


| Basic Information | |
|---|---|
| Family ID | F029706 |
| Family Type | Metagenome |
| Number of Sequences | 187 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQ |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 187 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 98.40 % |
| % of genes near scaffold ends (potentially truncated) | 99.47 % |
| % of genes from short scaffolds (< 2000 bps) | 88.24 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.235 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.230 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 22.97% β-sheet: 8.11% Coil/Unstructured: 68.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 187 Family Scaffolds |
|---|---|---|
| PF00296 | Bac_luciferase | 13.37 |
| PF01596 | Methyltransf_3 | 10.16 |
| PF01266 | DAO | 9.63 |
| PF04343 | DUF488 | 9.09 |
| PF01264 | Chorismate_synt | 5.35 |
| PF00903 | Glyoxalase | 3.74 |
| PF03992 | ABM | 3.74 |
| PF02142 | MGS | 3.74 |
| PF04392 | ABC_sub_bind | 2.14 |
| PF07690 | MFS_1 | 2.14 |
| PF00326 | Peptidase_S9 | 2.14 |
| PF02653 | BPD_transp_2 | 2.14 |
| PF08402 | TOBE_2 | 1.60 |
| PF09723 | Zn-ribbon_8 | 1.60 |
| PF12695 | Abhydrolase_5 | 1.07 |
| PF00892 | EamA | 1.07 |
| PF02661 | Fic | 1.07 |
| PF00005 | ABC_tran | 1.07 |
| PF00355 | Rieske | 1.07 |
| PF10604 | Polyketide_cyc2 | 1.07 |
| PF00561 | Abhydrolase_1 | 1.07 |
| PF00072 | Response_reg | 0.53 |
| PF02627 | CMD | 0.53 |
| PF13091 | PLDc_2 | 0.53 |
| PF11746 | DUF3303 | 0.53 |
| PF03795 | YCII | 0.53 |
| PF13489 | Methyltransf_23 | 0.53 |
| PF00583 | Acetyltransf_1 | 0.53 |
| PF01738 | DLH | 0.53 |
| PF04454 | Linocin_M18 | 0.53 |
| PF14579 | HHH_6 | 0.53 |
| PF02826 | 2-Hacid_dh_C | 0.53 |
| PF00389 | 2-Hacid_dh | 0.53 |
| PF03404 | Mo-co_dimer | 0.53 |
| PF06146 | PsiE | 0.53 |
| PF02776 | TPP_enzyme_N | 0.53 |
| PF00154 | RecA | 0.53 |
| PF02784 | Orn_Arg_deC_N | 0.53 |
| PF04909 | Amidohydro_2 | 0.53 |
| PF05360 | YiaAB | 0.53 |
| PF02310 | B12-binding | 0.53 |
| PF13823 | ADH_N_assoc | 0.53 |
| PF05544 | Pro_racemase | 0.53 |
| PF00300 | His_Phos_1 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 187 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 13.37 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 10.16 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 10.16 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 10.16 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 9.09 |
| COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 5.35 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.14 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.53 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.53 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.53 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.53 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.53 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
| COG3223 | Phosphate starvation-inducible membrane PsiE (function unknown) | General function prediction only [R] | 0.53 |
| COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.53 |
| COG4298 | Uncharacterized conserved protein, YiaAB domain | Function unknown [S] | 0.53 |
| COG4682 | Uncharacterized membrane protein YiaA | Function unknown [S] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.24 % |
| Unclassified | root | N/A | 11.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100074658 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300000891|JGI10214J12806_10296998 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300002558|JGI25385J37094_10012379 | All Organisms → cellular organisms → Bacteria | 3051 | Open in IMG/M |
| 3300002561|JGI25384J37096_10064259 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1361 | Open in IMG/M |
| 3300002912|JGI25386J43895_10000787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6941 | Open in IMG/M |
| 3300003324|soilH2_10019475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1554 | Open in IMG/M |
| 3300004013|Ga0055465_10068722 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300004019|Ga0055439_10295328 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300004156|Ga0062589_100633405 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300004480|Ga0062592_101726098 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005093|Ga0062594_100036591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2337 | Open in IMG/M |
| 3300005175|Ga0066673_10862409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 516 | Open in IMG/M |
| 3300005178|Ga0066688_10020414 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
| 3300005180|Ga0066685_10367945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 998 | Open in IMG/M |
| 3300005289|Ga0065704_10652458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300005293|Ga0065715_11157902 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005332|Ga0066388_101750585 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005339|Ga0070660_101742278 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005364|Ga0070673_101366356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300005439|Ga0070711_101644581 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005451|Ga0066681_10437828 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 803 | Open in IMG/M |
| 3300005458|Ga0070681_11503168 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005467|Ga0070706_100292700 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300005468|Ga0070707_100198353 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300005545|Ga0070695_101667335 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005546|Ga0070696_101605537 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005552|Ga0066701_10002277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7086 | Open in IMG/M |
| 3300005577|Ga0068857_100069902 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300005713|Ga0066905_101662388 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 586 | Open in IMG/M |
| 3300005937|Ga0081455_10926237 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300006032|Ga0066696_10274679 | All Organisms → cellular organisms → Bacteria | 1092 | Open in IMG/M |
| 3300006046|Ga0066652_100077684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2610 | Open in IMG/M |
| 3300006058|Ga0075432_10137103 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300006755|Ga0079222_10560301 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300006794|Ga0066658_10788369 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300006806|Ga0079220_10064155 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300006844|Ga0075428_100785034 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006844|Ga0075428_102142095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300006845|Ga0075421_101205709 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300006845|Ga0075421_102816289 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006847|Ga0075431_101044238 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300006847|Ga0075431_101113650 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006852|Ga0075433_11772317 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006853|Ga0075420_100359014 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300006876|Ga0079217_11192805 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300006880|Ga0075429_100819588 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300006880|Ga0075429_100865611 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006904|Ga0075424_100286382 | All Organisms → cellular organisms → Bacteria | 1753 | Open in IMG/M |
| 3300006904|Ga0075424_100535040 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1251 | Open in IMG/M |
| 3300007076|Ga0075435_100143355 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300007076|Ga0075435_102034648 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009012|Ga0066710_100138795 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
| 3300009012|Ga0066710_101214696 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300009012|Ga0066710_101766470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
| 3300009012|Ga0066710_103417654 | Not Available | 603 | Open in IMG/M |
| 3300009012|Ga0066710_104199878 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009089|Ga0099828_10478619 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300009090|Ga0099827_10299084 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1361 | Open in IMG/M |
| 3300009094|Ga0111539_10830049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1075 | Open in IMG/M |
| 3300009137|Ga0066709_101959856 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 813 | Open in IMG/M |
| 3300009137|Ga0066709_104453701 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 511 | Open in IMG/M |
| 3300009147|Ga0114129_11252106 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300009148|Ga0105243_13103532 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300009444|Ga0114945_10388142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 831 | Open in IMG/M |
| 3300009538|Ga0129287_10585195 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300009814|Ga0105082_1027441 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010046|Ga0126384_10603600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 961 | Open in IMG/M |
| 3300010047|Ga0126382_11638869 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010047|Ga0126382_12549071 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010320|Ga0134109_10013787 | All Organisms → cellular organisms → Bacteria | 2381 | Open in IMG/M |
| 3300010322|Ga0134084_10139536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 807 | Open in IMG/M |
| 3300010358|Ga0126370_11140562 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010360|Ga0126372_12968462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 526 | Open in IMG/M |
| 3300010361|Ga0126378_10942035 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300010362|Ga0126377_10265706 | All Organisms → cellular organisms → Bacteria | 1677 | Open in IMG/M |
| 3300010362|Ga0126377_10521701 | Not Available | 1222 | Open in IMG/M |
| 3300010366|Ga0126379_11653969 | Not Available | 745 | Open in IMG/M |
| 3300011119|Ga0105246_11324483 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300011429|Ga0137455_1062181 | Not Available | 1064 | Open in IMG/M |
| 3300012164|Ga0137352_1097763 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012189|Ga0137388_11042273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 754 | Open in IMG/M |
| 3300012199|Ga0137383_10980799 | Not Available | 616 | Open in IMG/M |
| 3300012208|Ga0137376_10371550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1242 | Open in IMG/M |
| 3300012354|Ga0137366_10173485 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012361|Ga0137360_10942949 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300012362|Ga0137361_11551126 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012363|Ga0137390_10622959 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012683|Ga0137398_11224768 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012917|Ga0137395_10079211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2140 | Open in IMG/M |
| 3300012922|Ga0137394_11593619 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012929|Ga0137404_11862909 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300012930|Ga0137407_11858611 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
| 3300012971|Ga0126369_13217599 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300012971|Ga0126369_13652090 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300013297|Ga0157378_12747418 | Not Available | 545 | Open in IMG/M |
| 3300014255|Ga0075320_1026706 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300014326|Ga0157380_10548887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1133 | Open in IMG/M |
| 3300014885|Ga0180063_1122802 | Not Available | 806 | Open in IMG/M |
| 3300017656|Ga0134112_10229604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 732 | Open in IMG/M |
| 3300017659|Ga0134083_10050853 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300017659|Ga0134083_10178100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 870 | Open in IMG/M |
| 3300017659|Ga0134083_10323576 | Not Available | 659 | Open in IMG/M |
| 3300018028|Ga0184608_10146309 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300018031|Ga0184634_10474885 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300018076|Ga0184609_10202441 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300018089|Ga0187774_11289315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 529 | Open in IMG/M |
| 3300019377|Ga0190264_10605334 | Not Available | 783 | Open in IMG/M |
| 3300019487|Ga0187893_10194622 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
| 3300019883|Ga0193725_1148850 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019890|Ga0193728_1340007 | Not Available | 545 | Open in IMG/M |
| 3300019998|Ga0193710_1019526 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300021073|Ga0210378_10204548 | Not Available | 753 | Open in IMG/M |
| 3300021344|Ga0193719_10473771 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300022694|Ga0222623_10024983 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300024181|Ga0247693_1023464 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300025160|Ga0209109_10072829 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300025165|Ga0209108_10481207 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
| 3300025173|Ga0209824_10296389 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300025324|Ga0209640_11169756 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 580 | Open in IMG/M |
| 3300025325|Ga0209341_10642309 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300025327|Ga0209751_10205409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1686 | Open in IMG/M |
| 3300025567|Ga0210076_1052591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 882 | Open in IMG/M |
| 3300025885|Ga0207653_10270671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 654 | Open in IMG/M |
| 3300025907|Ga0207645_10909389 | Not Available | 598 | Open in IMG/M |
| 3300025915|Ga0207693_10325891 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300025922|Ga0207646_10766955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 860 | Open in IMG/M |
| 3300025923|Ga0207681_10413479 | Not Available | 1091 | Open in IMG/M |
| 3300025930|Ga0207701_10362830 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300025938|Ga0207704_10447516 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300025940|Ga0207691_10067836 | All Organisms → cellular organisms → Bacteria | 3224 | Open in IMG/M |
| 3300025942|Ga0207689_10280190 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300025942|Ga0207689_11220993 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300026029|Ga0208002_1009863 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 918 | Open in IMG/M |
| 3300026075|Ga0207708_10505859 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300026277|Ga0209350_1020309 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300026310|Ga0209239_1116253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1115 | Open in IMG/M |
| 3300026318|Ga0209471_1065805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1635 | Open in IMG/M |
| 3300026507|Ga0257165_1043557 | Not Available | 800 | Open in IMG/M |
| 3300026524|Ga0209690_1030668 | All Organisms → cellular organisms → Bacteria | 2587 | Open in IMG/M |
| 3300026529|Ga0209806_1299425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300026530|Ga0209807_1211274 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300026540|Ga0209376_1005752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10190 | Open in IMG/M |
| 3300026548|Ga0209161_10003369 | All Organisms → cellular organisms → Bacteria | 12913 | Open in IMG/M |
| 3300026550|Ga0209474_10737102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300026551|Ga0209648_10464123 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300027273|Ga0209886_1039916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 727 | Open in IMG/M |
| 3300027636|Ga0214469_1155098 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027651|Ga0209217_1173329 | Not Available | 590 | Open in IMG/M |
| 3300027655|Ga0209388_1135994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 698 | Open in IMG/M |
| 3300027846|Ga0209180_10581917 | Not Available | 620 | Open in IMG/M |
| 3300027907|Ga0207428_10698920 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 725 | Open in IMG/M |
| 3300027907|Ga0207428_10936288 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300027909|Ga0209382_10817816 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300027909|Ga0209382_11156181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 795 | Open in IMG/M |
| 3300027910|Ga0209583_10793973 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| (restricted) 3300028043|Ga0233417_10080542 | All Organisms → cellular organisms → Bacteria | 1348 | Open in IMG/M |
| 3300028380|Ga0268265_10153005 | All Organisms → cellular organisms → Bacteria | 1948 | Open in IMG/M |
| 3300028592|Ga0247822_10780045 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 777 | Open in IMG/M |
| 3300028673|Ga0257175_1004243 | Not Available | 1882 | Open in IMG/M |
| 3300028792|Ga0307504_10419415 | Not Available | 530 | Open in IMG/M |
| 3300028809|Ga0247824_10052089 | All Organisms → cellular organisms → Bacteria | 2115 | Open in IMG/M |
| 3300030006|Ga0299907_10545119 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300030620|Ga0302046_10593971 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10127228 | Not Available | 693 | Open in IMG/M |
| 3300031229|Ga0299913_11137611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 742 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1098876 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300031572|Ga0318515_10521294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. CG3 | 634 | Open in IMG/M |
| 3300031716|Ga0310813_10092375 | All Organisms → cellular organisms → Bacteria | 2336 | Open in IMG/M |
| 3300031720|Ga0307469_10419095 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300031740|Ga0307468_102281487 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031820|Ga0307473_11045343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 599 | Open in IMG/M |
| 3300031859|Ga0318527_10047455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1662 | Open in IMG/M |
| 3300031903|Ga0307407_11454609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300031911|Ga0307412_10555364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 965 | Open in IMG/M |
| 3300031943|Ga0310885_10395082 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300032000|Ga0310903_10576716 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300032017|Ga0310899_10697730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 515 | Open in IMG/M |
| 3300032094|Ga0318540_10298611 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300032122|Ga0310895_10394575 | Not Available | 676 | Open in IMG/M |
| 3300032180|Ga0307471_102340657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Janthinobacterium → unclassified Janthinobacterium → Janthinobacterium sp. CG3 | 674 | Open in IMG/M |
| 3300032205|Ga0307472_102200982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 556 | Open in IMG/M |
| 3300032205|Ga0307472_102246215 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300033550|Ga0247829_10043535 | All Organisms → cellular organisms → Bacteria | 3107 | Open in IMG/M |
| 3300033550|Ga0247829_11372300 | Not Available | 584 | Open in IMG/M |
| 3300033551|Ga0247830_10326079 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300033811|Ga0364924_135269 | Not Available | 575 | Open in IMG/M |
| 3300034177|Ga0364932_0007865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4011 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.81% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.21% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.21% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.07% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.07% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.07% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.07% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.07% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.07% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.07% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.53% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.53% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.53% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.53% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.53% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012164 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027636 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeq | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1000746581 | 3300000559 | Soil | MKYGVVLPIWQLTVADAESLATKAEALGLDGVFVPDHILAKPA |
| JGI10214J12806_102969984 | 3300000891 | Soil | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKP |
| JGI25385J37094_100123794 | 3300002558 | Grasslands Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVFVPDHILAKPATTQHYG |
| JGI25384J37096_100642591 | 3300002561 | Grasslands Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVFVPDHILAKP |
| JGI25386J43895_100007871 | 3300002912 | Grasslands Soil | MNYGVVLPIWQLTVAQAESLAARAEQLGLDGVFVPDHILAKPA |
| soilH2_100194751 | 3300003324 | Sugarcane Root And Bulk Soil | MKYGVVLPIWQLTIAEAESLAVRAEDAGLDGVFVPDHILAKPATTQH |
| Ga0055465_100687221 | 3300004013 | Natural And Restored Wetlands | MNYGIVLPIWQLSAAEAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0055439_102953282 | 3300004019 | Natural And Restored Wetlands | MKYGVVLPIWQLTVAEAETLATRAESLGLDGVFVPDHILAKPATTQHYG |
| Ga0062589_1006334051 | 3300004156 | Soil | MNYGVVLPIWQLSAREAESLTVRAEALGLDGVFVPDHILAKP |
| Ga0062592_1017260982 | 3300004480 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0062594_1000365911 | 3300005093 | Soil | MKYGVVLPIWQLTVAEAESLATRAEQLGLDGVFVPDHILAKPATTQHYGGHWP |
| Ga0066673_108624091 | 3300005175 | Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVFVPDHILAKPATTQ |
| Ga0066688_100204141 | 3300005178 | Soil | MNYGVVLPIWQLTVAQAESLAARAEQLGLDGVFVPDNILAKPATTQHY |
| Ga0066685_103679453 | 3300005180 | Soil | MKLGVVLPIWQISVTDAEKLTLKAEELGLDGVFVPDHILAKPATTQHYGPS |
| Ga0065704_106524581 | 3300005289 | Switchgrass Rhizosphere | MNYGVVLPIWQLTTADAESLTVRAEELGLDGVFVPDHILAK |
| Ga0065715_111579021 | 3300005293 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPAT |
| Ga0066388_1017505853 | 3300005332 | Tropical Forest Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKP |
| Ga0070660_1017422782 | 3300005339 | Corn Rhizosphere | MKYGVVLPIWQLTVAEAESLATRAEQLGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0070673_1013663561 | 3300005364 | Switchgrass Rhizosphere | MKYGVVLPIWQLTVAEAESLATRAEELGIDGVFVPDHILAK |
| Ga0070711_1016445811 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVILPIWQLTVAEAESLATKAETLGLDGVFVPDHILAKPATTQ |
| Ga0066681_104378281 | 3300005451 | Soil | MKFGAVLPIWQLTVGEAESLALRAEEVGLDGVFVPDHILAKPA |
| Ga0070681_115031682 | 3300005458 | Corn Rhizosphere | MMYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILA |
| Ga0070706_1002927003 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILAKPATTQHY |
| Ga0070707_1001983531 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILAKPATT |
| Ga0070695_1016673351 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAP |
| Ga0070696_1016055371 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVILPIWQLTVAEAESLATRAEALGLDGVFVPDHILAKPATTQHYGGHWPDPF |
| Ga0066701_1000227710 | 3300005552 | Soil | MNYGVVLPIWQLTVADAESLTTRAEELGLDGVFVPDHILAKPATTQHYG |
| Ga0068857_1000699025 | 3300005577 | Corn Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHWP |
| Ga0066905_1016623882 | 3300005713 | Tropical Forest Soil | MKFGAVLPIWQLTVAEAETLTVRAEDLGLDGIFVPDHILAKPATTQHYG |
| Ga0081455_109262372 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNYGVVLPIWQLTIAEAESLTARAEELGIDGVFVPDHILAKPAT |
| Ga0066696_102746791 | 3300006032 | Soil | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILAKPATTQH |
| Ga0066652_1000776844 | 3300006046 | Soil | MKLGVVLPIWQISVTDAEKLTLKAEELGLDGVFVPDHILAKPA |
| Ga0075432_101371032 | 3300006058 | Populus Rhizosphere | MKYGVVLPIWQLTIAEAESLTTRAESLGLDGVFVPDHILAK |
| Ga0079222_105603013 | 3300006755 | Agricultural Soil | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGG |
| Ga0066658_107883692 | 3300006794 | Soil | MKYGVILPIWQLSVRDAETLSLKAEDLGLDGVFVPDHILAPPA |
| Ga0079220_100641553 | 3300006806 | Agricultural Soil | MKYGVVLPIWQLTIADAESLTMRAEALGLDGVFVPDHILAKPATTQHYGGHWPDPFALL |
| Ga0075428_1007850341 | 3300006844 | Populus Rhizosphere | MNYGVVLPIWQLTVADAEALTLRAEALGLDGVFVPDHILAKPATTQHYGGHWPDPFSLL |
| Ga0075428_1021420952 | 3300006844 | Populus Rhizosphere | MKYGVVLPIWQLTVAEAEALATRAEELGLDGVFVPDHILAK |
| Ga0075421_1012057091 | 3300006845 | Populus Rhizosphere | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPA |
| Ga0075421_1028162892 | 3300006845 | Populus Rhizosphere | MNYGVVLPIWQLTAREAESLTVRAEALGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0075431_1010442382 | 3300006847 | Populus Rhizosphere | MNYGVVLPIWQLTIAEAESLALRTEELGLDGVFVPDHILAKPATTQHYG |
| Ga0075431_1011136503 | 3300006847 | Populus Rhizosphere | MKFGAVLPIWQLTMSEAETLALRAEEVGLDGVFVPDHILAKPATTQHYG |
| Ga0075433_117723172 | 3300006852 | Populus Rhizosphere | MKLGVVLPIWQLTSGEAESLAVNADELGLDGVFVPDHILAKPATTQ |
| Ga0075420_1003590142 | 3300006853 | Populus Rhizosphere | MDYGVVLPIWQLTIADAEALTTHAEALGLDGVFVPDHILAKPATTQHYGGHWPDPF |
| Ga0079217_111928051 | 3300006876 | Agricultural Soil | MNYGVVLPIWQLTVADAASLTTRAEELGLDGVFVPDHILA |
| Ga0075429_1008195881 | 3300006880 | Populus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0075429_1008656111 | 3300006880 | Populus Rhizosphere | MNYGVVLPIWQLTVAEAESLTTRAEELGIDGVFVPDHILAKPATTQHYGGHWPDPFALL |
| Ga0075424_1002863821 | 3300006904 | Populus Rhizosphere | MNYGVVLPIWQLTAREAESLTVRAEALGLDGVFVP |
| Ga0075424_1005350404 | 3300006904 | Populus Rhizosphere | MHYGVVLPIWQLTIADAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0075435_1001433553 | 3300007076 | Populus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATT |
| Ga0075435_1020346481 | 3300007076 | Populus Rhizosphere | MKYGVILPIWQLSVRDAETLALRAEALGLDGVFVPDHILAPPATTQHYGPNWPD |
| Ga0066710_1001387951 | 3300009012 | Grasslands Soil | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILAKPATTQHYG |
| Ga0066710_1012146961 | 3300009012 | Grasslands Soil | MNYGVVLPIWQLTVAQAESLAARAEQLGLDGVFVPDHILAKPATTQHYGGHWPDPF |
| Ga0066710_1017664701 | 3300009012 | Grasslands Soil | MNYGVVLAIWQLTIAEAEALTARAEELGIDGVFVPDHILAKPATTQHY |
| Ga0066710_1034176541 | 3300009012 | Grasslands Soil | MKFGVVLPIWQLTIGEAESLTLRAEELGLDGIFVPDHILAKPA |
| Ga0066710_1041998781 | 3300009012 | Grasslands Soil | MNYGVVLPIWQLTIAEAEALTARAEELGIDGVFVPDHILAKPATTQHY |
| Ga0099828_104786195 | 3300009089 | Vadose Zone Soil | MNYGVVLPIWQLTVTDAESLTTRAEELGLDGVFVPDHILAKPATTQHYGSHW |
| Ga0099827_102990842 | 3300009090 | Vadose Zone Soil | MNYGVVLPIWQLTIAEAESLTARAETLGLDGVFVPDH |
| Ga0111539_108300491 | 3300009094 | Populus Rhizosphere | VVLPIWQLTAADAESLTVRAEELGLDGVFVPDHILAKPATTQHYG |
| Ga0066709_1019598561 | 3300009137 | Grasslands Soil | MKFGVVLPIWQLTIGEAESLTLRAEELGLDGIFVPDHILAKPATTQHY |
| Ga0066709_1044537012 | 3300009137 | Grasslands Soil | MKYGVVLPIWQLTIAEAESLAVKAEEAGLDGVFVPDHILA |
| Ga0114129_112521063 | 3300009147 | Populus Rhizosphere | MKYGVILPIWQLTVAEAASLATRAEELGLDGVFVPDHILAKPA |
| Ga0105243_131035322 | 3300009148 | Miscanthus Rhizosphere | MNYGVVLPIWQLTIAEAESLALKAEELGLDGVFVPDHILAKPA |
| Ga0114945_103881422 | 3300009444 | Thermal Springs | MNFGVVLPIWQLTVADAESLTARAEELGLDGVFVPDHILAKPATSQHYGGHWP |
| Ga0129287_105851952 | 3300009538 | Beach Aquifer Porewater | MNYGVVLPIWQLTVAEAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGH |
| Ga0105082_10274411 | 3300009814 | Groundwater Sand | MKYGVVLPIWQLSIREAETLALKAEEVGLDGVFVPDHI |
| Ga0126384_106036003 | 3300010046 | Tropical Forest Soil | MKYGVILPIWQLSVRDAETLALRAEALGLDGVFVPDHILAPPA |
| Ga0126382_116388691 | 3300010047 | Tropical Forest Soil | MKFGVVLPIWQLTVGEAESLAVRAEELGVDGVFVPDH |
| Ga0126382_125490712 | 3300010047 | Tropical Forest Soil | MKYGVVLPIWQLTIADAEALTLKAEELGLDGVFVPDHILA |
| Ga0134109_100137871 | 3300010320 | Grasslands Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVLVPDHILAKPATTQH |
| Ga0134084_101395361 | 3300010322 | Grasslands Soil | MNYGVVLPIWQLTIADAESLTARAEQLGLDGVFVPDHILAKPATTQHYG |
| Ga0126370_111405622 | 3300010358 | Tropical Forest Soil | MKYGVILPIWQLSVRDAEALALRAEDLGLDGVFVPDHILAPPATTQPYGRNWPDPF* |
| Ga0126372_129684621 | 3300010360 | Tropical Forest Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQHY |
| Ga0126378_109420352 | 3300010361 | Tropical Forest Soil | MNYGVVLPIWQLSVAEAESLTMRAEELGIDGVFVPDHILAKPATTQH |
| Ga0126377_102657061 | 3300010362 | Tropical Forest Soil | MKYGVVLPIWQLTVADAESLATKAEALGLDGVFVPDHILAKPAT |
| Ga0126377_105217011 | 3300010362 | Tropical Forest Soil | MKFGAVLPIWQLTMAEAESLTLRAEEVGLDAVFVPDHILAKP |
| Ga0126379_116539692 | 3300010366 | Tropical Forest Soil | MKFGAVLPIWQLTMSEAEALALRAEEVGLDGVFVPDHILAKPATTQ |
| Ga0105246_113244832 | 3300011119 | Miscanthus Rhizosphere | MAMKYGVVLPIWQLTVAEAESLATRAEELGIDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0137455_10621811 | 3300011429 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVP |
| Ga0137352_10977632 | 3300012164 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILA |
| Ga0137388_110422731 | 3300012189 | Vadose Zone Soil | MNYGVVLPIWQLSVAEAESLAVRAEALGLAGVFVPDHILAKPATTQHYGG |
| Ga0137383_109807992 | 3300012199 | Vadose Zone Soil | MKYGVVLPIWQLTVAEAESLATRAEALGLDGVFVPDHILAKP |
| Ga0137376_103715502 | 3300012208 | Vadose Zone Soil | MNYGVFLPIWQLTIAEAESLTARAEALGLDGVFVPDHILA |
| Ga0137366_101734854 | 3300012354 | Vadose Zone Soil | MKFGVVLPIWQLTIGEAESLTLRAEELGLDGIFVPDHILAKPATT |
| Ga0137360_109429493 | 3300012361 | Vadose Zone Soil | MKYGVVLPIWQLTVAEAESLATRAEALGLDGVFVPDHILAKPATT |
| Ga0137361_115511262 | 3300012362 | Vadose Zone Soil | MKYGVIVPIWQLSVRDAETLALRAEDLGLDGVFVPDHILA |
| Ga0137390_106229591 | 3300012363 | Vadose Zone Soil | MNYGVVLPIWQLTVGQAEALTARAEELGLEGVFVP |
| Ga0137398_112247681 | 3300012683 | Vadose Zone Soil | MKYGVVLPIWQLTVTEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHWP |
| Ga0137395_100792111 | 3300012917 | Vadose Zone Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQHYGPNWPD |
| Ga0137394_115936191 | 3300012922 | Vadose Zone Soil | MKLGVVLPIWQLSVTDAEKLTLKAEELGLDGVFVPDHILAKP |
| Ga0137404_118629091 | 3300012929 | Vadose Zone Soil | MNYGVVLPIWQLTVADAESLTTRAEELGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0137407_118586112 | 3300012930 | Vadose Zone Soil | MNYGVVLPIWQLTVAEAESLTTRAEELGLDAVFVPDHILAKPATTQH |
| Ga0126369_132175992 | 3300012971 | Tropical Forest Soil | MKLGAIIPIWQLTIAEAEEITVASEGLGLDAVFVPDHILAKPATTQHYGPHWPDPFSL |
| Ga0126369_136520902 | 3300012971 | Tropical Forest Soil | MKYGVVLPIWQLTITEAESLALKAETLGLDRVFVPDHILAKPATTEHYGGHWP |
| Ga0157378_127474182 | 3300013297 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHWPDP |
| Ga0075320_10267063 | 3300014255 | Natural And Restored Wetlands | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVP |
| Ga0157380_105488871 | 3300014326 | Switchgrass Rhizosphere | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQHYGPNWPDPF |
| Ga0180063_11228021 | 3300014885 | Soil | MKFGAVLPIWQLTVAEAEILAVRAEDLGLDGVFVPDHILAKPATTQHYGPHWPDPFA |
| Ga0134112_102296042 | 3300017656 | Grasslands Soil | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHIL |
| Ga0134083_100508532 | 3300017659 | Grasslands Soil | MKFGVVLPIWQLTIGEAESLTLRAEEVGLDAVFVPDHILAKPATT |
| Ga0134083_101781001 | 3300017659 | Grasslands Soil | MNYGVVLPIWQLTVAEAESLAVRAEELGLDGVFVPDHILAKPATTQHY |
| Ga0134083_103235761 | 3300017659 | Grasslands Soil | MKFGAVLPIWQLTVAEAESLTLRAEELGLDGVFVPDHILAKPATTQHY |
| Ga0184608_101463094 | 3300018028 | Groundwater Sediment | MKYGVILPIWQLTVAEAASLATRAEELGLDGVFVPDHILAKP |
| Ga0184634_104748851 | 3300018031 | Groundwater Sediment | VKYGVVLPIWQLTIAEAESLTTRAEELGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0184609_102024413 | 3300018076 | Groundwater Sediment | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQ |
| Ga0187774_112893152 | 3300018089 | Tropical Peatland | MQFGVVLPIWQLTVSEAESLTLHAEEIGLDGVFVPDHILAKPATIEHYGAHWPDPFSLL |
| Ga0190264_106053342 | 3300019377 | Soil | MKYGVVLPIWQLTIAEAESLATRAEELGLDGVFVPDHILAKPATT |
| Ga0187893_101946221 | 3300019487 | Microbial Mat On Rocks | MKYGVVLPIWQLTVAEAESLATRAETLGLDGVFVPDHILAKPATTQHYG |
| Ga0193725_11488501 | 3300019883 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPAT |
| Ga0193728_13400072 | 3300019890 | Soil | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPD |
| Ga0193710_10195261 | 3300019998 | Soil | MKYGVVLPIWQLTVADAASLATRAEELGLDGVFVPDHILAKP |
| Ga0210378_102045481 | 3300021073 | Groundwater Sediment | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPD |
| Ga0193719_104737711 | 3300021344 | Soil | MKYGVILPIWQLTVAEAASLATRAEELGLDGVFVPDHI |
| Ga0222623_100249831 | 3300022694 | Groundwater Sediment | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATT |
| Ga0247693_10234642 | 3300024181 | Soil | MKYGVILPIWQLSVREAETLALRAEDLGLDGVFVPDHILAPPATTQHYGPN |
| Ga0209109_100728291 | 3300025160 | Soil | MKYGVVLPIWQLTVAEAESLATRAEALGLDTGIFNACFD |
| Ga0209108_104812072 | 3300025165 | Soil | MNYGVVLPIWQLTVAEAESLAARAEELGLDGVFVPDHILAKPATTQ |
| Ga0209824_102963892 | 3300025173 | Wastewater | MNYGVVLPIWQLTVTEAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGHWPDPFSLL |
| Ga0209640_111697562 | 3300025324 | Soil | MNYGIVLPIWQLTAAEEESLAVRAEELGLDGVFVPDHILAK |
| Ga0209341_106423093 | 3300025325 | Soil | MNYGVVLPIWQLTVAEAEALAVRAEALGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0209751_102054091 | 3300025327 | Soil | MNYGVVLPIWQLTVAEADSLAARAEELGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0210076_10525911 | 3300025567 | Natural And Restored Wetlands | MNYGIVLPIWQLSAAEAESLTVRAEELGLDGVFVPDHILAKPATTQH |
| Ga0207653_102706711 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATRAEQLGLDGVFVPDHIL |
| Ga0207645_109093891 | 3300025907 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVADAESLATKAEALGLDGVFVPDHILAKPATTQ |
| Ga0207693_103258911 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVILPIWQLTVAEAESLATRAEALGLDGVFVP |
| Ga0207646_107669551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILA |
| Ga0207681_104134792 | 3300025923 | Switchgrass Rhizosphere | MKYGVVLPIWQLTIAEAESLALKAEELGLDGVFVPDHILAKPATT |
| Ga0207701_103628303 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATRAEELGLDGGFVPDH |
| Ga0207704_104475161 | 3300025938 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHWPDPFS |
| Ga0207691_100678361 | 3300025940 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQ |
| Ga0207689_102801905 | 3300025942 | Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATRAEQLGLDGVFVPDHILAKPATTQHYGGH |
| Ga0207689_112209931 | 3300025942 | Miscanthus Rhizosphere | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQPYG |
| Ga0208002_10098631 | 3300026029 | Natural And Restored Wetlands | MNYGIVLPIWQLSAAEAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0207708_105058593 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHIL |
| Ga0209350_10203091 | 3300026277 | Grasslands Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVFVPDHILAKPA |
| Ga0209239_11162532 | 3300026310 | Grasslands Soil | MNYGVVLPIWQLTVAQAESLAARAEQLGLDGVFVPDHILA |
| Ga0209471_10658053 | 3300026318 | Soil | MNYGVVLPIWQLTIADAESLTARAEQLGLDGVFVPDHILAKPAT |
| Ga0257165_10435573 | 3300026507 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQHYGGH |
| Ga0209690_10306683 | 3300026524 | Soil | MNYGVVLPIWQLTIADAESLTTRAEQLGLDGVFVPDHILA |
| Ga0209806_12994252 | 3300026529 | Soil | MNYGVVLPIWQLTIADAESLTARAEQLGLDGVFVPDHILAKPATTQHYGGHWPDPFSL |
| Ga0209807_12112741 | 3300026530 | Soil | MKLGVVLPIWQISVTDAEKLTLKAEELGLDGVFVPDHI |
| Ga0209376_100575210 | 3300026540 | Soil | MKYGVILPIWQLSVRDAETLSLKAEDLGLDGVFVPDHILAPPATTQHYGPNWPDPF |
| Ga0209161_1000336917 | 3300026548 | Soil | MNYGVVLPIWQLTVADAESLTTRAEALGLDGVFVPDHILAKPATTQHYGGHWPDPFALLA |
| Ga0209474_107371022 | 3300026550 | Soil | MNYGVVLPIWQLTVADAESLAMRAESLGLDGVFVPDHI |
| Ga0209648_104641231 | 3300026551 | Grasslands Soil | MKYGVVLPIWQLTVAEAESLATRAEALGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0209886_10399162 | 3300027273 | Groundwater Sand | MNYGVVLPIWQLTIAEAESLTARADQLGLDGVFVPDHILAKPATTQRYGG |
| Ga0214469_11550981 | 3300027636 | Soil | MQYGVVLPIWQLTVAEAETLATRAEELGLDGVFVPDHILAKPATMQHYGGHWP |
| Ga0209217_11733291 | 3300027651 | Forest Soil | MKYGVILPIWQLTVAEAESLATRAEALGLDGVFVPDHIL |
| Ga0209388_11359941 | 3300027655 | Vadose Zone Soil | MNYGVVLPIWQLTIADAESLTSRAEQLGLDGVFVPDHILAKP |
| Ga0209180_105819172 | 3300027846 | Vadose Zone Soil | MKYGVVLPIWQLTVAEAESLATRAEALGLDGVFVPDHILAKPAT |
| Ga0207428_106989202 | 3300027907 | Populus Rhizosphere | MQYGVVLPIWQLTVADAEALTTRAEALGLDAVFVPDHILAKPATTQHYGG |
| Ga0207428_109362881 | 3300027907 | Populus Rhizosphere | VKYGVVLPIWQLTIAEAESLAVRAEELGLDGVFVPDHILAKPATTQHYGGHWPDPFS |
| Ga0209382_108178161 | 3300027909 | Populus Rhizosphere | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILASPPQ |
| Ga0209382_111561811 | 3300027909 | Populus Rhizosphere | MNYGVVLPIWQLTTADAESLTVRAEELGLDGVFVPDHILAKPATTQHYGGHWPDP |
| Ga0209583_107939732 | 3300027910 | Watersheds | MKYGVVLPIWQLTVAEAASLATRAEELGLDGVFVPDHILAKPAT |
| (restricted) Ga0233417_100805421 | 3300028043 | Sediment | MKYGVVLPIWQLTVADAESLATRAEELGLDGVFVPDHILAKPATTQHYG |
| Ga0268265_101530054 | 3300028380 | Switchgrass Rhizosphere | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHIL |
| Ga0247822_107800451 | 3300028592 | Soil | MNYGVVLPIWQLTTADAESLTVRAEELGLDGVFVPDHILAKPATTQHY |
| Ga0257175_10042431 | 3300028673 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQHYGGHWPDP |
| Ga0307504_104194152 | 3300028792 | Soil | MKYGVVLPIWQLTVTEAESLAIQAEAVGLDGVFVPDHILAKPATTQHYGGHWPDPYS |
| Ga0247824_100520894 | 3300028809 | Soil | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHI |
| Ga0299907_105451193 | 3300030006 | Soil | MQYGVVLPIWQLTVAEAETLATRAEELGLDGVFVPDHILAKPATM |
| Ga0302046_105939713 | 3300030620 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHI |
| (restricted) Ga0255310_101272281 | 3300031197 | Sandy Soil | MKYGVVLPIWQLTIAEAESLAVRAEQVGVDGVFVPDHILAKPATTE |
| Ga0299913_111376111 | 3300031229 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQHYGGHWPDPF |
| (restricted) Ga0255312_10988761 | 3300031248 | Sandy Soil | MKYGVVLPIWQLTIAEAESLAVRAEQVGVDGVFVPDHILAKPATTEHYGGHWPDPFAFL |
| Ga0318515_105212941 | 3300031572 | Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQHYGPNWP |
| Ga0310813_100923753 | 3300031716 | Soil | MKYGVVLPIWQLTIAEAESLTLRAETLGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0307469_104190951 | 3300031720 | Hardwood Forest Soil | MKYGVVLPIWQLTVAEAESLATKAESLGLDGVFVPDHILAKPATTQHYGGNWPDPFS |
| Ga0307468_1022814871 | 3300031740 | Hardwood Forest Soil | MKYGVILPIWQLSVRDAETLALRAEDLGVDGVFVPDHILAPPATTQHY |
| Ga0307473_110453432 | 3300031820 | Hardwood Forest Soil | MKYGVILPIWQLSVRDAETLALRAEALGLDGVFVPDHILAPPATTQHYGPNW |
| Ga0318527_100474553 | 3300031859 | Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPP |
| Ga0307407_114546092 | 3300031903 | Rhizosphere | MNYGIVLPIWQLSAAEAESLTVRAEQLGLDGVFVPDHILAKPATTQHYGGHW |
| Ga0307412_105553641 | 3300031911 | Rhizosphere | MKYGVVLPIWQLTIAEAESLTTRAEALGLDGVFVPDHILA |
| Ga0310885_103950822 | 3300031943 | Soil | MKYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQH |
| Ga0310903_105767162 | 3300032000 | Soil | MKYGVVLPIWQLTIAEAESLATRAESLGLDGVFVPDHILAKPATTQHYGG |
| Ga0310899_106977301 | 3300032017 | Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPATTQH |
| Ga0318540_102986111 | 3300032094 | Soil | MKYGVILPIWQLSVRDAETLALRAEDLGLDGVFVPDHILA |
| Ga0310895_103945752 | 3300032122 | Soil | MNYGVVLPIWQLTIAEAESLTMKAEELGLDGVFVPD |
| Ga0307471_1023406571 | 3300032180 | Hardwood Forest Soil | MKYGVILPIWQLSVRDAETLALRAEALGLDGVFVPDHILAPPATTQ |
| Ga0307472_1022009821 | 3300032205 | Hardwood Forest Soil | MKYGVVLPIWQLSVRDAETLALRAEDLGLDGVFVPDHILAPPLT |
| Ga0307472_1022462152 | 3300032205 | Hardwood Forest Soil | MKYGVVLPIWQLTVAEAASLATRAEELGLDGVFVPDHILAKPATTQHYGGHWP |
| Ga0247829_100435354 | 3300033550 | Soil | MNYGVVLPIWQLTVAEAESLATRAEELGLDGVFVPDHILAKPATTQHGGDDPVLSR |
| Ga0247829_113723002 | 3300033550 | Soil | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHY |
| Ga0247830_103260791 | 3300033551 | Soil | MKYGVVLPIWQLTVAEAESLATKAEALGLDGVFVPDHILAKPATTQHYGGHWPD |
| Ga0364924_135269_446_574 | 3300033811 | Sediment | MNYGVVLPIWQLTIAEAESLTARAEALGLDGVFVPDHILAKPA |
| Ga0364932_0007865_3906_4010 | 3300034177 | Sediment | MGGEETRMNYGVVLPIWQLTIAEAEALTVRAEALG |
| ⦗Top⦘ |