPVGHYSLELVPFNYIAGYRMITYFLEALG |
| Ga0209523_10536272 | 3300027548 | Forest Soil | TERMLDSLRRHGAETRTLELPVGHYSLELPPFSYIAGYRMLVYFLEALG |
| Ga0209525_10193084 | 3300027575 | Forest Soil | PELTHEMLDALRESGAENRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0209076_10018398 | 3300027643 | Vadose Zone Soil | ADPRTLELSCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0209388_10166563 | 3300027655 | Vadose Zone Soil | ADPRTLELPCGHYSLELAPFSYIAGYHMLSFFTQSLA |
| Ga0208990_10761722 | 3300027663 | Forest Soil | PRILELPCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0207826_12271851 | 3300027680 | Tropical Forest Soil | EQMLRALRKHGADPRTLELPVGHYSLELAPFSYVAGYRMFTYFLEALG |
| Ga0209180_105143792 | 3300027846 | Vadose Zone Soil | PRTLELACGHYSLELAPFSYVAGYRMLTFFLESLA |
| Ga0209180_106071241 | 3300027846 | Vadose Zone Soil | GADPRTLELPCGHYSLELAPFSYLAGYRMLTFFLQSLA |
| Ga0209517_103209243 | 3300027854 | Peatlands Soil | AETRTLELPVGHYSLELAPFSWVAGWRMFTYFLEALG |
| Ga0209166_100523101 | 3300027857 | Surface Soil | EPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0209701_107283651 | 3300027862 | Vadose Zone Soil | RRHGAEPRALELPCGHYSLELVPFSYIAGYRMLTFFLQSLA |
| Ga0209283_106326792 | 3300027875 | Vadose Zone Soil | DSLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLQSLA |
| Ga0209590_110417002 | 3300027882 | Vadose Zone Soil | RHGAEPRTLELACGHYSLELAPFSYIAGYRMLTFFLGSLA |
| Ga0209380_104333121 | 3300027889 | Soil | LNSLRRHGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0209006_104057041 | 3300027908 | Forest Soil | PTFLPELTHEMLDALRESGAETRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALG |
| Ga0075377_113336461 | 3300030844 | Soil | PELTHEMLSSLRRHGAEPRTLELPVGHYSLELPPFSYIAGYRMFTYFLEALA |
| Ga0170834_1012606691 | 3300031057 | Forest Soil | PRTLELPVGHYSLELSPFSYIAGWRMFTYFLEALG |
| Ga0170834_1109558991 | 3300031057 | Forest Soil | KYDPTFLPELTHEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0170824_1152139101 | 3300031231 | Forest Soil | HGAEPRTLELPVGHYSLELPPFSYIAGYRMFTYFLEALA |
| Ga0318541_104010222 | 3300031545 | Soil | PELTRQMLESLRAHGAETRTLELPVGHYSLELAPFSYVAGYRMITYFLEALA |
| Ga0318528_100316061 | 3300031561 | Soil | HGAETRTLELPVGHYSLELPPFSYIAGYRMITYFLEALG |
| Ga0318496_104743351 | 3300031713 | Soil | AEMLEALHQHGAAPKTLELACGHYSLELAPFSYIAGYRMLNYFRAALA |
| Ga0307474_116092441 | 3300031718 | Hardwood Forest Soil | RRNGAEPRTLELPVGHYSLELAPFSYVAGWRMFSYFLEALA |
| Ga0307469_114691553 | 3300031720 | Hardwood Forest Soil | EPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0306918_100161431 | 3300031744 | Soil | FLPELTGRMLESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0306918_108904332 | 3300031744 | Soil | TERMLESLQRHGAETRTLELPVGHYSLELVPFSYIAGYRMITYFLEALG |
| Ga0307475_105220862 | 3300031754 | Hardwood Forest Soil | ALRRTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLETLA |
| Ga0307475_112349832 | 3300031754 | Hardwood Forest Soil | RQMLDSLRRHGADPSTLELPCGHYSLELAPFAHIAGYRMLTFFLQSLA |
| Ga0318547_104806861 | 3300031781 | Soil | LTGRMLESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0307473_104957761 | 3300031820 | Hardwood Forest Soil | HGADPRTLELPCGHYSLELAPFSYIAGYRMLTFFLESLA |
| Ga0307478_100259211 | 3300031823 | Hardwood Forest Soil | GAETRTLELPVGHYSLELPPFSYIAGYRMLVYFLEALG |
| Ga0307478_115122863 | 3300031823 | Hardwood Forest Soil | LRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0310917_104903892 | 3300031833 | Soil | TRTLELPVGHYSLELAPFSYIAGHRMITYFLEALA |
| Ga0306925_107265621 | 3300031890 | Soil | LEALHQHGAAPKTLELACGHYSLELAPFSLIAGYRMLNYFRAALA |
| Ga0318536_100399221 | 3300031893 | Soil | LRRHGAETRTLELPVGHYSLELPPFSYIAGYRMITYFLEALG |
| Ga0318551_108436332 | 3300031896 | Soil | SLQRHGAETRTLELPVGHYSLELVPFNYIAGYSMITYFLEALG |
| Ga0310912_104532751 | 3300031941 | Soil | MLEALHQHGAAPRTLALACGHYSLELAPFSYIAGYRMLNYFRVALA |
| Ga0310912_108906632 | 3300031941 | Soil | MLSSLRRHGAEPRTLELPVGHYSLELAPFSYIAGYRMFTYFLEALA |
| Ga0310912_112181901 | 3300031941 | Soil | TGRMLESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0310913_100673701 | 3300031945 | Soil | ELTGRMLESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0306926_101927594 | 3300031954 | Soil | RMLESLRRHGSETRTLELPVGHYSLELVPFSYIAGYRMITYFLEALG |
| Ga0307479_106272751 | 3300031962 | Hardwood Forest Soil | DPTFLPELTQEMLGALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0307479_108152471 | 3300031962 | Hardwood Forest Soil | PSTLELPCGHYSLELAPFSYVAGYRMLTFFLESLA |
| Ga0307479_114084621 | 3300031962 | Hardwood Forest Soil | RTGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0310911_100848852 | 3300032035 | Soil | LESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0310911_107894951 | 3300032035 | Soil | ESLRRHGAETRTLELPVGHYSLELAPFSYIAGYRMITYFLEALG |
| Ga0307470_100254661 | 3300032174 | Hardwood Forest Soil | ALRKSGAEPRTLELPVGHYSLELAPFSYIAGWRMFTYFLEALA |
| Ga0307471_1007070752 | 3300032180 | Hardwood Forest Soil | ELTERMLDSLRRHGAETRTLELPVGHYSLELPPFSYIAGYRMLVYFLEALG |
| Ga0307471_1042785491 | 3300032180 | Hardwood Forest Soil | PELTEQMLESLRRHGADPRTLELPVGHYSLELAPFSYIAGWRMITYFLETLG |
| Ga0306920_1018385961 | 3300032261 | Soil | FWPELTGRMLESLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMITYFLEALG |
| Ga0335080_119303192 | 3300032828 | Soil | ALRKHGAEPRTLELPVGHYSLELSPFSYIAGWRMFTYFLEALG |
| Ga0335083_111110211 | 3300032954 | Soil | RALRQHGADPRTMELPVGHYSLELPPFSYIAGYRMFMYFLEALG |
| Ga0335083_113682732 | 3300032954 | Soil | TRQMLDSLRKHGADPATLELPVGHYSLELVPFSYIAGYRMIMYFLEALA |
| Ga0335077_111475502 | 3300033158 | Soil | ELTHEMLSSLRRHGAETRTLELPVGHYSLELPPFSYVAGYRMFTYFLQALA |
| Ga0335077_112788181 | 3300033158 | Soil | FLPELTEQMLRSLRAHGAETRTLELPVGHYSLEVPPFSYVAGWRMITYFLEALG |
| ⦗Top⦘ |