


| Basic Information | |
|---|---|
| Family ID | F029871 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 187 |
| Average Sequence Length | 39 residues |
| Representative Sequence | LTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 81.28 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.658 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.390 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.668 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.920 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF10098 | DUF2336 | 3.74 |
| PF03401 | TctC | 2.14 |
| PF04392 | ABC_sub_bind | 2.14 |
| PF03972 | MmgE_PrpD | 1.60 |
| PF00535 | Glycos_transf_2 | 1.60 |
| PF13356 | Arm-DNA-bind_3 | 1.07 |
| PF04909 | Amidohydro_2 | 1.07 |
| PF00884 | Sulfatase | 1.07 |
| PF05598 | DUF772 | 1.07 |
| PF13551 | HTH_29 | 1.07 |
| PF09588 | YqaJ | 1.07 |
| PF04255 | DUF433 | 0.53 |
| PF00583 | Acetyltransf_1 | 0.53 |
| PF13592 | HTH_33 | 0.53 |
| PF05977 | MFS_3 | 0.53 |
| PF00903 | Glyoxalase | 0.53 |
| PF13646 | HEAT_2 | 0.53 |
| PF05050 | Methyltransf_21 | 0.53 |
| PF05088 | Bac_GDH | 0.53 |
| PF09335 | SNARE_assoc | 0.53 |
| PF12728 | HTH_17 | 0.53 |
| PF00872 | Transposase_mut | 0.53 |
| PF13406 | SLT_2 | 0.53 |
| PF01381 | HTH_3 | 0.53 |
| PF09650 | PHA_gran_rgn | 0.53 |
| PF04325 | DUF465 | 0.53 |
| PF01610 | DDE_Tnp_ISL3 | 0.53 |
| PF13442 | Cytochrome_CBB3 | 0.53 |
| PF13557 | Phenol_MetA_deg | 0.53 |
| PF03928 | HbpS-like | 0.53 |
| PF11953 | DUF3470 | 0.53 |
| PF13506 | Glyco_transf_21 | 0.53 |
| PF00106 | adh_short | 0.53 |
| PF05016 | ParE_toxin | 0.53 |
| PF01734 | Patatin | 0.53 |
| PF00383 | dCMP_cyt_deam_1 | 0.53 |
| PF13701 | DDE_Tnp_1_4 | 0.53 |
| PF01609 | DDE_Tnp_1 | 0.53 |
| PF12471 | GTP_CH_N | 0.53 |
| PF04191 | PEMT | 0.53 |
| PF02826 | 2-Hacid_dh_C | 0.53 |
| PF11742 | DUF3302 | 0.53 |
| PF02738 | MoCoBD_1 | 0.53 |
| PF05973 | Gp49 | 0.53 |
| PF04545 | Sigma70_r4 | 0.53 |
| PF13538 | UvrD_C_2 | 0.53 |
| PF14707 | Sulfatase_C | 0.53 |
| PF03466 | LysR_substrate | 0.53 |
| PF13817 | DDE_Tnp_IS66_C | 0.53 |
| PF04041 | Glyco_hydro_130 | 0.53 |
| PF07221 | GlcNAc_2-epim | 0.53 |
| PF00107 | ADH_zinc_N | 0.53 |
| PF01019 | G_glu_transpept | 0.53 |
| PF02775 | TPP_enzyme_C | 0.53 |
| PF16658 | RF3_C | 0.53 |
| PF13525 | YfiO | 0.53 |
| PF01522 | Polysacc_deac_1 | 0.53 |
| PF13545 | HTH_Crp_2 | 0.53 |
| PF13586 | DDE_Tnp_1_2 | 0.53 |
| PF03572 | Peptidase_S41 | 0.53 |
| PF01593 | Amino_oxidase | 0.53 |
| PF02771 | Acyl-CoA_dh_N | 0.53 |
| PF13565 | HTH_32 | 0.53 |
| PF12770 | CHAT | 0.53 |
| PF02195 | ParBc | 0.53 |
| PF00005 | ABC_tran | 0.53 |
| PF03331 | LpxC | 0.53 |
| PF00348 | polyprenyl_synt | 0.53 |
| PF13358 | DDE_3 | 0.53 |
| PF12762 | DDE_Tnp_IS1595 | 0.53 |
| PF02817 | E3_binding | 0.53 |
| PF02550 | AcetylCoA_hydro | 0.53 |
| PF01266 | DAO | 0.53 |
| PF00857 | Isochorismatase | 0.53 |
| PF13193 | AMP-binding_C | 0.53 |
| PF01527 | HTH_Tnp_1 | 0.53 |
| PF00216 | Bac_DNA_binding | 0.53 |
| PF01425 | Amidase | 0.53 |
| PF05239 | PRC | 0.53 |
| PF00199 | Catalase | 0.53 |
| PF12399 | BCA_ABC_TP_C | 0.53 |
| PF03050 | DDE_Tnp_IS66 | 0.53 |
| PF12706 | Lactamase_B_2 | 0.53 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.53 |
| PF00885 | DMRL_synthase | 0.53 |
| PF13546 | DDE_5 | 0.53 |
| PF13384 | HTH_23 | 0.53 |
| PF17158 | MASE4 | 0.53 |
| PF13533 | Biotin_lipoyl_2 | 0.53 |
| PF08352 | oligo_HPY | 0.53 |
| PF13683 | rve_3 | 0.53 |
| PF05284 | DUF736 | 0.53 |
| PF00487 | FA_desaturase | 0.53 |
| PF06863 | DUF1254 | 0.53 |
| PF09351 | DUF1993 | 0.53 |
| PF00520 | Ion_trans | 0.53 |
| PF04377 | ATE_C | 0.53 |
| PF00300 | His_Phos_1 | 0.53 |
| PF16078 | 2-oxogl_dehyd_N | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.14 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.14 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.60 |
| COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.53 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.53 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.53 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.53 |
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 0.53 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.53 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.53 |
| COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.53 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.53 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.53 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.53 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 0.53 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.53 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.53 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.53 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.53 |
| COG2902 | NAD-specific glutamate dehydrogenase | Amino acid transport and metabolism [E] | 0.53 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG2942 | Mannose or cellobiose epimerase, N-acyl-D-glucosamine 2-epimerase family | Carbohydrate transport and metabolism [G] | 0.53 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.53 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.53 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.53 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.53 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 0.53 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.53 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 0.53 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.53 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.53 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.53 |
| COG5489 | Uncharacterized conserved protein, DUF736 family | Function unknown [S] | 0.53 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.66 % |
| Unclassified | root | N/A | 28.34 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459003|FZ032L002JA8ZW | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005171|Ga0066677_10635526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300005178|Ga0066688_10809058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300005439|Ga0070711_100482338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1019 | Open in IMG/M |
| 3300005467|Ga0070706_100022293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5831 | Open in IMG/M |
| 3300005471|Ga0070698_100434012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1248 | Open in IMG/M |
| 3300005554|Ga0066661_10458363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300005554|Ga0066661_10561874 | Not Available | 681 | Open in IMG/M |
| 3300005557|Ga0066704_10211436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1313 | Open in IMG/M |
| 3300005764|Ga0066903_100506471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2048 | Open in IMG/M |
| 3300005764|Ga0066903_101597831 | Not Available | 1236 | Open in IMG/M |
| 3300005764|Ga0066903_102262463 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005764|Ga0066903_103274747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 875 | Open in IMG/M |
| 3300005764|Ga0066903_103357675 | Not Available | 864 | Open in IMG/M |
| 3300005764|Ga0066903_107486818 | Not Available | 563 | Open in IMG/M |
| 3300005764|Ga0066903_109032045 | Not Available | 504 | Open in IMG/M |
| 3300005980|Ga0066798_10011061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis | 3240 | Open in IMG/M |
| 3300006055|Ga0097691_1017396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3232 | Open in IMG/M |
| 3300006055|Ga0097691_1037888 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
| 3300006173|Ga0070716_100073739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2014 | Open in IMG/M |
| 3300006173|Ga0070716_100361143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1031 | Open in IMG/M |
| 3300006175|Ga0070712_100537779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
| 3300006354|Ga0075021_10302990 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300006800|Ga0066660_10692160 | Not Available | 839 | Open in IMG/M |
| 3300006845|Ga0075421_100273030 | Not Available | 2065 | Open in IMG/M |
| 3300006852|Ga0075433_10264528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1524 | Open in IMG/M |
| 3300006881|Ga0068865_100248332 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300007788|Ga0099795_10009327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8 | 2843 | Open in IMG/M |
| 3300007788|Ga0099795_10090302 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300007788|Ga0099795_10147707 | Not Available | 960 | Open in IMG/M |
| 3300007788|Ga0099795_10261565 | Not Available | 749 | Open in IMG/M |
| 3300007788|Ga0099795_10600705 | Not Available | 524 | Open in IMG/M |
| 3300009029|Ga0066793_10747609 | Not Available | 555 | Open in IMG/M |
| 3300009038|Ga0099829_10547298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
| 3300009094|Ga0111539_11772884 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300009143|Ga0099792_10243003 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300009143|Ga0099792_10578195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 713 | Open in IMG/M |
| 3300009176|Ga0105242_11999402 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300009522|Ga0116218_1151131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300009645|Ga0116106_1208860 | Not Available | 621 | Open in IMG/M |
| 3300010046|Ga0126384_11748964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300010049|Ga0123356_10888495 | Not Available | 1062 | Open in IMG/M |
| 3300010343|Ga0074044_10003735 | Not Available | 12850 | Open in IMG/M |
| 3300010343|Ga0074044_10005818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9975 | Open in IMG/M |
| 3300010343|Ga0074044_10017322 | Not Available | 5277 | Open in IMG/M |
| 3300010343|Ga0074044_10295196 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300010376|Ga0126381_101601536 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 941 | Open in IMG/M |
| 3300010376|Ga0126381_102215167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
| 3300010376|Ga0126381_103341240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 632 | Open in IMG/M |
| 3300010379|Ga0136449_100070666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7494 | Open in IMG/M |
| 3300010379|Ga0136449_100416941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2373 | Open in IMG/M |
| 3300010379|Ga0136449_100625634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer | 1827 | Open in IMG/M |
| 3300010379|Ga0136449_102840895 | Not Available | 682 | Open in IMG/M |
| 3300010396|Ga0134126_11274195 | Not Available | 815 | Open in IMG/M |
| 3300010396|Ga0134126_11927070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 647 | Open in IMG/M |
| 3300010398|Ga0126383_10301151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1602 | Open in IMG/M |
| 3300010398|Ga0126383_11352769 | Not Available | 802 | Open in IMG/M |
| 3300010398|Ga0126383_11471193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 771 | Open in IMG/M |
| 3300010398|Ga0126383_13250537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Klebsiella/Raoultella group → Klebsiella → Klebsiella pneumoniae | 531 | Open in IMG/M |
| 3300010401|Ga0134121_10258560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1527 | Open in IMG/M |
| 3300011120|Ga0150983_10727832 | Not Available | 568 | Open in IMG/M |
| 3300011269|Ga0137392_10629154 | Not Available | 890 | Open in IMG/M |
| 3300012096|Ga0137389_11656702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 536 | Open in IMG/M |
| 3300012200|Ga0137382_10190960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1405 | Open in IMG/M |
| 3300012202|Ga0137363_10131201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1947 | Open in IMG/M |
| 3300012202|Ga0137363_10140178 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1889 | Open in IMG/M |
| 3300012202|Ga0137363_10338778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1242 | Open in IMG/M |
| 3300012202|Ga0137363_10491522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1030 | Open in IMG/M |
| 3300012202|Ga0137363_11326584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 608 | Open in IMG/M |
| 3300012202|Ga0137363_11371302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 596 | Open in IMG/M |
| 3300012203|Ga0137399_10335041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1255 | Open in IMG/M |
| 3300012205|Ga0137362_10007925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 7543 | Open in IMG/M |
| 3300012205|Ga0137362_10012576 | Not Available | 6258 | Open in IMG/M |
| 3300012205|Ga0137362_10123124 | Not Available | 2200 | Open in IMG/M |
| 3300012205|Ga0137362_11770193 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300012206|Ga0137380_10049214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3864 | Open in IMG/M |
| 3300012206|Ga0137380_10159332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2058 | Open in IMG/M |
| 3300012207|Ga0137381_11617719 | Not Available | 539 | Open in IMG/M |
| 3300012208|Ga0137376_10114127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2301 | Open in IMG/M |
| 3300012357|Ga0137384_11316187 | Not Available | 569 | Open in IMG/M |
| 3300012361|Ga0137360_10012894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 5377 | Open in IMG/M |
| 3300012361|Ga0137360_10270188 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300012361|Ga0137360_10789677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 817 | Open in IMG/M |
| 3300012362|Ga0137361_10112570 | Not Available | 2386 | Open in IMG/M |
| 3300012362|Ga0137361_10244297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1634 | Open in IMG/M |
| 3300012582|Ga0137358_10007177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6798 | Open in IMG/M |
| 3300012582|Ga0137358_10189858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1402 | Open in IMG/M |
| 3300012923|Ga0137359_10018204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5937 | Open in IMG/M |
| 3300012923|Ga0137359_11189778 | Not Available | 650 | Open in IMG/M |
| 3300012923|Ga0137359_11412874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300012955|Ga0164298_10538010 | Not Available | 789 | Open in IMG/M |
| 3300012957|Ga0164303_10047194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1887 | Open in IMG/M |
| 3300012957|Ga0164303_10229307 | Not Available | 1049 | Open in IMG/M |
| 3300012958|Ga0164299_10226456 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300012960|Ga0164301_10001416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 7686 | Open in IMG/M |
| 3300012960|Ga0164301_10124746 | Not Available | 1528 | Open in IMG/M |
| 3300012971|Ga0126369_10413989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1389 | Open in IMG/M |
| 3300013306|Ga0163162_11151977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 879 | Open in IMG/M |
| 3300013306|Ga0163162_13005974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 542 | Open in IMG/M |
| 3300014151|Ga0181539_1268995 | Not Available | 633 | Open in IMG/M |
| 3300014152|Ga0181533_1035351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2814 | Open in IMG/M |
| 3300014155|Ga0181524_10299497 | Not Available | 734 | Open in IMG/M |
| 3300014155|Ga0181524_10477879 | Not Available | 532 | Open in IMG/M |
| 3300014501|Ga0182024_12019165 | Not Available | 637 | Open in IMG/M |
| 3300014638|Ga0181536_10120645 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300015195|Ga0167658_1031519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1394 | Open in IMG/M |
| 3300016270|Ga0182036_11206952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300016341|Ga0182035_11135594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300016371|Ga0182034_12016939 | Not Available | 510 | Open in IMG/M |
| 3300016387|Ga0182040_10046326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2674 | Open in IMG/M |
| 3300016445|Ga0182038_10204381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1557 | Open in IMG/M |
| 3300016445|Ga0182038_10285627 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300017792|Ga0163161_10390242 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300017792|Ga0163161_11588519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300017935|Ga0187848_10098027 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin429 | 1338 | Open in IMG/M |
| 3300018002|Ga0187868_1189057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 722 | Open in IMG/M |
| 3300018025|Ga0187885_10398941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 616 | Open in IMG/M |
| 3300018044|Ga0187890_10232505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium | 1040 | Open in IMG/M |
| 3300018088|Ga0187771_10516469 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300019996|Ga0193693_1029524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 966 | Open in IMG/M |
| 3300021086|Ga0179596_10119588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1221 | Open in IMG/M |
| 3300021086|Ga0179596_10519193 | Not Available | 604 | Open in IMG/M |
| 3300021168|Ga0210406_10311718 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300021171|Ga0210405_10504632 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300021363|Ga0193699_10062340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1460 | Open in IMG/M |
| 3300021861|Ga0213853_10368496 | Not Available | 848 | Open in IMG/M |
| 3300022756|Ga0222622_10369107 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium RIFOXYB2_FULL_49_7 | 1004 | Open in IMG/M |
| 3300023102|Ga0247754_1008048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2139 | Open in IMG/M |
| 3300025322|Ga0209641_10895617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300025481|Ga0208079_1004681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5926 | Open in IMG/M |
| 3300025898|Ga0207692_10327175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 939 | Open in IMG/M |
| 3300025899|Ga0207642_10993438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 540 | Open in IMG/M |
| 3300025906|Ga0207699_10179202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1423 | Open in IMG/M |
| 3300025912|Ga0207707_10474125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1069 | Open in IMG/M |
| 3300025922|Ga0207646_10974549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 750 | Open in IMG/M |
| 3300025931|Ga0207644_10532851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 971 | Open in IMG/M |
| 3300025934|Ga0207686_11290103 | Not Available | 599 | Open in IMG/M |
| 3300025944|Ga0207661_10069553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2870 | Open in IMG/M |
| 3300025972|Ga0207668_10226150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1506 | Open in IMG/M |
| 3300026223|Ga0209840_1063610 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026272|Ga0209913_1067462 | Not Available | 801 | Open in IMG/M |
| 3300026285|Ga0209438_1134094 | Not Available | 664 | Open in IMG/M |
| 3300026320|Ga0209131_1002341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12905 | Open in IMG/M |
| 3300026320|Ga0209131_1165893 | Not Available | 1092 | Open in IMG/M |
| 3300026322|Ga0209687_1166249 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300026374|Ga0257146_1055570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300026481|Ga0257155_1001624 | Not Available | 2474 | Open in IMG/M |
| 3300026482|Ga0257172_1044195 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300026482|Ga0257172_1069347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300026494|Ga0257159_1014583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1255 | Open in IMG/M |
| 3300027512|Ga0209179_1127818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium 32-66-8 | 568 | Open in IMG/M |
| 3300028047|Ga0209526_10163814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1553 | Open in IMG/M |
| 3300030007|Ga0311338_10877403 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300031546|Ga0318538_10289078 | Not Available | 883 | Open in IMG/M |
| 3300031561|Ga0318528_10211561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1038 | Open in IMG/M |
| 3300031572|Ga0318515_10134572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1312 | Open in IMG/M |
| 3300031573|Ga0310915_10389572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300031713|Ga0318496_10073446 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300031719|Ga0306917_10021120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4019 | Open in IMG/M |
| 3300031744|Ga0306918_11421093 | Not Available | 531 | Open in IMG/M |
| 3300031747|Ga0318502_10371575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300031771|Ga0318546_10991205 | Not Available | 591 | Open in IMG/M |
| 3300031792|Ga0318529_10583694 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300031820|Ga0307473_11462815 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031845|Ga0318511_10244754 | Not Available | 804 | Open in IMG/M |
| 3300031890|Ga0306925_11910239 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031893|Ga0318536_10534940 | Not Available | 588 | Open in IMG/M |
| 3300031910|Ga0306923_10743544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
| 3300031912|Ga0306921_10468314 | Not Available | 1467 | Open in IMG/M |
| 3300031912|Ga0306921_10906531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1000 | Open in IMG/M |
| 3300031941|Ga0310912_10477159 | Not Available | 972 | Open in IMG/M |
| 3300031941|Ga0310912_10838216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. | 709 | Open in IMG/M |
| 3300031942|Ga0310916_10372980 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300031942|Ga0310916_11338070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 588 | Open in IMG/M |
| 3300032001|Ga0306922_11339374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 722 | Open in IMG/M |
| 3300032039|Ga0318559_10482625 | Not Available | 578 | Open in IMG/M |
| 3300032044|Ga0318558_10311790 | Not Available | 778 | Open in IMG/M |
| 3300032059|Ga0318533_10347134 | Not Available | 1080 | Open in IMG/M |
| 3300032076|Ga0306924_10340331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1721 | Open in IMG/M |
| 3300032160|Ga0311301_10042681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 10843 | Open in IMG/M |
| 3300032160|Ga0311301_10069043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7502 | Open in IMG/M |
| 3300032160|Ga0311301_10753978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Rhodoligotrophos → Rhodoligotrophos appendicifer | 1351 | Open in IMG/M |
| 3300032160|Ga0311301_11823910 | Not Available | 722 | Open in IMG/M |
| 3300032174|Ga0307470_11126477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300032261|Ga0306920_100086670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4615 | Open in IMG/M |
| 3300032261|Ga0306920_100120994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3889 | Open in IMG/M |
| 3300033289|Ga0310914_11661529 | Not Available | 542 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.39% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.81% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.28% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.21% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.67% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.14% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.07% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.07% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.53% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.53% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.53% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019996 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025481 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
| 3300026272 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026374 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E4A_09158040 | 2170459003 | Grass Soil | PLSLTTYFFTEISFAAMTCPPSPVVGDESESPNPFKLVEAGD |
| Ga0066677_106355262 | 3300005171 | Soil | LSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGE* |
| Ga0066688_108090581 | 3300005178 | Soil | RSRSSPLSLTTYFFTEISFAAMIASLAIVGDESESLNPFQLVEAGD* |
| Ga0070711_1004823382 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0070706_1000222937 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0070698_1004340124 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | PVSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0066661_104583631 | 3300005554 | Soil | YFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0066661_105618742 | 3300005554 | Soil | RTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0066704_102114361 | 3300005557 | Soil | LTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0066903_1005064713 | 3300005764 | Tropical Forest Soil | CSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFELVEAGD* |
| Ga0066903_1015978313 | 3300005764 | Tropical Forest Soil | LTTYVFTEISFAAILASIANPGDGSESPNPFKLVEAND* |
| Ga0066903_1022624631 | 3300005764 | Tropical Forest Soil | NLTTYVFTEISFAAILASIANPGDGSESPNPFKLVEAND* |
| Ga0066903_1032747473 | 3300005764 | Tropical Forest Soil | RSRSSPLSLTTYFFTEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0066903_1033576753 | 3300005764 | Tropical Forest Soil | LTTYFFTEISFAAMIASSPVVGDESESLNPFELVEAGD* |
| Ga0066903_1074868181 | 3300005764 | Tropical Forest Soil | TYVFTEISFAAILASIANPGDGSESPNPFKLVEAND* |
| Ga0066903_1090320452 | 3300005764 | Tropical Forest Soil | ASSRSRSSALNRTTYFFTEISFPAMILSSAQLGEKSESLNPFKLIEAGD* |
| Ga0066798_100110611 | 3300005980 | Soil | YFFTEISFAAMIASLASSGDESESPNPFKLVEASD* |
| Ga0097691_10173965 | 3300006055 | Arctic Peat Soil | TTYFFTEISFAAMIASLASSGDESESPNPFKLVEAGD* |
| Ga0097691_10378882 | 3300006055 | Arctic Peat Soil | TYFFTEISFAAMIASLASSGDESESPNPFKLVEASD* |
| Ga0070716_1000737391 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0070716_1003611431 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0070712_1005377791 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | YLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0075021_103029901 | 3300006354 | Watersheds | TYFFTEISFAAIMVSLVRGCESESLNPSQLVEAGD* |
| Ga0066660_106921604 | 3300006800 | Soil | TYFFTEISFAAMIASVADSGDKSESLNPFKLVEAGD* |
| Ga0075421_1002730301 | 3300006845 | Populus Rhizosphere | TTYFFAEISFAAMIASLAIVGDESESLNPFKLVEAGD* |
| Ga0075433_102645284 | 3300006852 | Populus Rhizosphere | NRTTYRFTEISFPAMIAFANSSDESESSIPFELVEATD* |
| Ga0068865_1002483321 | 3300006881 | Miscanthus Rhizosphere | LGSATAHRTLTLNLTTYVFTEISFAAILASIANPSDGSESPNPFKLVEAND* |
| Ga0099795_100093271 | 3300007788 | Vadose Zone Soil | NRTTYPFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0099795_100903021 | 3300007788 | Vadose Zone Soil | LNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0099795_101477072 | 3300007788 | Vadose Zone Soil | YLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0099795_102615651 | 3300007788 | Vadose Zone Soil | TTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0099795_106007052 | 3300007788 | Vadose Zone Soil | NRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0066793_107476092 | 3300009029 | Prmafrost Soil | LTTYFFTEISFAAMIASLASSGDESESPNPFKLVEARD* |
| Ga0099829_105472981 | 3300009038 | Vadose Zone Soil | YLFTEISFAAIIAPVVRPSTSESLNPFELVEAGD* |
| Ga0111539_117728841 | 3300009094 | Populus Rhizosphere | LSLTTYFFTEISFAAMIASSPVVCDESESLDPFKLVEAGD* |
| Ga0099792_102430032 | 3300009143 | Vadose Zone Soil | RTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0099792_105781951 | 3300009143 | Vadose Zone Soil | RSSALNRTTYLFTEFSFAAMIPSAAIRGAKSESLKPFKLVEASD* |
| Ga0105242_119994021 | 3300009176 | Miscanthus Rhizosphere | SRSRSSALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0116218_11511313 | 3300009522 | Peatlands Soil | SPLNRTTYFFTELSLPAMIAPVIRVMTSESSNPFKVVEAGD* |
| Ga0116106_12088602 | 3300009645 | Peatland | NLTTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD* |
| Ga0126384_117489641 | 3300010046 | Tropical Forest Soil | TYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD* |
| Ga0123356_108884951 | 3300010049 | Termite Gut | TTYRFTEISFAAMIPSAANSGDKSESTNPFKIVDAGD* |
| Ga0074044_100037351 | 3300010343 | Bog Forest Soil | TYFFTEISFAAMIASIANSGDQSESQNPFKLVEAGD* |
| Ga0074044_1000581810 | 3300010343 | Bog Forest Soil | FFTKISFAAMIASIANSGDQSESQNPFKLVEAGD* |
| Ga0074044_100173227 | 3300010343 | Bog Forest Soil | NLTTYFFTEISFAAMIASIANSGDQSESQNPFKLVEAGD* |
| Ga0074044_102951962 | 3300010343 | Bog Forest Soil | FFTEISFAAMIASIANSGDQSESQNPFKLVEAGD* |
| Ga0126381_1016015361 | 3300010376 | Tropical Forest Soil | ASSCSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNLFEMVEAGD* |
| Ga0126381_1022151672 | 3300010376 | Tropical Forest Soil | SCSRSSALNRTTYRFTEISFATMIPSAVNTDDKSESQNPFEMVEAGD* |
| Ga0126381_1033412401 | 3300010376 | Tropical Forest Soil | NRTTYRFTEISFAAMIPSAVNNDDKSESPNPFEMVEAGD* |
| Ga0136449_1000706661 | 3300010379 | Peatlands Soil | SFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH* |
| Ga0136449_1004169414 | 3300010379 | Peatlands Soil | SSSLSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH* |
| Ga0136449_1006256345 | 3300010379 | Peatlands Soil | FTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH* |
| Ga0136449_1028408951 | 3300010379 | Peatlands Soil | TYFFTEISFPAMIPLRRLCGDPSESLNPFKLVEAGD* |
| Ga0134126_112741951 | 3300010396 | Terrestrial Soil | NRTIYLFTVISCAAMIPSAADSGNKSESPNPFKLVEAGD* |
| Ga0134126_119270703 | 3300010396 | Terrestrial Soil | TTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEAGD* |
| Ga0126383_103011511 | 3300010398 | Tropical Forest Soil | TTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD* |
| Ga0126383_113527691 | 3300010398 | Tropical Forest Soil | RTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD* |
| Ga0126383_114711931 | 3300010398 | Tropical Forest Soil | SASSCSRSSALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFEMVEAGD* |
| Ga0126383_132505372 | 3300010398 | Tropical Forest Soil | ALNRTTYRFTEISFAAMIPSAVNNDDKSESPNPFKMVEAGD* |
| Ga0134121_102585603 | 3300010401 | Terrestrial Soil | SASSRSRSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0150983_107278322 | 3300011120 | Forest Soil | SVERLEYVFTEIPFAAMIASIADSDESESQNPFKLV* |
| Ga0137392_106291542 | 3300011269 | Vadose Zone Soil | TYFFTEISFAAIFASVARSCDESESLNPFKLVEADD* |
| Ga0137389_116567021 | 3300012096 | Vadose Zone Soil | SLTTYFFTEISFAAMIASVSRRGDESESLNPFKLVKAGD* |
| Ga0137382_101909602 | 3300012200 | Vadose Zone Soil | TTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0137363_101312011 | 3300012202 | Vadose Zone Soil | TYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD* |
| Ga0137363_101401781 | 3300012202 | Vadose Zone Soil | TYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD* |
| Ga0137363_103387781 | 3300012202 | Vadose Zone Soil | LNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0137363_104915221 | 3300012202 | Vadose Zone Soil | YLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0137363_113265841 | 3300012202 | Vadose Zone Soil | RSSALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD* |
| Ga0137363_113713022 | 3300012202 | Vadose Zone Soil | FFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD* |
| Ga0137399_103350413 | 3300012203 | Vadose Zone Soil | EISFAAIIAPVVRPSTSESLNPFELVEAGDSLPAV* |
| Ga0137362_100079251 | 3300012205 | Vadose Zone Soil | RTTYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD* |
| Ga0137362_100125761 | 3300012205 | Vadose Zone Soil | TYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD* |
| Ga0137362_101231242 | 3300012205 | Vadose Zone Soil | SRSSALNRTTYLFTEISFAAMIASVVPTVDESESPNPFNLVEAGD* |
| Ga0137362_117701933 | 3300012205 | Vadose Zone Soil | FFTEISFAAMLASVVRRDDQSESLIPFKMVEAGD* |
| Ga0137380_100492141 | 3300012206 | Vadose Zone Soil | SPLNLTTYLFTGISFAAMIASVASSGDESESPNPFKLVEAAD* |
| Ga0137380_101593325 | 3300012206 | Vadose Zone Soil | LNLTTYLFTGISFAAMIASVASSGDESESPNPFKLVEAGD* |
| Ga0137381_116177192 | 3300012207 | Vadose Zone Soil | NLTTYVFTEISFPSMIASIANNGDASESSNPFKLVEAGD* |
| Ga0137376_101141271 | 3300012208 | Vadose Zone Soil | SSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNTFKLVEASD* |
| Ga0137384_113161872 | 3300012357 | Vadose Zone Soil | SRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEAGD* |
| Ga0137360_100128941 | 3300012361 | Vadose Zone Soil | VFTEISFAAMIASIANSGDGNESSNPFKFVEAGD* |
| Ga0137360_102701881 | 3300012361 | Vadose Zone Soil | SVTTYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD* |
| Ga0137360_107896771 | 3300012361 | Vadose Zone Soil | LSVTTYFFTKISFAAMIAPAARFNGKSESSNPFNLIEAGD* |
| Ga0137361_101125701 | 3300012362 | Vadose Zone Soil | SSALNRTTYLFTEISFAAMIASVVPTVDESESSNTFNLVEAGD* |
| Ga0137361_102442971 | 3300012362 | Vadose Zone Soil | NRTTYLFTEISFAAIIAPVVRPSTSESLNPFELVEAGD* |
| Ga0137358_100071771 | 3300012582 | Vadose Zone Soil | SASSRSRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNAFKLVEASD* |
| Ga0137358_101898581 | 3300012582 | Vadose Zone Soil | TYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0137359_100182041 | 3300012923 | Vadose Zone Soil | ALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGG* |
| Ga0137359_111897781 | 3300012923 | Vadose Zone Soil | TYLFTEISVAAMVGSVVPTVDASECSDRFKLGEPGA* |
| Ga0137359_114128742 | 3300012923 | Vadose Zone Soil | RSRSSALNRTTYLFTEFSLAAMIPSAAIRGGKTESLNSFKLVEASD* |
| Ga0164298_105380101 | 3300012955 | Soil | NRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD* |
| Ga0164303_100471944 | 3300012957 | Soil | YLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD* |
| Ga0164303_102293072 | 3300012957 | Soil | LNLTTYVFTEISFPSMIASIANNGDASESSNPFKLVEAGD* |
| Ga0164299_102264561 | 3300012958 | Soil | LNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD* |
| Ga0164301_100014161 | 3300012960 | Soil | LFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD* |
| Ga0164301_101247461 | 3300012960 | Soil | TTYLFTEFSFAAMIPSAVIRGGKSELLNPFELVEASD* |
| Ga0126369_104139891 | 3300012971 | Tropical Forest Soil | RFTEISFAAMIPSAINNDDKSESPNPFEMVEAGD* |
| Ga0163162_111519772 | 3300013306 | Switchgrass Rhizosphere | SSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNSFKLVEASD* |
| Ga0163162_130059742 | 3300013306 | Switchgrass Rhizosphere | YLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD* |
| Ga0181539_12689951 | 3300014151 | Bog | NRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD* |
| Ga0181533_10353514 | 3300014152 | Bog | FFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD* |
| Ga0181524_102994971 | 3300014155 | Bog | TYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD* |
| Ga0181524_104778792 | 3300014155 | Bog | LNRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD* |
| Ga0182024_120191652 | 3300014501 | Permafrost | YFFTEISFAAMIAPPPARDGEEKESLNPFKLVEADD* |
| Ga0181536_101206451 | 3300014638 | Bog | LNLTTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD* |
| Ga0167658_10315193 | 3300015195 | Glacier Forefield Soil | PLSLTTYFFTEISFAAMIASVARSCDESESPNPFKLVEADD* |
| Ga0182036_112069521 | 3300016270 | Soil | SLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0182035_111355941 | 3300016341 | Soil | TTYFFTEISFPAMIAPSPNHGSSESSNPFKLVETGD |
| Ga0182034_120169391 | 3300016371 | Soil | SRSSPLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD |
| Ga0182040_100463261 | 3300016387 | Soil | TTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0182038_102043812 | 3300016445 | Soil | LTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0182038_102856272 | 3300016445 | Soil | LSLTTYFFTEISFAAMIASLASRWDESESLNPFELVEAGD |
| Ga0163161_103902421 | 3300017792 | Switchgrass Rhizosphere | TYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0163161_115885192 | 3300017792 | Switchgrass Rhizosphere | SRSRSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0187848_100980272 | 3300017935 | Peatland | NRTTYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD |
| Ga0187868_11890572 | 3300018002 | Peatland | TYFFTEIFFAAMIASPAHDGQERESLNPFKLVEAGD |
| Ga0187885_103989413 | 3300018025 | Peatland | TTYFFTEISFAAMIASVVRGCESESPNPFQLVEAGD |
| Ga0187890_102325051 | 3300018044 | Peatland | RSSALSRTTYFFTEISFAAMIPSVARLANQSESLNPFKLVEAGD |
| Ga0187771_105164691 | 3300018088 | Tropical Peatland | SCSRSSPLNRTTYRFTEISFAAMIPSVANNGDKSESLNPFKLIEAGN |
| Ga0193693_10295243 | 3300019996 | Soil | SRTTYFFTEISFAAMIASVTSSADESESLNPFKLVEAGD |
| Ga0179596_101195883 | 3300021086 | Vadose Zone Soil | LNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0179596_105191931 | 3300021086 | Vadose Zone Soil | SLSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH |
| Ga0210406_103117182 | 3300021168 | Soil | PLSLTTYLFTEISFASMIASVARSCDESESLNPFKLVEADD |
| Ga0210405_105046323 | 3300021171 | Soil | SLTTYFFTEISFAAMIAPFAGRGDESESPNPFKLVEAGD |
| Ga0193699_100623401 | 3300021363 | Soil | LSRTTYFFTEISFAAMIASVTSSADESESLNPFKLVEAGD |
| Ga0213853_103684962 | 3300021861 | Watersheds | TTYFFTKISFAAMIAPAARFNGRSESSNPFNLIEAGD |
| Ga0222622_103691071 | 3300022756 | Groundwater Sediment | LLNLTTYVFTEISFAAILASIANPSDGSESPNPFKLVEAND |
| Ga0247754_10080481 | 3300023102 | Soil | TLTLNLTTYVFTEISFAAILASIANPCDGSESPNPFKLVEAND |
| Ga0209641_108956172 | 3300025322 | Soil | LNRTTYFFTEISFAVMITSAANSGDKSESLNPFKLVEAGD |
| Ga0208079_100468110 | 3300025481 | Arctic Peat Soil | YFFTEISFAAMIASLASSGDESESPNPFKLVEASD |
| Ga0207692_103271753 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0207642_109934382 | 3300025899 | Miscanthus Rhizosphere | ALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0207699_101792023 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0207707_104741253 | 3300025912 | Corn Rhizosphere | LNRTTYLFTEISFAAMIPSSANSGGKSESLNPFKLVEASD |
| Ga0207646_109745493 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SLTTYFFTEISFAAMIASLASPVVGDESESLIPFKLVEAGD |
| Ga0207644_105328511 | 3300025931 | Switchgrass Rhizosphere | LNRTTYLITEFAFAAMIPSAAIKGGKSESLNPFKLVEASD |
| Ga0207686_112901032 | 3300025934 | Miscanthus Rhizosphere | RSSALNRTTYLFTEFAFAAMIPSAAIKGGKSESLNPFKLVEAGD |
| Ga0207661_100695536 | 3300025944 | Corn Rhizosphere | ALNRTTYLFTEISFAAMVPSSANSAGKSESLNPFKLVEAND |
| Ga0207668_102261501 | 3300025972 | Switchgrass Rhizosphere | SRSSALNRTTYLFTEFSFAAMIPSAAIKGGKSESLNPFKLVEAGD |
| Ga0209840_10636102 | 3300026223 | Soil | LSLTTYFFTEISFAAMIASLASSGDESESPNPFKLVEASD |
| Ga0209913_10674622 | 3300026272 | Soil | RLSLTTYFFTEISFAAMIASLASSGDESESPNPFKLVEASD |
| Ga0209438_11340941 | 3300026285 | Grasslands Soil | SALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASE |
| Ga0209131_100234112 | 3300026320 | Grasslands Soil | ALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0209131_11658932 | 3300026320 | Grasslands Soil | RTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0209687_11662491 | 3300026322 | Soil | PLSRTTYFFTEISFAAMILSVVRGGDANESLIPFKLVEAAD |
| Ga0257146_10555701 | 3300026374 | Soil | ALNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD |
| Ga0257155_10016242 | 3300026481 | Soil | TYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0257172_10441951 | 3300026482 | Soil | SALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0257172_10693471 | 3300026482 | Soil | SALNRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGE |
| Ga0257159_10145831 | 3300026494 | Soil | NRTTYLFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0209179_11278181 | 3300027512 | Vadose Zone Soil | NRTTYPFTEISFAAMIASVVPTVDESESSNPFNLVEAGD |
| Ga0209526_101638143 | 3300028047 | Forest Soil | YLFTEISFASMIASVARSCDKSESLNPFKLVEADD |
| Ga0311338_108774031 | 3300030007 | Palsa | ALNRTTYLFTEISFAAMIASVVRTVDESESSNPFKLVEAGDYAL |
| Ga0318538_102890781 | 3300031546 | Soil | SSCARSSALNRTTYRFTEISFAAMIPSAANNDDKSESPKTFKLVDAGD |
| Ga0318528_102115611 | 3300031561 | Soil | TYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0318515_101345721 | 3300031572 | Soil | LSLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0310915_103895721 | 3300031573 | Soil | YFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0318496_100734461 | 3300031713 | Soil | YFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0306917_100211201 | 3300031719 | Soil | LSLTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0306918_114210932 | 3300031744 | Soil | TYLFTEISFAAMIPSAANSGCKSESPNPFKLIDASD |
| Ga0318502_103715751 | 3300031747 | Soil | PLSLTTYFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0318546_109912051 | 3300031771 | Soil | NRTTYRFTEISFAAMIPSAANNDDKSESPKTFKLVDAGD |
| Ga0318529_105836942 | 3300031792 | Soil | TYRFTEISFAAMIPSAAKNGDKSESPNHFKLAEAGD |
| Ga0307473_114628152 | 3300031820 | Hardwood Forest Soil | SPLSLTTYFFSKISFAAMIASLASAGDESESLNPFKLVEAGD |
| Ga0318511_102447541 | 3300031845 | Soil | STLNRTTYFFTEISFPAMIAPSPTHGSSESFNPFKLVETGD |
| Ga0306925_119102393 | 3300031890 | Soil | TYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0318536_105349402 | 3300031893 | Soil | PLNRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0306923_107435442 | 3300031910 | Soil | ALNLTTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD |
| Ga0306921_104683144 | 3300031912 | Soil | YFFTEISFAAIIASLASLGDESESLNHFKLVEAGD |
| Ga0306921_109065313 | 3300031912 | Soil | NRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0310912_104771592 | 3300031941 | Soil | RSSPLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD |
| Ga0310912_108382161 | 3300031941 | Soil | LNRTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0310916_103729801 | 3300031942 | Soil | TTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0310916_113380701 | 3300031942 | Soil | SLTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0306922_113393741 | 3300032001 | Soil | LTTYFFTEISFAAMIASLASLGDESESLNHFKLVEAGD |
| Ga0318559_104826252 | 3300032039 | Soil | TTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD |
| Ga0318558_103117902 | 3300032044 | Soil | SHTTYFFTEISFAAMIASSPVVGDESESLNPFELVEAGD |
| Ga0318533_103471343 | 3300032059 | Soil | PLSLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD |
| Ga0306924_103403313 | 3300032076 | Soil | NLTTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD |
| Ga0311301_100426811 | 3300032160 | Peatlands Soil | YFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH |
| Ga0311301_1006904311 | 3300032160 | Peatlands Soil | LSFTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH |
| Ga0311301_107539781 | 3300032160 | Peatlands Soil | FTTYFFTETTLPAMITPVANQCDKSESNNPFKLVEAGH |
| Ga0311301_118239101 | 3300032160 | Peatlands Soil | LSRTTYFFTEISFEAMIASAAPGCGESESPNPFKLVEAGD |
| Ga0307470_111264771 | 3300032174 | Hardwood Forest Soil | LNRTTYLFTEFSFAAMIPSAVIRGGKSESLNPFELVEASD |
| Ga0306920_1000866701 | 3300032261 | Soil | TTYRFTEISFAAMIPSAAKNGDKSESPNHFKLVEAGD |
| Ga0306920_1001209945 | 3300032261 | Soil | RTTYFFTEISFAAMLASVVRRGDQSESLIPFKMVEAGD |
| Ga0310914_116615291 | 3300033289 | Soil | SLTTYFFTEISFAAMIASLASLGDESESLNPFELVEAGD |
| ⦗Top⦘ |