


| Basic Information | |
|---|---|
| Family ID | F029487 |
| Family Type | Metagenome |
| Number of Sequences | 188 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKQLTEQQITDNWNDLRTIINNTFEGERLEKLNKMYDYFE |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 188 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 92.51 % |
| % of genes near scaffold ends (potentially truncated) | 97.34 % |
| % of genes from short scaffolds (< 2000 bps) | 81.38 % |
| Associated GOLD sequencing projects | 137 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (47.872 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (38.830 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.511 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.085 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 188 Family Scaffolds |
|---|---|---|
| PF14236 | DUF4338 | 13.83 |
| PF01555 | N6_N4_Mtase | 2.66 |
| PF02195 | ParBc | 2.13 |
| PF05118 | Asp_Arg_Hydrox | 2.13 |
| PF03851 | UvdE | 1.60 |
| PF13589 | HATPase_c_3 | 1.06 |
| PF00478 | IMPDH | 1.06 |
| PF02810 | SEC-C | 0.53 |
| PF00291 | PALP | 0.53 |
| PF00534 | Glycos_transf_1 | 0.53 |
| PF08239 | SH3_3 | 0.53 |
| PF00733 | Asn_synthase | 0.53 |
| PF01844 | HNH | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 188 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 2.66 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.66 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 2.66 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 2.13 |
| COG4294 | UV DNA damage repair endonuclease | Replication, recombination and repair [L] | 1.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.13 % |
| Unclassified | root | N/A | 47.87 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10108030 | Not Available | 896 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10010573 | All Organisms → Viruses → Predicted Viral | 4800 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10017904 | All Organisms → Viruses → Predicted Viral | 3769 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10042977 | Not Available | 2066 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10211007 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 591 | Open in IMG/M |
| 3300000193|SI47jul10_135mDRAFT_c1063841 | Not Available | 525 | Open in IMG/M |
| 3300000215|SI53jan11_120mDRAFT_c1062093 | Not Available | 515 | Open in IMG/M |
| 3300000216|SI53jan11_150mDRAFT_c1023936 | All Organisms → Viruses → Predicted Viral | 1363 | Open in IMG/M |
| 3300000949|BBAY94_10172552 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 584 | Open in IMG/M |
| 3300001450|JGI24006J15134_10051213 | Not Available | 1685 | Open in IMG/M |
| 3300001450|JGI24006J15134_10226817 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 551 | Open in IMG/M |
| 3300001450|JGI24006J15134_10231074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 543 | Open in IMG/M |
| 3300001589|JGI24005J15628_10017836 | All Organisms → Viruses → Predicted Viral | 3126 | Open in IMG/M |
| 3300002484|JGI25129J35166_1004770 | All Organisms → Viruses → Predicted Viral | 3872 | Open in IMG/M |
| 3300002519|JGI25130J35507_1018534 | Not Available | 1632 | Open in IMG/M |
| 3300003492|JGI26245J51145_1042143 | Not Available | 703 | Open in IMG/M |
| 3300006190|Ga0075446_10040559 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1472 | Open in IMG/M |
| 3300006735|Ga0098038_1030567 | All Organisms → Viruses → Predicted Viral | 2010 | Open in IMG/M |
| 3300006735|Ga0098038_1266223 | Not Available | 538 | Open in IMG/M |
| 3300006735|Ga0098038_1288572 | Not Available | 511 | Open in IMG/M |
| 3300006736|Ga0098033_1099167 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300006737|Ga0098037_1162448 | Not Available | 745 | Open in IMG/M |
| 3300006738|Ga0098035_1022044 | All Organisms → Viruses → Predicted Viral | 2471 | Open in IMG/M |
| 3300006750|Ga0098058_1009086 | All Organisms → Viruses → Predicted Viral | 2986 | Open in IMG/M |
| 3300006751|Ga0098040_1072952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1049 | Open in IMG/M |
| 3300006752|Ga0098048_1215473 | Not Available | 565 | Open in IMG/M |
| 3300006754|Ga0098044_1011815 | All Organisms → Viruses → Predicted Viral | 4073 | Open in IMG/M |
| 3300006789|Ga0098054_1062424 | All Organisms → Viruses → Predicted Viral | 1416 | Open in IMG/M |
| 3300006789|Ga0098054_1236637 | Not Available | 661 | Open in IMG/M |
| 3300006802|Ga0070749_10296866 | Not Available | 907 | Open in IMG/M |
| 3300006902|Ga0066372_10859528 | Not Available | 552 | Open in IMG/M |
| 3300006919|Ga0070746_10280777 | Not Available | 770 | Open in IMG/M |
| 3300006921|Ga0098060_1019686 | All Organisms → Viruses → Predicted Viral | 2103 | Open in IMG/M |
| 3300006923|Ga0098053_1095371 | Not Available | 600 | Open in IMG/M |
| 3300006924|Ga0098051_1021634 | All Organisms → Viruses → Predicted Viral | 1859 | Open in IMG/M |
| 3300006928|Ga0098041_1006642 | All Organisms → Viruses → Predicted Viral | 3923 | Open in IMG/M |
| 3300006928|Ga0098041_1051702 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| 3300006928|Ga0098041_1299039 | Not Available | 511 | Open in IMG/M |
| 3300006928|Ga0098041_1304942 | Not Available | 506 | Open in IMG/M |
| 3300006929|Ga0098036_1123074 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 795 | Open in IMG/M |
| 3300006929|Ga0098036_1238458 | Not Available | 550 | Open in IMG/M |
| 3300007236|Ga0075463_10255811 | Not Available | 563 | Open in IMG/M |
| 3300007346|Ga0070753_1097430 | Not Available | 1151 | Open in IMG/M |
| 3300007542|Ga0099846_1349350 | Not Available | 501 | Open in IMG/M |
| 3300007725|Ga0102951_1109374 | Not Available | 783 | Open in IMG/M |
| 3300008050|Ga0098052_1167983 | Not Available | 863 | Open in IMG/M |
| 3300009071|Ga0115566_10336073 | Not Available | 883 | Open in IMG/M |
| 3300009409|Ga0114993_10804001 | Not Available | 678 | Open in IMG/M |
| 3300009420|Ga0114994_10238428 | All Organisms → Viruses → Predicted Viral | 1219 | Open in IMG/M |
| 3300009423|Ga0115548_1123831 | Not Available | 828 | Open in IMG/M |
| 3300009435|Ga0115546_1031285 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300009442|Ga0115563_1230534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 697 | Open in IMG/M |
| 3300009481|Ga0114932_10247920 | Not Available | 1075 | Open in IMG/M |
| 3300009481|Ga0114932_10389003 | Not Available | 828 | Open in IMG/M |
| 3300009512|Ga0115003_10091878 | All Organisms → Viruses → Predicted Viral | 1874 | Open in IMG/M |
| 3300009601|Ga0114914_1048189 | Not Available | 691 | Open in IMG/M |
| 3300009703|Ga0114933_11094753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 502 | Open in IMG/M |
| 3300009786|Ga0114999_11207380 | Not Available | 539 | Open in IMG/M |
| 3300009790|Ga0115012_10487227 | Not Available | 961 | Open in IMG/M |
| 3300010148|Ga0098043_1067970 | All Organisms → Viruses → Predicted Viral | 1069 | Open in IMG/M |
| 3300010148|Ga0098043_1126458 | Not Available | 734 | Open in IMG/M |
| 3300010148|Ga0098043_1129269 | Not Available | 724 | Open in IMG/M |
| 3300010149|Ga0098049_1206874 | Not Available | 600 | Open in IMG/M |
| 3300010150|Ga0098056_1174780 | Not Available | 721 | Open in IMG/M |
| 3300010150|Ga0098056_1186450 | Not Available | 695 | Open in IMG/M |
| 3300010151|Ga0098061_1223037 | Not Available | 663 | Open in IMG/M |
| 3300010153|Ga0098059_1002277 | Not Available | 9145 | Open in IMG/M |
| 3300010155|Ga0098047_10033907 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
| 3300010883|Ga0133547_10251320 | Not Available | 3712 | Open in IMG/M |
| 3300010883|Ga0133547_10517538 | All Organisms → Viruses → Predicted Viral | 2406 | Open in IMG/M |
| 3300010934|Ga0137844_1153156 | Not Available | 1099 | Open in IMG/M |
| 3300011013|Ga0114934_10033006 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 2769 | Open in IMG/M |
| 3300011129|Ga0151672_151995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 520 | Open in IMG/M |
| 3300011258|Ga0151677_1010218 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300011258|Ga0151677_1020675 | Not Available | 1849 | Open in IMG/M |
| 3300012953|Ga0163179_10095122 | Not Available | 2143 | Open in IMG/M |
| 3300012953|Ga0163179_11530138 | Not Available | 601 | Open in IMG/M |
| 3300012954|Ga0163111_12524197 | Not Available | 523 | Open in IMG/M |
| 3300017697|Ga0180120_10105566 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300017706|Ga0181377_1074088 | Not Available | 615 | Open in IMG/M |
| 3300017709|Ga0181387_1002133 | All Organisms → Viruses → Predicted Viral | 4073 | Open in IMG/M |
| 3300017714|Ga0181412_1133546 | Not Available | 566 | Open in IMG/M |
| 3300017720|Ga0181383_1171414 | Not Available | 580 | Open in IMG/M |
| 3300017731|Ga0181416_1041736 | All Organisms → Viruses → Predicted Viral | 1079 | Open in IMG/M |
| 3300017733|Ga0181426_1033819 | All Organisms → Viruses → Predicted Viral | 1007 | Open in IMG/M |
| 3300017737|Ga0187218_1005204 | All Organisms → Viruses → Predicted Viral | 3653 | Open in IMG/M |
| 3300017738|Ga0181428_1002756 | All Organisms → Viruses → Predicted Viral | 4046 | Open in IMG/M |
| 3300017743|Ga0181402_1110929 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 705 | Open in IMG/M |
| 3300017757|Ga0181420_1017465 | All Organisms → Viruses → Predicted Viral | 2400 | Open in IMG/M |
| 3300017757|Ga0181420_1098442 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 902 | Open in IMG/M |
| 3300017758|Ga0181409_1013282 | All Organisms → Viruses → Predicted Viral | 2718 | Open in IMG/M |
| 3300017759|Ga0181414_1046970 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300017759|Ga0181414_1097842 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 772 | Open in IMG/M |
| 3300017763|Ga0181410_1045301 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1365 | Open in IMG/M |
| 3300017773|Ga0181386_1225659 | Not Available | 558 | Open in IMG/M |
| 3300017775|Ga0181432_1039558 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300017779|Ga0181395_1082780 | All Organisms → Viruses → Predicted Viral | 1036 | Open in IMG/M |
| 3300017962|Ga0181581_10688091 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 616 | Open in IMG/M |
| 3300017967|Ga0181590_11088798 | Not Available | 516 | Open in IMG/M |
| 3300018049|Ga0181572_10551342 | Not Available | 705 | Open in IMG/M |
| 3300018416|Ga0181553_10128499 | All Organisms → Viruses → Predicted Viral | 1531 | Open in IMG/M |
| 3300018416|Ga0181553_10544437 | Not Available | 617 | Open in IMG/M |
| 3300018420|Ga0181563_10123646 | All Organisms → Viruses → Predicted Viral | 1660 | Open in IMG/M |
| 3300019751|Ga0194029_1012553 | Not Available | 1231 | Open in IMG/M |
| 3300020055|Ga0181575_10516261 | Not Available | 639 | Open in IMG/M |
| 3300020165|Ga0206125_10097523 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300020312|Ga0211542_1033186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 1012 | Open in IMG/M |
| 3300020312|Ga0211542_1078835 | Not Available | 581 | Open in IMG/M |
| 3300020367|Ga0211703_10080067 | Not Available | 808 | Open in IMG/M |
| 3300020372|Ga0211683_10079607 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 1065 | Open in IMG/M |
| 3300020374|Ga0211477_10141068 | Not Available | 864 | Open in IMG/M |
| 3300020378|Ga0211527_10052876 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
| 3300020396|Ga0211687_10169515 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300020397|Ga0211583_10091858 | All Organisms → Viruses → Predicted Viral | 1147 | Open in IMG/M |
| 3300020401|Ga0211617_10031097 | All Organisms → Viruses → Predicted Viral | 2267 | Open in IMG/M |
| 3300020403|Ga0211532_10159861 | Not Available | 919 | Open in IMG/M |
| 3300020403|Ga0211532_10400417 | Not Available | 513 | Open in IMG/M |
| 3300020410|Ga0211699_10354629 | Not Available | 577 | Open in IMG/M |
| 3300020411|Ga0211587_10006733 | All Organisms → cellular organisms → Bacteria | 6547 | Open in IMG/M |
| 3300020411|Ga0211587_10063161 | All Organisms → Viruses → Predicted Viral | 1661 | Open in IMG/M |
| 3300020413|Ga0211516_10481754 | Not Available | 543 | Open in IMG/M |
| 3300020414|Ga0211523_10339600 | Not Available | 612 | Open in IMG/M |
| 3300020423|Ga0211525_10010939 | All Organisms → cellular organisms → Bacteria | 5451 | Open in IMG/M |
| 3300020436|Ga0211708_10359823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 595 | Open in IMG/M |
| 3300020439|Ga0211558_10009278 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5133 | Open in IMG/M |
| 3300020444|Ga0211578_10511387 | Not Available | 505 | Open in IMG/M |
| 3300020448|Ga0211638_10095230 | All Organisms → Viruses → Predicted Viral | 1324 | Open in IMG/M |
| 3300020451|Ga0211473_10670414 | Not Available | 521 | Open in IMG/M |
| 3300020452|Ga0211545_10547878 | Not Available | 519 | Open in IMG/M |
| 3300020452|Ga0211545_10583678 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 500 | Open in IMG/M |
| 3300020454|Ga0211548_10360423 | Not Available | 711 | Open in IMG/M |
| 3300020457|Ga0211643_10105253 | Not Available | 1392 | Open in IMG/M |
| 3300020470|Ga0211543_10155532 | All Organisms → Viruses → Predicted Viral | 1146 | Open in IMG/M |
| 3300020470|Ga0211543_10229543 | Not Available | 913 | Open in IMG/M |
| 3300020471|Ga0211614_10326200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 674 | Open in IMG/M |
| 3300020474|Ga0211547_10208028 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
| 3300020477|Ga0211585_10113264 | Not Available | 1831 | Open in IMG/M |
| 3300021365|Ga0206123_10267133 | Not Available | 738 | Open in IMG/M |
| 3300021368|Ga0213860_10121163 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300021957|Ga0222717_10187080 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
| 3300021964|Ga0222719_10203358 | All Organisms → Viruses → Predicted Viral | 1352 | Open in IMG/M |
| 3300022149|Ga0196907_104970 | Not Available | 686 | Open in IMG/M |
| 3300022164|Ga0212022_1026039 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED198 | 889 | Open in IMG/M |
| 3300025072|Ga0208920_1020420 | Not Available | 1430 | Open in IMG/M |
| 3300025096|Ga0208011_1043199 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300025096|Ga0208011_1129887 | Not Available | 515 | Open in IMG/M |
| 3300025099|Ga0208669_1006532 | All Organisms → Viruses → Predicted Viral | 3484 | Open in IMG/M |
| 3300025099|Ga0208669_1017871 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
| 3300025102|Ga0208666_1034081 | All Organisms → Viruses → Predicted Viral | 1520 | Open in IMG/M |
| 3300025108|Ga0208793_1082808 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 923 | Open in IMG/M |
| 3300025108|Ga0208793_1168457 | Not Available | 567 | Open in IMG/M |
| 3300025112|Ga0209349_1010825 | All Organisms → Viruses → Predicted Viral | 3540 | Open in IMG/M |
| 3300025112|Ga0209349_1027938 | All Organisms → Viruses → Predicted Viral | 1913 | Open in IMG/M |
| 3300025114|Ga0208433_1094048 | Not Available | 749 | Open in IMG/M |
| 3300025118|Ga0208790_1018975 | All Organisms → Viruses → Predicted Viral | 2371 | Open in IMG/M |
| 3300025118|Ga0208790_1060462 | All Organisms → Viruses → Predicted Viral | 1169 | Open in IMG/M |
| 3300025127|Ga0209348_1031297 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
| 3300025127|Ga0209348_1078211 | Not Available | 1060 | Open in IMG/M |
| 3300025128|Ga0208919_1041638 | Not Available | 1610 | Open in IMG/M |
| 3300025132|Ga0209232_1224362 | Not Available | 559 | Open in IMG/M |
| 3300025132|Ga0209232_1256632 | Not Available | 501 | Open in IMG/M |
| 3300025133|Ga0208299_1036508 | All Organisms → Viruses → Predicted Viral | 1988 | Open in IMG/M |
| 3300025137|Ga0209336_10026684 | All Organisms → Viruses → Predicted Viral | 1983 | Open in IMG/M |
| 3300025138|Ga0209634_1284835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 577 | Open in IMG/M |
| 3300025151|Ga0209645_1014759 | All Organisms → Viruses → Predicted Viral | 3062 | Open in IMG/M |
| 3300025151|Ga0209645_1075017 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
| 3300025543|Ga0208303_1121205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239 | 526 | Open in IMG/M |
| 3300025626|Ga0209716_1040883 | All Organisms → Viruses → Predicted Viral | 1613 | Open in IMG/M |
| 3300025647|Ga0208160_1017330 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300025674|Ga0208162_1157055 | Not Available | 617 | Open in IMG/M |
| 3300025704|Ga0209602_1170877 | Not Available | 675 | Open in IMG/M |
| 3300025869|Ga0209308_10224031 | Not Available | 820 | Open in IMG/M |
| 3300025874|Ga0209533_1337021 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 566 | Open in IMG/M |
| 3300025890|Ga0209631_10056976 | All Organisms → Viruses → Predicted Viral | 2491 | Open in IMG/M |
| 3300025892|Ga0209630_10243142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → unclassified Woeseia → Woeseia sp. | 849 | Open in IMG/M |
| 3300026183|Ga0209932_1045010 | Not Available | 1076 | Open in IMG/M |
| 3300027801|Ga0209091_10101630 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300027838|Ga0209089_10037513 | All Organisms → Viruses → Predicted Viral | 3214 | Open in IMG/M |
| 3300027844|Ga0209501_10338101 | Not Available | 911 | Open in IMG/M |
| 3300028197|Ga0257110_1170503 | Not Available | 862 | Open in IMG/M |
| 3300029319|Ga0183748_1032129 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300029319|Ga0183748_1034211 | All Organisms → Viruses → Predicted Viral | 1600 | Open in IMG/M |
| 3300029448|Ga0183755_1028765 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300031519|Ga0307488_10272039 | Not Available | 1105 | Open in IMG/M |
| 3300031606|Ga0302119_10154782 | Not Available | 909 | Open in IMG/M |
| 3300032006|Ga0310344_11514136 | Not Available | 547 | Open in IMG/M |
| 3300032073|Ga0315315_11500295 | Not Available | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 38.83% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 19.15% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 9.04% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.32% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 3.72% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.72% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 2.66% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.13% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.13% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.60% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.60% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.06% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.06% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.06% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.53% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.53% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.53% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.53% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.53% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.53% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.53% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.53% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.53% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.53% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.53% |
| Subsea Pool Microbial Mat | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat | 0.53% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000193 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 135m | Environmental | Open in IMG/M |
| 3300000215 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 120m | Environmental | Open in IMG/M |
| 3300000216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 150m | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002519 | Marine viral communities from the Pacific Ocean - ETNP_2_300 | Environmental | Open in IMG/M |
| 3300003492 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_200m_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300010934 | Microbial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3 | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020372 | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020396 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020423 | Marine microbial communities from Tara Oceans - TARA_B100000315 (ERX556027-ERR599062) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020444 | Marine microbial communities from Tara Oceans - TARA_B100001245 (ERX556114-ERR598980) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020454 | Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022149 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025874 | Pelagic Microbial community sample from North Sea - COGITO 998_met_04 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028197 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_101080302 | 3300000115 | Marine | MKELTPEQIEHNWKKLRDIIQNTFDGERLESMNKMYDYF |
| DelMOSpr2010_100105736 | 3300000116 | Marine | MKQLTEQQITNNWTDLRTIINNTFSGDRLEKLNKMYD |
| DelMOWin2010_100179041 | 3300000117 | Marine | MKQLTEQQITDNWTDLRTIINNTFTGDRLEKLNKMYDD |
| DelMOWin2010_100429771 | 3300000117 | Marine | MKELTPEQIEHNWKKLRDIIQNTFDGERLESMNKMYDYFEE |
| DelMOWin2010_102110071 | 3300000117 | Marine | MKELTAEQIQGNWNKLRGLITDTFEGERLENLNKMYDY |
| SI47jul10_135mDRAFT_10638412 | 3300000193 | Marine | MKQLNPEQIQENWKQLRDLITNTFSDERLENLNTMYDYFEDRMCLAPASGK |
| SI53jan11_120mDRAFT_10620932 | 3300000215 | Marine | MKQLTPEQIQQNWVKLRELLNNTFSGERLEKLNQM |
| SI53jan11_150mDRAFT_10239361 | 3300000216 | Marine | MKQLNPEQIQENWKQLRDLITNTFSDERLENLNTMYDYFEDRMCLAPASGKEHYHNAMA |
| BBAY94_101725522 | 3300000949 | Macroalgal Surface | MKELTAEQIQSNWNKLRGLITDTFEGERLENLNKM |
| JGI24006J15134_100512131 | 3300001450 | Marine | MKELTAEQIQENWQQLRNIITETFEGERLEKLNEMYDYFEDRMCIAPA |
| JGI24006J15134_102268172 | 3300001450 | Marine | MKQLTEKQITDNWXDLRTIINNTFTGDRLEKLNKMYDDFEDRMIVAP |
| JGI24006J15134_102310742 | 3300001450 | Marine | MKQLTEQQITDNWTDLRTIINNTFTGDRLEKLNKMYDDFEDRMI |
| JGI24005J15628_100178361 | 3300001589 | Marine | MKQLTEKQITDNWADLRTIINNTFTGDRLEKLNKMYDDFEDRMI |
| JGI25129J35166_10047704 | 3300002484 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYDYFEERMCMA |
| JGI25130J35507_10185343 | 3300002519 | Marine | MKELTPEQIENNWHDLIDLVNTTFEGERLDKLIEMYDYFE |
| JGI26245J51145_10421431 | 3300003492 | Marine | MKQLTPEQIQQNWVKLRELLNNTFSGERLEKLNQMYDYFEDR |
| Ga0075446_100405591 | 3300006190 | Marine | MKELTSEQIQKNWEQLRNLITNTFEGERLEKLNTMYDYFEDRMCLAP |
| Ga0098038_10305673 | 3300006735 | Marine | MTLTEQQITDNYKELRKIINDTFSGLRLDKLNHMYDDL |
| Ga0098038_12662231 | 3300006735 | Marine | MKQLTEQQITQNWTDLRTIVNNTFEGVRLEKLNKMYDYFEDRMVVAPASGRAH |
| Ga0098038_12885721 | 3300006735 | Marine | MKQLTAEQIAKNWEQLRSLINNTFEGERKEKLNKMYDHFE |
| Ga0098033_10991673 | 3300006736 | Marine | MKQLNPEQIQSNWNNLRQIISDTFDGERLVNLNKMYDYFEDRMCMAP |
| Ga0098037_11624483 | 3300006737 | Marine | MITLTEKEILSNWEKLRGIITDTFEGERLENLNKM |
| Ga0098035_10220446 | 3300006738 | Marine | MKILNEQQIQSNWNNLRQIISDTFDGERLVNLNKMYDYFE |
| Ga0098058_10090866 | 3300006750 | Marine | MKILNEQQIQSNWNNLRQIISDTFDGERLVNLNKMYDYFEDRMCMAP |
| Ga0098040_10729522 | 3300006751 | Marine | MKQLTPEQIQENWIKLRELINNTFSGERLEKLNQMYDYF |
| Ga0098048_12154732 | 3300006752 | Marine | MKQLTEQQITQNWTDLRTIVNNTFEGVRLEKLNKMYDYFEDRMVVAPASG |
| Ga0098044_10118151 | 3300006754 | Marine | MKELTPEQIQENWNRLRGIITDTFEGERLENLNKMYDY |
| Ga0098054_10624241 | 3300006789 | Marine | MKQLTPEQIQENWIKLRELINNTFSGERLEKLNQMYDYFEDRMVMAPASGKEHY |
| Ga0098054_12366371 | 3300006789 | Marine | MKQLTPEQIQQNWVKLRELINNTFSGERLEKLNQMYDYFEDRMVMAPASGKEHY |
| Ga0070749_102968661 | 3300006802 | Aqueous | MKQLAEQQIIDNWKELRGIINNTFSGERLEKLNKM |
| Ga0066372_108595281 | 3300006902 | Marine | MKQLTAEQLEANWYKLRDLITESFEGERLEKLNEMY |
| Ga0070746_102807771 | 3300006919 | Aqueous | MKQLAEQQIIDNWKELRGIINNTFSGERLEKLNKMYDDLEDRMVVA |
| Ga0098060_10196863 | 3300006921 | Marine | MKQLTAEQIQENWYQLRNLITNTFEGDRLEKLNKM |
| Ga0098053_10953712 | 3300006923 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYDYFE |
| Ga0098051_10216343 | 3300006924 | Marine | MKELTPEQIQQNWERLRGIINDTFKDDRLEKLNEM |
| Ga0098041_10066428 | 3300006928 | Marine | MKQLTAEQIAKNWEQLRSLINNTFEGERKEKLNKM |
| Ga0098041_10517021 | 3300006928 | Marine | MKELTPEQIQQNWERLRGIVNDTFKDDRLEKLNEMYDY |
| Ga0098041_12990392 | 3300006928 | Marine | MKQLTEQQITDNWTDLRTIINNTFTGDRLEKLNKMYDDFEDRM |
| Ga0098041_13049421 | 3300006928 | Marine | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYDY |
| Ga0098036_11230741 | 3300006929 | Marine | MKQLTEQQIQDNWLELRQIINDTFEGDRLTKLNKLYDDFEDRMVV |
| Ga0098036_12384582 | 3300006929 | Marine | MKELTPEQIQENWNQLRQLINDTFKDERLDKLNHMYDYFETRMCVAPA |
| Ga0075463_102558112 | 3300007236 | Aqueous | MKQLTEQQITGNWKELRTIINNTFSGERLEKLNKMYDDLEDRMV |
| Ga0070753_10974301 | 3300007346 | Aqueous | MTQLTETQITDNYNQLRKIINDTFSGERLERLNKMYD |
| Ga0099846_13493502 | 3300007542 | Aqueous | MKQLTEQQIMDNWNELRTIINNTFSGERLEKLNKMYDYFED |
| Ga0102951_11093741 | 3300007725 | Water | MKQLNEQQIQDNWLELRGIINNTFEGERLEKLNKMYD |
| Ga0098052_11679831 | 3300008050 | Marine | MKELTPEQIQENWDKLIELVNDTFEGERLEKLLEMYDYFEERMC |
| Ga0115566_103360732 | 3300009071 | Pelagic Marine | MKELTPEQIEHNWKKLRDIIQNTFDGERLESMNKMYDYFEERMCLA |
| Ga0114993_108040012 | 3300009409 | Marine | MTKELTPEQIQENWKQLIQLVEDNFTGERLEKLLK |
| Ga0114994_102384282 | 3300009420 | Marine | MKQLTEQQITSNWTDLRTIINNTFTGDRLEKLNKM |
| Ga0115548_11238311 | 3300009423 | Pelagic Marine | MKELTPEQIEHNWKKLRDIIQNTFDGERLESMDKMYDYFEERMCLAPA |
| Ga0115546_10312853 | 3300009435 | Pelagic Marine | MKELTPEQIQENWSKLRSIITDTFVGERLENLNKMYDYF* |
| Ga0115563_12305341 | 3300009442 | Pelagic Marine | MKQLTEKQITSNWTDLRTIINNTFTGDRLEKLNKMYDDLEDRMVV |
| Ga0114932_102479201 | 3300009481 | Deep Subsurface | MKELKAEQIQENWVKLRDLISETFDGERLEKLNKMYD |
| Ga0114932_103890031 | 3300009481 | Deep Subsurface | MKELTPEQIENNWHDLIDLVNTTFEGERLDKLIKMYDYFEERMCLAPASGKEHYHNAH |
| Ga0115003_100918781 | 3300009512 | Marine | MKQLKPEQIQENWNKLRELITNTFEGERLEKLNTMYDYFEDRMCLAPASGKEHF |
| Ga0114914_10481892 | 3300009601 | Deep Ocean | MKQLTEQKIQSNWTDLRTIINNTFTGDRLEKLNKMYDDFEDRMVVAPASGK |
| Ga0114933_110947531 | 3300009703 | Deep Subsurface | MKELSIEQIEHNWKKLRDIIENTFDGDRLINLNKMYDYFED |
| Ga0114999_112073801 | 3300009786 | Marine | MKQLTAEQIQENWYQLRNFITNTFEGDRLEKLNKMYDH |
| Ga0115012_104872272 | 3300009790 | Marine | MKQLTAEQIQENWYQLRNLITNTFEGDRLEKLNKMYDHFEDRMC |
| Ga0098043_10679703 | 3300010148 | Marine | MKELTPEQIQQNWERLRGIISDTFEGERLEKFNEMYD |
| Ga0098043_11264581 | 3300010148 | Marine | MKQLTEKQITQNWTDLRTIINNTFEGERLEKLNKMYD |
| Ga0098043_11292691 | 3300010148 | Marine | MKQLSPEQIQTNWQDLRQLINDTFSGERLENLNKM |
| Ga0098049_12068742 | 3300010149 | Marine | MTLTEQQITDNYKELRKIINDTFSGLRLDKLNHMYDDLEDRMVVAP |
| Ga0098056_11747801 | 3300010150 | Marine | MKELNPEQIQENWNKLIHIINDNFSGERLEKLLKMYDYFEERMCLAP |
| Ga0098056_11864502 | 3300010150 | Marine | MKELTPEQIQENWNKLIGLVNDTFEGERLEKLLEM |
| Ga0098061_12230371 | 3300010151 | Marine | MKELTPEQIQENWDKLIELVNDTFEGERLEKLLEMYDYFEE |
| Ga0098059_100227721 | 3300010153 | Marine | MKQLSPEQIQTNWQDLRQLINDTFSGERLENLNKMYDYFED |
| Ga0098047_100339072 | 3300010155 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYHYFE |
| Ga0133547_102513201 | 3300010883 | Marine | MTKELTPEQIQENWKQLIQLVEDNFTGERLEKLLKMYD |
| Ga0133547_105175381 | 3300010883 | Marine | MKQLTAEQIQGNWYKLRDFITESFEGERLEKLNEMY |
| Ga0137844_11531561 | 3300010934 | Subsea Pool Microbial Mat | MKQLTAEQXQENWYKLRDLITETFDGSRLEQLNVMYDYFEDRMCMAPASG |
| Ga0114934_100330061 | 3300011013 | Deep Subsurface | MKELTPEQIHKNWEQLRNLITNTFEGERLEKLNTMYDYF |
| Ga0151672_1519952 | 3300011129 | Marine | MKELTPNQIQENWSKLRGIMTDTYNGKKLEKLNDMY |
| Ga0151677_10102181 | 3300011258 | Marine | MKQLTEQQITDNWTDLRTIINNTFSGDRLEKLNKMYDDFEDRMVV |
| Ga0151677_10206753 | 3300011258 | Marine | MKELTPKQIQENWGKLRQIINDNFSGERLEKLDEDV* |
| Ga0163179_100951223 | 3300012953 | Seawater | MTKELTPELIQHNWNNLIRLIEVKFTGERLDKLLH |
| Ga0163179_115301382 | 3300012953 | Seawater | MTLTEQQITDNYKDLRTIINNTFTGDRLEKLNKMYDDL |
| Ga0163111_125241971 | 3300012954 | Surface Seawater | MITLTEKEILSNWEKLRSIITDTFEGERLEKLNTMYDYFEERMVLAPASGKEH |
| Ga0180120_101055662 | 3300017697 | Freshwater To Marine Saline Gradient | MKQLTEQQITDNWTDLRTIINNTFMGDRLEKLNKMYD |
| Ga0181377_10740882 | 3300017706 | Marine | MKELTPEQIQQNWERLRGIVNDTFKDDRLEKLNEMYDYFE |
| Ga0181387_10021331 | 3300017709 | Seawater | MKQLTEQQITDNWKDLRTIINNTFSGDRLEKLNKMYDDFEDRMV |
| Ga0181412_11335461 | 3300017714 | Seawater | MKQLTEQQITQNWTDLRTIVNNTFEGVRLEKLNKMYDYFEDRMVVAPAS |
| Ga0181383_11714143 | 3300017720 | Seawater | VKELTPEQIENNWHDLIDLINTTFEGERLDKLIKMYDYFEERM |
| Ga0181416_10417362 | 3300017731 | Seawater | MKELTAEQIQGNWNKLRGLITDTFEGERLENLNKMYDYFE |
| Ga0181426_10338191 | 3300017733 | Seawater | MKQLTEQQIQDNYLKLRSIINDTFTGERLEKLNTMYDHFENRMVLVRT |
| Ga0187218_10052044 | 3300017737 | Seawater | MKQLTEQQITDNWKDLRTIINNTFSGDRLEKLNKMYD |
| Ga0181428_10027564 | 3300017738 | Seawater | MKQLTEQQITDNWKDLRTIINNTFSGDRLEKLNKMYDDFEDRM |
| Ga0181402_11109291 | 3300017743 | Seawater | MKELTAEQIQGNWNKLRGLITDTFEGERLENLNKMYDYFEER |
| Ga0181420_10174653 | 3300017757 | Seawater | MKELTAEQIQGNWNKLRGLITDTFEGERLENLNKMYDYFEERMCIAPASGK |
| Ga0181420_10984422 | 3300017757 | Seawater | MKKLTEQQITDNWKDLRTIINNTFSGDRLEKLNKMYDDFE |
| Ga0181409_10132824 | 3300017758 | Seawater | MKELTSEQIEHNWKKLRDIIQNTFDGERLESMNKMYDYFE |
| Ga0181414_10469702 | 3300017759 | Seawater | MKQLTEQQITQNWTDLRTIVNNTFEGVRLEKLNKMYDYFEDRMVVAPASGR |
| Ga0181414_10978421 | 3300017759 | Seawater | MKQLTEKQITSNWTDLRTIINNTFTGDRLEKLNKM |
| Ga0181410_10453011 | 3300017763 | Seawater | MKELTPEQIQKNWEQLRNLVSNTFEGERLEILNKMYDYFEDR |
| Ga0181386_12256591 | 3300017773 | Seawater | MKQLTEKQITSNWTDLRTIINNTFTGDRLEKLNKMYD |
| Ga0181432_10395581 | 3300017775 | Seawater | MKELTPEQIQENWIKLLNLIKDTFEGERLEKLLEMYDYFEERMCL |
| Ga0181395_10827801 | 3300017779 | Seawater | MKQLTEKQITSNWTDLRTIINNTFSGDRLERLNKM |
| Ga0181581_106880911 | 3300017962 | Salt Marsh | MKQLTEQQITGNWEKLRTIINNTFSGDRLERLNKMYDDLEDRM |
| Ga0181590_110887981 | 3300017967 | Salt Marsh | MKELAPEQIEHNWKKLIKIINDNFSGERLEKLLTMYDYFEERMCLAPASGK |
| Ga0181572_105513422 | 3300018049 | Salt Marsh | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYDYFEDR |
| Ga0181553_101284992 | 3300018416 | Salt Marsh | MTLTEQQITDNYKELRKIINDTFSDLRLDKLNHMYDDLEDRMV |
| Ga0181553_105444371 | 3300018416 | Salt Marsh | MTQLTETQITDNYKTLRKIINDTFSGERLERLNKMYDD |
| Ga0181563_101236463 | 3300018420 | Salt Marsh | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMY |
| Ga0194029_10125531 | 3300019751 | Freshwater | MTQLTETQITDNYKTLRKIINDTFSGERLERLNKM |
| Ga0181575_105162611 | 3300020055 | Salt Marsh | MKQLTEQQITGNWKELRTIINNTFSGERLERLNKMYDDLEDRMVV |
| Ga0206125_100975231 | 3300020165 | Seawater | MKELKPEQIQENWNQLRQLITNTFEGERLEKLNTMYDYFEDRMC |
| Ga0211542_10331861 | 3300020312 | Marine | MKQLTAEQIQENWKALRNIITMNFSGERLEKLNKMYDYFEDR |
| Ga0211542_10383931 | 3300020312 | Marine | MKELTPEQIQDNWSKLRSIITDNFSGERLERMNEMYDYFEERMCL |
| Ga0211542_10788351 | 3300020312 | Marine | MKQLTEQQITDNWNDLRTIINNTFEGERLEKLNKMYDYFE |
| Ga0211703_100800671 | 3300020367 | Marine | MTLTEQQIQDNYKELRKIINDTFSGERLEKLNKMYD |
| Ga0211683_100796072 | 3300020372 | Marine | MKELTSEQIQKNWEQLRNLITNTFEGERLEKLNTM |
| Ga0211477_101410682 | 3300020374 | Marine | MKELTSEQIQENWEKLRSVINDTFEDERLEKLNVMYDYFEDRMVI |
| Ga0211527_100528761 | 3300020378 | Marine | MTQLTEQQITDNYKTLRKIINDTFSGLRLDKLNHMYDDLEDRMVVAPAS |
| Ga0211687_101695154 | 3300020396 | Marine | MKELTAEQIQENWQQLRNIITDTFEGERLEKLNKMY |
| Ga0211583_100918582 | 3300020397 | Marine | MKELTPEQIQHNWSNLRQLIDINFSGERLEKLNTMY |
| Ga0211617_100310974 | 3300020401 | Marine | MTLTEQQIQDNYKELRKIINDTFSGLRLDKLNYMYDDL |
| Ga0211532_101598611 | 3300020403 | Marine | MKELTPEQIQHNWSNLRQLIDVNFSGERLEKLNTMYD |
| Ga0211532_104004171 | 3300020403 | Marine | MKELTPEQIQQNWERLRGIISDTFEDERLEKLNEMYDYFEDRMV |
| Ga0211699_103546291 | 3300020410 | Marine | MKQLNEKQIQDNWLELRQIIDDTFSGERLAKLNKMYDELEDRMVVAPASAK |
| Ga0211587_100067331 | 3300020411 | Marine | MKQLTPEQIENNWHDLIDLINTTFEGERLDKLIKMYDYFEERMCLAP |
| Ga0211587_100631614 | 3300020411 | Marine | MLKQLTPEQIENNWHDLIDLINTTFEGERLDKLIKMYDYFEERMCLAP |
| Ga0211516_104817542 | 3300020413 | Marine | MTLTEQQITDNYKDLRTIINNTFSGDRLEKLNKMYDD |
| Ga0211523_103396002 | 3300020414 | Marine | MKELSPEQIQENWGKLIQLINDNFSGERLEKLLKMYDYFEERMCLA |
| Ga0211525_100109396 | 3300020423 | Marine | MKQLTPEQIQQNWVKLRELLNNTFSGERLEKLNQMYDYFEDRMCMAPASGKKH |
| Ga0211708_103598233 | 3300020436 | Marine | MKELSIKQIEHNWKKLRDTIENTFDGDRLINLNKMYDYFEDRMCMAP |
| Ga0211558_100092781 | 3300020439 | Marine | MKQLTEQQIIDNWKELRGIINDTFSGERLEKLNKMYDF |
| Ga0211578_105113871 | 3300020444 | Marine | MKQLKPEQIKNNWDKLRELITNTFEGERLEKLNKMYDY |
| Ga0211638_100952301 | 3300020448 | Marine | MTLTEQQIQDNYKELRKIINDTFSGLRLDKLNYMYDDLEDRMVV |
| Ga0211473_106704142 | 3300020451 | Marine | MKQLTEQQITSNWDKLRGIINDTFSGERLEKLNKMYDYFEDRMVLA |
| Ga0211545_105478782 | 3300020452 | Marine | MKELTPEQIQKNWEQLRNLITNTFEGERLEKLNTMYD |
| Ga0211545_105836782 | 3300020452 | Marine | MKELTAEQIQENWQKLRNLITNTFEGDRLEKLNTMYDYFEDRMCLAPASGTE |
| Ga0211548_103604232 | 3300020454 | Marine | MTLTEQQIQDNYKDLRTIINNTFSGDRLEKLNKMYDDLE |
| Ga0211643_101052532 | 3300020457 | Marine | MITLTEKEILSNWEKLRGIITDTFEGERLEKLNTMYDYFEERMVLAP |
| Ga0211543_101555322 | 3300020470 | Marine | MKQLNEQQIQDNWKELRGIINDTFSGDRLEKLNKMY |
| Ga0211543_102295431 | 3300020470 | Marine | MTQLTEQQITDNYKELRKIINDTFSDLRLDKLNHMYDDLEDR |
| Ga0211614_103262001 | 3300020471 | Marine | MKELTPEQIQDNWSKLRSIITDNFSGERLERMNEMYDYFEERMC |
| Ga0211547_102080282 | 3300020474 | Marine | MKELKPEQIQENWNQLRQLITNTFEGERLEKLNTMYDYFEDRMCLAPA |
| Ga0211585_101132641 | 3300020477 | Marine | MKQLTAEQIQENWYKLRDLITETFDGSRLEQLNVMYDYFEDRMCMAP |
| Ga0206123_102671331 | 3300021365 | Seawater | MKELTPQQIEQNWNKLRNIIQDTFEGERLDNLNKMYDHFE |
| Ga0213860_101211632 | 3300021368 | Seawater | MTLTEQQITDNYKELRKIINDTFSGLRLDKLNHMYDDLEDRMVVAPA |
| Ga0222717_101870801 | 3300021957 | Estuarine Water | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYDYFEDRMVV |
| Ga0222719_102033582 | 3300021964 | Estuarine Water | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYDYFEDRMVVAPA |
| Ga0196907_1049701 | 3300022149 | Aqueous | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYNYFEDRMVVAPASG |
| Ga0212022_10260392 | 3300022164 | Aqueous | MKQLTEQQITNNWTDLRTIINNTFSGDRLEKLNKMYDE |
| Ga0208920_10204202 | 3300025072 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYHYFEE |
| Ga0208011_10431991 | 3300025096 | Marine | MKQLTPEQIQENWIKLRELINNTFSGERLEKLNQMYDYFEDRM |
| Ga0208011_11298873 | 3300025096 | Marine | MKELTPEQIENNWHELIDLINTTFEGERLDKLIKMYDYFEERMCMAPASGKEH |
| Ga0208669_10065321 | 3300025099 | Marine | MKELNPEQIQENWNKLIQIINDNFSGERLEKLLNM |
| Ga0208669_10178713 | 3300025099 | Marine | MKQLTAEQIQENWYQLRNLITNTFEGDRLEKLNKMYDHFED |
| Ga0208666_10340813 | 3300025102 | Marine | MKQLTEKQITDNWNELRTIVNNTFSGDRLEKLNKMYDYFEDRMVM |
| Ga0208793_10828082 | 3300025108 | Marine | MKQLTEQQIQDNWLELRQIINDTFEGDRLTKLNKLYDDFEDRM |
| Ga0208793_11684571 | 3300025108 | Marine | MKELTPEQIQENWNQLRQLINDTFKDERLEKLNHMYDYFET |
| Ga0209349_10108254 | 3300025112 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYDYFEER |
| Ga0209349_10279381 | 3300025112 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYHYFEER |
| Ga0208433_10940482 | 3300025114 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYHYF |
| Ga0208790_10189751 | 3300025118 | Marine | MKELTPEQIQENWSRLRGMITDTFEGERLENLNKMYDYFEERMCLA |
| Ga0208790_10604621 | 3300025118 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMY |
| Ga0209348_10312974 | 3300025127 | Marine | MITLTEKEILSNWEKLRGIITDTFEGERLEKLNTMYD |
| Ga0209348_10782111 | 3300025127 | Marine | MTLTEQQIQDNYNELRKIINDTFSGLRLDKLNYMYDDLEDRMVLAP |
| Ga0208919_10416381 | 3300025128 | Marine | MKQLTAEQIQENWYQLRNLITNTFEGDRLERLNKMYDHFEDRMC |
| Ga0209232_12243622 | 3300025132 | Marine | MKELKAEQIQENWVKLRDLISETFDGERLEKLNKMYDYF |
| Ga0209232_12566322 | 3300025132 | Marine | MKQLTAEQIQENWYQLRNLITNTFEGERLEKLNKMYDHFEDRMCM |
| Ga0208299_10365083 | 3300025133 | Marine | MKELTPEQIQENWNKLIQIINDNFSGERLEKLLEMYDYFEE |
| Ga0209336_100266843 | 3300025137 | Marine | MKELKPEQIQKNWEQLRNLITNTFEGERLEKLNTMYDYFE |
| Ga0209634_12848352 | 3300025138 | Marine | MKQLTEQQITDNWTDLRTIINNTFTGDRLEKLNKMYDDFEDRMIVAP |
| Ga0209645_10147594 | 3300025151 | Marine | MKQLTEQQITDNWKELRTIINNTFSGDRLEKLNKLYDDF |
| Ga0209645_10750172 | 3300025151 | Marine | MKQLNEQQIQDNWKELRGIINDTFSGDRLEKLNKM |
| Ga0208303_11212052 | 3300025543 | Aqueous | MQLTEQQIQDNWNKLRTIINDTFTGERLVNLNKMYDDFEDRMCMAPAS |
| Ga0209716_10408831 | 3300025626 | Pelagic Marine | MKQLNEKQIQQNWTDLRTIINNTFEGERLEKLNKMYDYFEDRMVMAPASGR |
| Ga0208160_10173303 | 3300025647 | Aqueous | MKQLTEKQITDNWNELRTIINNTFSGERLEKLNKMYDYFE |
| Ga0208162_11570552 | 3300025674 | Aqueous | MKQLTEQQLKDNYGKLRNVVSETFSGERLEKLNKLYDDFEDRIVVAPASGKE |
| Ga0209602_11708773 | 3300025704 | Pelagic Marine | MKELTPQQIEQNWNKLRNIIQDTFEGERLDNLNKMYD |
| Ga0209308_102240312 | 3300025869 | Pelagic Marine | MKQLTEQQITQNWTDLRTIINNTFEGERLEKLNKMYDYFEDRMVLAP |
| Ga0209533_13370212 | 3300025874 | Pelagic Marine | MKQLTEQQITDNWTDLRTIINNTFSGDRLERLNKMY |
| Ga0209631_100569764 | 3300025890 | Pelagic Marine | MKELTPQQIEQNWNKLRNIIQDTFEGERLDNLNKMYDH |
| Ga0209630_102431422 | 3300025892 | Pelagic Marine | MKELTPEQIQENWSKLRSIITDTFVGERLENLNKMFF |
| Ga0209932_10450102 | 3300026183 | Pond Water | MKQLTEQQITQNWTDLRTIINNTFEGVRLEKLNKMYDYFEDRMVV |
| Ga0209091_101016301 | 3300027801 | Marine | MKELTPEQIQKNWEQLRNLITNTFEGERLEKLNTMYDYFEDRMCLAPASGKEHFH |
| Ga0209089_100375137 | 3300027838 | Marine | MKQLTAEQIQENWYKLRDFITESFEGERLEKLNEMYDYFED |
| Ga0209501_103381012 | 3300027844 | Marine | MKQLTPEQIQQNWIKLRELLNITFSGERLEKLNQMYDYFE |
| Ga0257110_11705032 | 3300028197 | Marine | MKQLNEKQIQQNWTDLRTIINNTFEGDRLEKLNKMYDYFEDRMVMAPASG |
| Ga0183748_10321293 | 3300029319 | Marine | MTQLTEQQITDNYKTLRKIINDTFSGLRLDKLNHMYDDLED |
| Ga0183748_10342111 | 3300029319 | Marine | MKQLTEQQIQDNWLKLRGIINDTFEGERLEKLNKMYDYFEDRMVV |
| Ga0183755_10287651 | 3300029448 | Marine | MKELTPEQIQKNWEQLRNLITNTFEGERLEKLNTMYDYFEDRM |
| Ga0307488_102720391 | 3300031519 | Sackhole Brine | MKELTAEQIQENWQQLRNIITETFEGERLEKLNEMYDYFEDRMCIAPASGTEY |
| Ga0302119_101547822 | 3300031606 | Marine | MKELKPEQIQENWNKLRELITNTFEGERLEKLNKMYDYFEDRM |
| Ga0310344_115141361 | 3300032006 | Seawater | MKQLTAEQIQENWYQLRNLITNTFDGSRLEQLNVMYDYFEDRMCMA |
| Ga0315315_115002951 | 3300032073 | Seawater | MKQLTEQQITSNWSDLRTIINNTFSGERLEKLNKMYDYFEDRM |
| ⦗Top⦘ |