


| Basic Information | |
|---|---|
| Family ID | F029783 |
| Family Type | Metagenome |
| Number of Sequences | 187 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKF |
| Number of Associated Samples | 107 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.24 % |
| % of genes near scaffold ends (potentially truncated) | 27.81 % |
| % of genes from short scaffolds (< 2000 bps) | 80.21 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (77.540 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (34.225 % of family members) |
| Environment Ontology (ENVO) | Unclassified (90.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 64.29% β-sheet: 0.00% Coil/Unstructured: 35.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 28.88 |
| PF00216 | Bac_DNA_binding | 6.42 |
| PF00565 | SNase | 3.74 |
| PF06941 | NT5C | 2.67 |
| PF01106 | NifU | 2.14 |
| PF13640 | 2OG-FeII_Oxy_3 | 2.14 |
| PF07486 | Hydrolase_2 | 1.07 |
| PF00574 | CLP_protease | 1.07 |
| PF14326 | DUF4384 | 1.07 |
| PF13098 | Thioredoxin_2 | 1.07 |
| PF04471 | Mrr_cat | 0.53 |
| PF00583 | Acetyltransf_1 | 0.53 |
| PF00386 | C1q | 0.53 |
| PF13759 | 2OG-FeII_Oxy_5 | 0.53 |
| PF05488 | PAAR_motif | 0.53 |
| PF17147 | PFOR_II | 0.53 |
| PF09636 | XkdW | 0.53 |
| PF00705 | PCNA_N | 0.53 |
| PF08443 | RimK | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 6.42 |
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 2.67 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 2.14 |
| COG0694 | Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain | Posttranslational modification, protein turnover, chaperones [O] | 2.14 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 2.14 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.07 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 1.07 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.53 |
| COG4104 | Zn-binding Pro-Ala-Ala-Arg (PAAR) domain, involved in Type VI secretion | Intracellular trafficking, secretion, and vesicular transport [U] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 77.54 % |
| All Organisms | root | All Organisms | 22.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 34.22% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 24.06% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 10.70% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.42% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 4.81% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 4.28% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.74% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.74% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.60% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.60% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.60% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.07% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.53% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.53% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.53% |
| Marine, Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine, Hydrothermal Vent Plume | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300002526 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m | Environmental | Open in IMG/M |
| 3300002528 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m | Environmental | Open in IMG/M |
| 3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
| 3300003540 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNA | Environmental | Open in IMG/M |
| 3300003702 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Piccard2013-Plume - Microbial Assembly | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
| 3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
| 3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
| 3300006011 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_O2min_ad_340m_LV | Environmental | Open in IMG/M |
| 3300006093 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP189 | Environmental | Open in IMG/M |
| 3300006308 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500m | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006324 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0500m | Environmental | Open in IMG/M |
| 3300006325 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500m | Environmental | Open in IMG/M |
| 3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006340 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770m | Environmental | Open in IMG/M |
| 3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
| 3300006414 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500m | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
| 3300007514 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008738 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300020256 | Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556010-ERR599067) | Environmental | Open in IMG/M |
| 3300020298 | Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128) | Environmental | Open in IMG/M |
| 3300020329 | Marine microbial communities from Tara Oceans - TARA_B100000678 (ERX555981-ERR599083) | Environmental | Open in IMG/M |
| 3300020373 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946) | Environmental | Open in IMG/M |
| 3300020389 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008) | Environmental | Open in IMG/M |
| 3300020398 | Marine microbial communities from Tara Oceans - TARA_B100000949 (ERX555993-ERR599072) | Environmental | Open in IMG/M |
| 3300020412 | Marine microbial communities from Tara Oceans - TARA_B100001167 (ERX556053-ERR599047) | Environmental | Open in IMG/M |
| 3300020423 | Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062) | Environmental | Open in IMG/M |
| 3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
| 3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
| 3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021352 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021443 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025707 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026190 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF86A (SPAdes) | Environmental | Open in IMG/M |
| 3300026260 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 (SPAdes) | Environmental | Open in IMG/M |
| 3300026268 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 (SPAdes) | Environmental | Open in IMG/M |
| 3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
| 3300027553 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027622 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_550m (SPAdes) | Environmental | Open in IMG/M |
| 3300027630 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes) | Environmental | Open in IMG/M |
| 3300027677 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_300m (SPAdes) | Environmental | Open in IMG/M |
| 3300027709 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
| 3300031140 | Marine microbial communities from water near the shore, Antarctic Ocean - #420 | Environmental | Open in IMG/M |
| 3300031141 | Marine microbial communities from water near the shore, Antarctic Ocean - #351 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031660 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 | Environmental | Open in IMG/M |
| 3300031683 | Marine microbial communities from water near the shore, Antarctic Ocean - #69 | Environmental | Open in IMG/M |
| 3300031687 | Marine microbial communities from water near the shore, Antarctic Ocean - #125 | Environmental | Open in IMG/M |
| 3300031757 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315 | Environmental | Open in IMG/M |
| 3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031811 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_Tmax_Bot8 | Environmental | Open in IMG/M |
| 3300031861 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416 | Environmental | Open in IMG/M |
| 3300031886 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032019 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515 | Environmental | Open in IMG/M |
| 3300032032 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315 | Environmental | Open in IMG/M |
| 3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
| 3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPaug09P16500mDRAFT_10214822 | 3300000142 | Marine | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFR* |
| LPaug09P16500mDRAFT_10246741 | 3300000142 | Marine | MIGELSGDTADFLNEVPWFDGIIYIILLMGLYVFYKWVNKKFS* |
| GBIDBA_1000566511 | 3300001683 | Hydrothermal Vent Plume | MIDLSSDTSDFLNEVPWFDGIIYIIMLMGLYYFYRWVNHKFK* |
| GBIDBA_100888862 | 3300001683 | Hydrothermal Vent Plume | MIGELSGDTADFLNEISWFDGIIYILLLMGLYVFYKWVNSKF* |
| GBIDBA_101386462 | 3300001683 | Hydrothermal Vent Plume | MIGELSGDTADFLNEISWFDGIIYILIIMGAYVFYKWVNSKF* |
| JGI24818J35693_10050597 | 3300002526 | Marine | MVELTGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFS* |
| JGI24819J35694_10136183 | 3300002528 | Marine | MGINKMVELTGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFS* |
| JGI26238J51125_100324510 | 3300003478 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNHKFK* |
| FS896DNA_100412472 | 3300003540 | Diffuse Hydrothermal Flow Volcanic Vent | MIGDLSGDTADFLNEIPWFDGIIYILMIMGLYVFYKWVNSKF* |
| PicMicro_100340064 | 3300003702 | Marine, Hydrothermal Vent Plume | MYMHGREPMIGELSGDTADFLNEISWFDGIIYIIILMGLYIFYKWANKKF* |
| Ga0066867_100023858 | 3300005400 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWINSKF* |
| Ga0066867_101037732 | 3300005400 | Marine | MIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF* |
| Ga0066867_102539432 | 3300005400 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0066855_101104041 | 3300005402 | Marine | MIGELSGDTADFLNEISWFDGIIYILMLMGLYVFYKWVNTKF* |
| Ga0066855_102728382 | 3300005402 | Marine | MIGELSGDTADFLNEISWFDGIIYIILLMGLYVFYKWANKKF* |
| Ga0066851_100932301 | 3300005427 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWICNSKF* |
| Ga0066851_102358802 | 3300005427 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKFQ* |
| Ga0066381_101515761 | 3300005945 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKF* |
| Ga0066373_101032621 | 3300006011 | Marine | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFK* |
| Ga0082019_10467481 | 3300006093 | Marine | EPNPDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF* |
| Ga0068470_11271461 | 3300006308 | Marine | MNIIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0068470_11419503 | 3300006308 | Marine | MIDLSSDTADFLNEVPWFDGIIYIILLMGLYVFYKWVNKKFS* |
| Ga0068470_12122743 | 3300006308 | Marine | MVELTGDTADFLNEIPWFDGIIYILLLMGLYIFYKWVNKKFR* |
| Ga0068471_11746166 | 3300006310 | Marine | MIGELSGDTADFLNEIPWFDGIVYIIMLMGIYVFYKWVNKKFR* |
| Ga0068471_14424512 | 3300006310 | Marine | MIGELSGDTADFLNEIPWFDGIISILMLMGLYVFYKWVHSKF* |
| Ga0068471_14565612 | 3300006310 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNTKF* |
| Ga0068476_10981572 | 3300006324 | Marine | MDVVGGLMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0068476_14621182 | 3300006324 | Marine | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKF |
| Ga0068501_11155833 | 3300006325 | Marine | GEIMIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFN* |
| Ga0068502_16454601 | 3300006336 | Marine | VGGEMIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFG* |
| Ga0068482_10956152 | 3300006338 | Marine | MIGELSGDTADFLNEISWFDGIIYIILLMGLYVFYKWVNKKF* |
| Ga0068482_11583444 | 3300006338 | Marine | MIGELSGDTADFLNEVPWFDGIIYIILLMGLYVFYKWGYKKFN* |
| Ga0068482_13425361 | 3300006338 | Marine | MIDLTGDTADFLNEIPWFDGIIYIVLLMGLYVFYKWVNKKFN* |
| Ga0068482_16852662 | 3300006338 | Marine | MVELTGDTADFLNEIPWFDGIIYIILLMGLYIFYKWVNKKFR* |
| Ga0068482_19083542 | 3300006338 | Marine | MVELTGDTADFLNEIPWFDGIIYIILLMGLYIFYKWANKKFR* |
| Ga0068503_103938135 | 3300006340 | Marine | MVDLSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWANKKFR* |
| Ga0068503_104073882 | 3300006340 | Marine | MIGELSGDTADFLNEIPWFDGVIYIIMLMGLYVFYKWVNKKFR* |
| Ga0068503_107657573 | 3300006340 | Marine | MIGELSGDTADFLNEISRFDGIVYILMLMGLYVFYKWINSKF* |
| Ga0068493_109639382 | 3300006341 | Marine | ELTGDTADFLNEIPWFDGIIYIILLMGLYIFYKWVNKKFR* |
| Ga0099957_14714134 | 3300006414 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFN* |
| Ga0098033_10604112 | 3300006736 | Marine | MLGELSGDTADFLNEISWFDGIIYILMLMGLYVFYKWVNTKF* |
| Ga0098033_11485912 | 3300006736 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNAKF* |
| Ga0098035_10474775 | 3300006738 | Marine | MIGELSGDTADFLNEIPWFDGIIYTLMLMGLYVFYKWVNSKF* |
| Ga0098035_10843583 | 3300006738 | Marine | IMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKFQ* |
| Ga0098035_10996502 | 3300006738 | Marine | MIGELSGDTADFLNEISWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0098035_12709793 | 3300006738 | Marine | IGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0098048_11034972 | 3300006752 | Marine | MLGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF* |
| Ga0098039_13044952 | 3300006753 | Marine | MIGELSGDTADFLNEIPWFDGIIYILILMSLYVFYKWVNTKF* |
| Ga0098044_10857467 | 3300006754 | Marine | MIGELSGDTADFLNEIPWFDGIIYTLMLMGLYVFYKWVNSKFK* |
| Ga0098055_12543192 | 3300006793 | Marine | MIGELSGDTADFLNEIPWFDGIIYILILMGLYVFYKWVNSKF* |
| Ga0066376_103061382 | 3300006900 | Marine | MNYLTKDTADFLNKIPWFDGIIYILMLMGLYVFYKWINSKF* |
| Ga0066376_103125873 | 3300006900 | Marine | MYMHGREPMIGELSGDTADFLNEISWFDGIVYIILLMGLYVFYKWANKKFR* |
| Ga0066372_101020696 | 3300006902 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGIYVFYKWVNKKFR* |
| Ga0066372_101062655 | 3300006902 | Marine | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNHKFK* |
| Ga0066372_101221751 | 3300006902 | Marine | MIGELSGDTADFLNEIPWFDGIVYIIMLMGLYVFYKWVNKKFR* |
| Ga0066372_102357453 | 3300006902 | Marine | MVGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFSKE* |
| Ga0066372_102473313 | 3300006902 | Marine | MIGELSGDTADFLNEIPWFDGIIYIFMLMGLYVFYKWVNKKFN* |
| Ga0066372_103285302 | 3300006902 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNKKFK* |
| Ga0098053_10538782 | 3300006923 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWFNSKF* |
| Ga0098034_11814001 | 3300006927 | Marine | DTADFLNEIPWFDGIIYILMLMGLYVFYKWVNAKF* |
| Ga0098036_10990191 | 3300006929 | Marine | IMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNTKF* |
| Ga0105019_10100454 | 3300007513 | Marine | MVGELSGDTADFLNEVPWFDGIIYILILMGLYVFYKWVNKKFS* |
| Ga0105020_12154691 | 3300007514 | Marine | DTADFLNEVPWFDGIIYILILMGLYVFYKWVNKKFS* |
| Ga0110931_10366212 | 3300007963 | Marine | QEYINIMIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF* |
| Ga0115660_104113911 | 3300008738 | Marine | MIGELSGDTADFLKEIPWFDGIIYIIMLMGLYVFYKWVNKKFR* |
| Ga0114996_103130511 | 3300009173 | Marine | VMIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFR* |
| Ga0114996_106704642 | 3300009173 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMIMGAYVFYKWVNSKF* |
| Ga0114993_100967088 | 3300009409 | Marine | MIGELSGDTADFLNEIPWFDGIIYILLIMGAYVFYKWVNSKF* |
| Ga0114997_100235122 | 3300009425 | Marine | MDVVGGIMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF* |
| Ga0114997_100785475 | 3300009425 | Marine | MIGELSADTADFLNMISWFDGIVYILMLMGLYVFYKWVNKTFK* |
| Ga0133547_102588835 | 3300010883 | Marine | MVELNLNSDTADFLYEVPWFDGIIYILMLMGLFYFYKWVNNRFK* |
| Ga0133547_118801282 | 3300010883 | Marine | MIDLSSDTADFLNEIPWFDGIIYIILLMGLYVFYK |
| Ga0181374_10286151 | 3300017702 | Marine | INIMIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF |
| Ga0181432_10020298 | 3300017775 | Seawater | MVGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFSKE |
| Ga0181432_10095296 | 3300017775 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNKKFN |
| Ga0181432_10236376 | 3300017775 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKYFG |
| Ga0181432_10602763 | 3300017775 | Seawater | MVGELSGDTADFLNEIPWFDGIVYIIMLMGLYVFYKWVNKKF |
| Ga0181432_10914742 | 3300017775 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGIYVFYKWINKKFR |
| Ga0181432_11209343 | 3300017775 | Seawater | GYGGKEGLMIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKKFR |
| Ga0181432_11320923 | 3300017775 | Seawater | GELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0181432_12201581 | 3300017775 | Seawater | LSSDTADFLNEVPWFDGIIYIIMAMGLYYFYRWVNHKFK |
| Ga0181432_13041672 | 3300017775 | Seawater | GDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF |
| Ga0211645_10567523 | 3300020256 | Marine | MFVLVTEFLGRGLMIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFR |
| Ga0211657_10280071 | 3300020298 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKK |
| Ga0211632_10281612 | 3300020329 | Marine | MVELTGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFS |
| Ga0211660_101826651 | 3300020373 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNHKFK |
| Ga0211680_101139112 | 3300020389 | Marine | MIGDLSGDTADFLNEISWFDGIIYILMLMGLYVFYKWVNSKFK |
| Ga0211637_101934543 | 3300020398 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNNKFK |
| Ga0211552_100678814 | 3300020412 | Marine | MIGELSGDTADFLNEIPWFDGIIYIVLLMGLYVFYKWVNKKFG |
| Ga0211525_100269172 | 3300020423 | Marine | MIDLSSDTADFLNEVSWFDGIIYIMMGMLLYYFYRWVNHKFK |
| Ga0211578_100381801 | 3300020444 | Marine | MDVVGGLMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYK |
| Ga0211578_100431613 | 3300020444 | Marine | MNIIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNNKFK |
| Ga0211691_100513782 | 3300020447 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKFK |
| Ga0211691_100689722 | 3300020447 | Marine | MMELTEDTADFLNSISWFDGIIYILILMVLYVFKKWVDKKLG |
| Ga0206684_10938771 | 3300021068 | Seawater | SGDTADFLNEIPWFDGIVYILMLMGLYVFYKWVNKKFK |
| Ga0206684_11084831 | 3300021068 | Seawater | GDIMIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNSKF |
| Ga0206678_102733603 | 3300021084 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIFMLMGLYVFYKWVNKKFK |
| Ga0206678_103891061 | 3300021084 | Seawater | MSERILERGLMIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFK |
| Ga0206683_103705713 | 3300021087 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKK |
| Ga0206679_101388944 | 3300021089 | Seawater | MSERILERGFMIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFK |
| Ga0206680_100311468 | 3300021352 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFK |
| Ga0206680_102035392 | 3300021352 | Seawater | MDVVGGLMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0206680_103184932 | 3300021352 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNGKF |
| Ga0206685_100023854 | 3300021442 | Seawater | MIDLSSDTADFLNEVPWFDGIIYIIMLMGLYYFYRWVNHKFK |
| Ga0206685_100042497 | 3300021442 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMIMGLYVFYKWVNSKF |
| Ga0206685_100055733 | 3300021442 | Seawater | MIDLSSDTADFLNEVPWFDGIIYIIMAMGLYYFYRWVNHKFK |
| Ga0206685_100131604 | 3300021442 | Seawater | MIGELSGDTADFLNEIPWFDGIVYILMLMGLYVFYKWVNKKFR |
| Ga0206685_100918911 | 3300021442 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWV |
| Ga0206685_100983781 | 3300021442 | Seawater | GDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0206685_101963662 | 3300021442 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFY |
| Ga0206681_100546492 | 3300021443 | Seawater | MGINKMVELTGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFS |
| Ga0206681_102736224 | 3300021443 | Seawater | EVMIGELSGDTADFLNEISWFDGIVYILILMGLYVFYKWVNSKF |
| Ga0206681_103558992 | 3300021443 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYK |
| Ga0226832_100160808 | 3300021791 | Hydrothermal Vent Fluids | MIGELSGDTADFLNEIPWFDGIIYIVLLMGLYVFYKW |
| (restricted) Ga0233427_1000678913 | 3300022933 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKFQ |
| Ga0208012_10148052 | 3300025066 | Marine | MIGELSGDTADFLNEISWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0208012_10161992 | 3300025066 | Marine | MIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF |
| Ga0208920_10622572 | 3300025072 | Marine | GELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF |
| Ga0208553_10334002 | 3300025109 | Marine | MLGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNTKF |
| Ga0209644_10587342 | 3300025125 | Marine | MIGELSGDTADFLNDIPWFDGIIYILMLMGLYVFYKWVNTKF |
| Ga0208299_10095526 | 3300025133 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNAKF |
| Ga0209756_10193034 | 3300025141 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWINSKF |
| Ga0209337_11870581 | 3300025168 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMIMGAYVFYKWVNSKFQXILDTAIT |
| Ga0209667_11448723 | 3300025707 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYK |
| Ga0207987_10316912 | 3300026190 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0208408_11532661 | 3300026260 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVN |
| Ga0208641_10735944 | 3300026268 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNS |
| Ga0208411_11565012 | 3300026279 | Marine | PSPNLKGEVMIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNHKFK |
| Ga0208947_10301513 | 3300027553 | Marine | MIDLSSDTADFLNEIPWFDGIIYIFMLMGLYVFYKWVNKKFK |
| Ga0209753_10055465 | 3300027622 | Marine | MIGELSGDTADFLNEIPWFDGIIYIVLLMGLYVFYKWVNKKFN |
| Ga0209753_10261514 | 3300027622 | Marine | MIGELSGDTADFLNEIPWFDGIVYVLMLMGLYVFYKWVNKKFR |
| Ga0209753_10661533 | 3300027622 | Marine | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFR |
| Ga0209432_11451513 | 3300027630 | Marine | MIGELSGDTADFLNEIPWFDGIVYIIMLMGLYVFYKWVNKKFR |
| Ga0209019_10799901 | 3300027677 | Marine | MIGELSGDTADFLNEIPWFDGIIYILMLMGIYVFYKWVNKKFR |
| Ga0209019_10949611 | 3300027677 | Marine | MIGELSGDTADFLNEIPWFDGIVYIIMLMGIYVFYKWVNKKFR |
| Ga0209228_10974692 | 3300027709 | Marine | MIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNSKFK |
| Ga0209709_101685343 | 3300027779 | Marine | MDVVGGIMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0209035_100135842 | 3300027827 | Marine | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFR |
| Ga0257107_10159684 | 3300028192 | Marine | MIGELSGDTADFLNEIPWFDGVIYIVMLMGLYVFYKWINKKFR |
| Ga0257109_11225532 | 3300028487 | Marine | MYLHGRGPMVGELSGDTADFLNEISWFDGIIYIIILMGLYIFYKWANKKF |
| Ga0257113_11300243 | 3300028488 | Marine | MIGELSGDTADFLNEISWFDGIIYIIILMGLYIFYKWANKK |
| Ga0257112_100684472 | 3300028489 | Marine | MVELTGDTADFLNEISWFDGIVYVILLMGLYVFYKWANKKFQ |
| Ga0257112_102635822 | 3300028489 | Marine | MIGELSGDTADFLNEISWFDGIIYIIMLMGLYVFYKWINKKFR |
| Ga0308024_10110076 | 3300031140 | Marine | MEASTMGIGDLSGDTADFLNQISWFDGIMYIILLMGLFTFYKWVNSKF |
| Ga0308021_102967553 | 3300031141 | Marine | MLGELSGDTADFLNEIPWFDGIIYILIIMGAYIFYKWVNSKF |
| Ga0308019_100302622 | 3300031598 | Marine | MLGELSGDTADFLNEIPWFDGIIYILIVMGAYIFYKWVNSKF |
| Ga0308019_102108722 | 3300031598 | Marine | MIDLSSDTADFLNEIPWFDGIIYILMGMGLYIFYKWVNKKFR |
| Ga0302118_103686902 | 3300031627 | Marine | MIGELSGDTADFLNEIPWFDGIIYILLIMGAYVFYKWVNSKF |
| Ga0307994_11645582 | 3300031660 | Marine | VILLMEASTMGIGDLSGDTADFLNQISWFDGIMYIILLMGLFTFYKWVNSKF |
| Ga0308006_100240852 | 3300031683 | Marine | MGIGDLSGDTADFLNQISWFDGIMYIILLMGLFTFYKWVNSKF |
| Ga0308008_10486642 | 3300031687 | Marine | MIGELSGDTADFLNEIPWFDGIIYILLIMGAYAFYKWVNSKF |
| Ga0315328_107463701 | 3300031757 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIFMLMGLYVFYKWVNKKFN |
| Ga0315332_106370761 | 3300031773 | Seawater | MIGELSGDTADFLNEIPWFDGVIYILMLMGLYVFYKWVNSKFQ |
| Ga0310121_102165455 | 3300031801 | Marine | ETADFLNEIPWFDGIIYIILLMGLYVFYKWVNSRF |
| Ga0310125_100956716 | 3300031811 | Marine | MDLVVTMIGDLSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKKFR |
| Ga0315319_100593063 | 3300031861 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWINKKFR |
| Ga0315319_101993662 | 3300031861 | Seawater | MIGDLSGDTADFLNEIPWFDGIIYILMIMGLYVFYKWVNSKF |
| Ga0315319_104277232 | 3300031861 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKKFK |
| Ga0315319_106807802 | 3300031861 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFN |
| Ga0315318_1000062327 | 3300031886 | Seawater | IGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0315316_100065593 | 3300032011 | Seawater | MIGELSGDTADFLNEIPWFDGIIYVLMLMGLYVFYKWVNSKF |
| Ga0315324_101421102 | 3300032019 | Seawater | MDVVGGLMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKFQ |
| Ga0315324_102261792 | 3300032019 | Seawater | MIGELSGDTADFLNEISWFDGIVYILILMGLYVFYKWVNSKF |
| Ga0315324_103080911 | 3300032019 | Seawater | MGINKMVELTGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFR |
| Ga0315327_100579206 | 3300032032 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYK |
| Ga0315329_100149471 | 3300032048 | Seawater | MDVVGGLMIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSK |
| Ga0315329_100664725 | 3300032048 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIIMLMGIYVFYKWVNKKFR |
| Ga0315329_102855991 | 3300032048 | Seawater | SGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFR |
| Ga0315329_104516552 | 3300032048 | Seawater | MVELTGDTADFLNEIPWFDGIIYIILLMGLYIFYKWVNKKFQ |
| Ga0315329_107284072 | 3300032048 | Seawater | LSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNKKFN |
| Ga0315333_102878811 | 3300032130 | Seawater | MIGELSGDTADFLNEIPWFDGIVYILMLMGLYVFYKWVNKK |
| Ga0315333_104755544 | 3300032130 | Seawater | SGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0310345_100208867 | 3300032278 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNKKFR |
| Ga0310345_101040672 | 3300032278 | Seawater | MVELTGDTADFLNEIPWFDGIIYILLLMGLYIFYKWVNKKFR |
| Ga0310345_108798712 | 3300032278 | Seawater | MIGELSGDTADFLNEIPWFDGIVYILMLMGLYVFYKWVNSKF |
| Ga0310345_111282321 | 3300032278 | Seawater | ELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0315334_100476571 | 3300032360 | Seawater | EDVMIGELSGDTADFLNEIPWFDGIVYIIMLMGLYVFYKWVNKKFR |
| Ga0315334_104580212 | 3300032360 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKYFG |
| Ga0315334_105363833 | 3300032360 | Seawater | MVGTMIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWINKKFR |
| Ga0315334_105461824 | 3300032360 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKKFR |
| Ga0315334_107133231 | 3300032360 | Seawater | YGGKEGLMIGELSGDTADFLNEIPWFDGIIYIVMLMGLYVFYKWVNKKFR |
| Ga0315334_111735442 | 3300032360 | Seawater | LSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSKF |
| Ga0315334_113326141 | 3300032360 | Seawater | MFVSVMEFLGRVLMIGELSGDTADFLNEIPWFDGIIYIIMLMGLYVFYKWVNKKFR |
| Ga0310342_1014072111 | 3300032820 | Seawater | MIDLSSDTADFLNEVPWFDGIIYIILLMGLYVFYKWVNKKFS |
| Ga0310342_1019349442 | 3300032820 | Seawater | MVELTGDTADFLNEIPWFDGIIYIILLMGLYIFYKWVNKKFR |
| Ga0310342_1024563471 | 3300032820 | Seawater | MIGELSGDTADFLNEIPWFDGIIYILMLMGLYVFYKWVNSK |
| Ga0372840_133724_109_240 | 3300034695 | Seawater | MIGELSGDTADFLNEIPWFDGIIYIILLMGLYVFYKWVNKKFS |
| ⦗Top⦘ |