


| Basic Information | |
|---|---|
| Family ID | F029191 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 189 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKYLVPPIVIPVLLFIGVVAYGVLRPPIVVGHPPVPAANSQPR |
| Number of Associated Samples | 142 |
| Number of Associated Scaffolds | 189 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.31 % |
| % of genes near scaffold ends (potentially truncated) | 41.27 % |
| % of genes from short scaffolds (< 2000 bps) | 79.89 % |
| Associated GOLD sequencing projects | 134 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.720 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.339 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.751 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.439 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 21.13% β-sheet: 0.00% Coil/Unstructured: 78.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 189 Family Scaffolds |
|---|---|---|
| PF01841 | Transglut_core | 8.47 |
| PF00313 | CSD | 2.12 |
| PF00108 | Thiolase_N | 1.59 |
| PF00118 | Cpn60_TCP1 | 1.59 |
| PF09849 | DUF2076 | 1.59 |
| PF00211 | Guanylate_cyc | 1.06 |
| PF00872 | Transposase_mut | 1.06 |
| PF00196 | GerE | 0.53 |
| PF02775 | TPP_enzyme_C | 0.53 |
| PF01042 | Ribonuc_L-PSP | 0.53 |
| PF01738 | DLH | 0.53 |
| PF13545 | HTH_Crp_2 | 0.53 |
| PF02705 | K_trans | 0.53 |
| PF13701 | DDE_Tnp_1_4 | 0.53 |
| PF02803 | Thiolase_C | 0.53 |
| PF13700 | DUF4158 | 0.53 |
| PF12681 | Glyoxalase_2 | 0.53 |
| PF01548 | DEDD_Tnp_IS110 | 0.53 |
| PF08240 | ADH_N | 0.53 |
| PF03006 | HlyIII | 0.53 |
| PF13378 | MR_MLE_C | 0.53 |
| PF13924 | Lipocalin_5 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 189 Family Scaffolds |
|---|---|---|---|
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 2.12 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.59 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.06 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 1.06 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.53 |
| COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.53 |
| COG3158 | K+ uptake protein Kup | Inorganic ion transport and metabolism [P] | 0.53 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.72 % |
| Unclassified | root | N/A | 23.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001867|JGI12627J18819_10173550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 874 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100145371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2240 | Open in IMG/M |
| 3300002675|Ga0005473J37261_114993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300002677|Ga0005475J37263_101565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300002677|Ga0005475J37263_112524 | Not Available | 830 | Open in IMG/M |
| 3300003219|JGI26341J46601_10000013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 55439 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10017936 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300004080|Ga0062385_10405907 | Not Available | 816 | Open in IMG/M |
| 3300004082|Ga0062384_100232342 | Not Available | 1108 | Open in IMG/M |
| 3300004082|Ga0062384_100345055 | Not Available | 941 | Open in IMG/M |
| 3300004082|Ga0062384_100600030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300004082|Ga0062384_100981497 | Not Available | 603 | Open in IMG/M |
| 3300004092|Ga0062389_103004591 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300004092|Ga0062389_103330311 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300004099|Ga0058900_1429797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300004100|Ga0058904_1435800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300004117|Ga0058893_1008003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1222 | Open in IMG/M |
| 3300004120|Ga0058901_1345131 | Not Available | 626 | Open in IMG/M |
| 3300004139|Ga0058897_10823393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
| 3300004152|Ga0062386_101318294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
| 3300004631|Ga0058899_12284313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1861 | Open in IMG/M |
| 3300005167|Ga0066672_10339153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 981 | Open in IMG/M |
| 3300005175|Ga0066673_10707803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300005177|Ga0066690_10556857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 767 | Open in IMG/M |
| 3300005178|Ga0066688_10233337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1175 | Open in IMG/M |
| 3300005179|Ga0066684_10083269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1923 | Open in IMG/M |
| 3300005181|Ga0066678_10672607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300005184|Ga0066671_10055101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2031 | Open in IMG/M |
| 3300005436|Ga0070713_100132354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2200 | Open in IMG/M |
| 3300005437|Ga0070710_10043327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2492 | Open in IMG/M |
| 3300005439|Ga0070711_100761957 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
| 3300005467|Ga0070706_101688263 | Not Available | 577 | Open in IMG/M |
| 3300005468|Ga0070707_101169524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 735 | Open in IMG/M |
| 3300005471|Ga0070698_101152838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300005569|Ga0066705_10690931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300006028|Ga0070717_10549525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300006047|Ga0075024_100580925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300006175|Ga0070712_100005249 | All Organisms → cellular organisms → Bacteria | 8016 | Open in IMG/M |
| 3300006175|Ga0070712_100863676 | Not Available | 779 | Open in IMG/M |
| 3300006791|Ga0066653_10167202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1089 | Open in IMG/M |
| 3300006796|Ga0066665_10038101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3223 | Open in IMG/M |
| 3300006796|Ga0066665_10385537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1153 | Open in IMG/M |
| 3300006796|Ga0066665_10551336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 937 | Open in IMG/M |
| 3300006796|Ga0066665_11255460 | Not Available | 567 | Open in IMG/M |
| 3300006796|Ga0066665_11332632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300006800|Ga0066660_10089632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2145 | Open in IMG/M |
| 3300006804|Ga0079221_11339450 | Not Available | 565 | Open in IMG/M |
| 3300006806|Ga0079220_11052249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300006854|Ga0075425_101254325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300006893|Ga0073928_10060170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 3361 | Open in IMG/M |
| 3300007076|Ga0075435_100700572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300009038|Ga0099829_10191632 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300009088|Ga0099830_10114083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300009088|Ga0099830_11621988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300009089|Ga0099828_11444757 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300009137|Ga0066709_104460426 | Not Available | 511 | Open in IMG/M |
| 3300009143|Ga0099792_10003263 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6302 | Open in IMG/M |
| 3300009143|Ga0099792_11008208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300009156|Ga0111538_12699372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300009162|Ga0075423_12419869 | Not Available | 572 | Open in IMG/M |
| 3300010048|Ga0126373_10048778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3756 | Open in IMG/M |
| 3300010360|Ga0126372_10406667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1244 | Open in IMG/M |
| 3300010360|Ga0126372_13126277 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300011120|Ga0150983_11121307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2218 | Open in IMG/M |
| 3300011120|Ga0150983_11598397 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300011120|Ga0150983_11728284 | Not Available | 1404 | Open in IMG/M |
| 3300011120|Ga0150983_14309888 | Not Available | 517 | Open in IMG/M |
| 3300011120|Ga0150983_15368125 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300011271|Ga0137393_10090451 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300012177|Ga0153943_1129509 | Not Available | 547 | Open in IMG/M |
| 3300012200|Ga0137382_10434303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 928 | Open in IMG/M |
| 3300012206|Ga0137380_10787510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 821 | Open in IMG/M |
| 3300012207|Ga0137381_10052896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3358 | Open in IMG/M |
| 3300012211|Ga0137377_11544822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300012361|Ga0137360_11372998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300012362|Ga0137361_10962532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 772 | Open in IMG/M |
| 3300012389|Ga0134040_1017496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 948 | Open in IMG/M |
| 3300012922|Ga0137394_10325156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1314 | Open in IMG/M |
| 3300012923|Ga0137359_11362273 | Not Available | 597 | Open in IMG/M |
| 3300012944|Ga0137410_11309926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300016357|Ga0182032_10132711 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dadabacteria → Candidatus Dadabacteria bacterium | 1816 | Open in IMG/M |
| 3300016357|Ga0182032_10153622 | Not Available | 1705 | Open in IMG/M |
| 3300016404|Ga0182037_10164856 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300016445|Ga0182038_11007020 | Not Available | 738 | Open in IMG/M |
| 3300017823|Ga0187818_10455040 | Not Available | 572 | Open in IMG/M |
| 3300017932|Ga0187814_10442398 | Not Available | 509 | Open in IMG/M |
| 3300017942|Ga0187808_10046253 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
| 3300017943|Ga0187819_10518713 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300017955|Ga0187817_10454767 | Not Available | 817 | Open in IMG/M |
| 3300018006|Ga0187804_10241664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 778 | Open in IMG/M |
| 3300018433|Ga0066667_11300665 | Not Available | 635 | Open in IMG/M |
| 3300018433|Ga0066667_11915448 | Not Available | 541 | Open in IMG/M |
| 3300018468|Ga0066662_10221393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1518 | Open in IMG/M |
| 3300019161|Ga0184602_112592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1792 | Open in IMG/M |
| 3300020579|Ga0210407_10075173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2539 | Open in IMG/M |
| 3300020580|Ga0210403_10285587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1352 | Open in IMG/M |
| 3300020580|Ga0210403_11106176 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300020581|Ga0210399_10230529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1543 | Open in IMG/M |
| 3300020581|Ga0210399_10730349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300020581|Ga0210399_10913431 | Not Available | 711 | Open in IMG/M |
| 3300020581|Ga0210399_10940606 | Not Available | 699 | Open in IMG/M |
| 3300020581|Ga0210399_11452452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300020582|Ga0210395_10001202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 20095 | Open in IMG/M |
| 3300020582|Ga0210395_10480505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 935 | Open in IMG/M |
| 3300020583|Ga0210401_10259197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1598 | Open in IMG/M |
| 3300020583|Ga0210401_11107721 | Not Available | 650 | Open in IMG/M |
| 3300021088|Ga0210404_10167670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300021088|Ga0210404_10252086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 960 | Open in IMG/M |
| 3300021168|Ga0210406_11305057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300021358|Ga0213873_10017302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
| 3300021405|Ga0210387_11052912 | Not Available | 711 | Open in IMG/M |
| 3300021432|Ga0210384_11645580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
| 3300021474|Ga0210390_10009668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7896 | Open in IMG/M |
| 3300021476|Ga0187846_10005996 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6117 | Open in IMG/M |
| 3300021476|Ga0187846_10012211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4111 | Open in IMG/M |
| 3300021476|Ga0187846_10023429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2845 | Open in IMG/M |
| 3300021478|Ga0210402_10650444 | Not Available | 976 | Open in IMG/M |
| 3300021478|Ga0210402_11746572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300021479|Ga0210410_10081367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2848 | Open in IMG/M |
| 3300021560|Ga0126371_10032210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4917 | Open in IMG/M |
| 3300022726|Ga0242654_10351290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 555 | Open in IMG/M |
| 3300022726|Ga0242654_10386909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300023672|Ga0247553_100324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1670 | Open in IMG/M |
| 3300025915|Ga0207693_10014512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 6332 | Open in IMG/M |
| 3300026315|Ga0209686_1098448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1018 | Open in IMG/M |
| 3300026330|Ga0209473_1185864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 801 | Open in IMG/M |
| 3300026356|Ga0257150_1015940 | Not Available | 1040 | Open in IMG/M |
| 3300026508|Ga0257161_1118777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300026547|Ga0209156_10322876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 688 | Open in IMG/M |
| 3300026552|Ga0209577_10768291 | Not Available | 539 | Open in IMG/M |
| 3300027173|Ga0208097_1000416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3116 | Open in IMG/M |
| 3300027698|Ga0209446_1007218 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300027703|Ga0207862_1234918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
| 3300027908|Ga0209006_11051072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300030730|Ga0307482_1041357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1082 | Open in IMG/M |
| 3300030763|Ga0265763_1004380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1155 | Open in IMG/M |
| 3300030990|Ga0308178_1001475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 2255 | Open in IMG/M |
| 3300030990|Ga0308178_1008424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1380 | Open in IMG/M |
| 3300030990|Ga0308178_1022384 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300031057|Ga0170834_100299481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300031122|Ga0170822_12391458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2301 | Open in IMG/M |
| 3300031122|Ga0170822_13997545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 781 | Open in IMG/M |
| 3300031128|Ga0170823_13697183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum → unclassified Magnetospirillum → Magnetospirillum sp. | 691 | Open in IMG/M |
| 3300031231|Ga0170824_102690722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1371 | Open in IMG/M |
| 3300031231|Ga0170824_110681715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1384 | Open in IMG/M |
| 3300031231|Ga0170824_114060603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300031446|Ga0170820_16279487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1115 | Open in IMG/M |
| 3300031446|Ga0170820_17678006 | Not Available | 771 | Open in IMG/M |
| 3300031474|Ga0170818_104093902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 693 | Open in IMG/M |
| 3300031543|Ga0318516_10347975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
| 3300031545|Ga0318541_10031118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2644 | Open in IMG/M |
| 3300031545|Ga0318541_10356782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 816 | Open in IMG/M |
| 3300031677|Ga0307480_1009698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300031681|Ga0318572_10399443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300031682|Ga0318560_10072781 | All Organisms → cellular organisms → Bacteria | 1738 | Open in IMG/M |
| 3300031682|Ga0318560_10344428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
| 3300031708|Ga0310686_110291123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300031715|Ga0307476_10046221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2953 | Open in IMG/M |
| 3300031719|Ga0306917_11187592 | Not Available | 593 | Open in IMG/M |
| 3300031763|Ga0318537_10023880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2145 | Open in IMG/M |
| 3300031782|Ga0318552_10006543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4649 | Open in IMG/M |
| 3300031797|Ga0318550_10074423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1568 | Open in IMG/M |
| 3300031821|Ga0318567_10656623 | Not Available | 595 | Open in IMG/M |
| 3300031833|Ga0310917_10437202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 890 | Open in IMG/M |
| 3300031833|Ga0310917_10479098 | Not Available | 847 | Open in IMG/M |
| 3300031835|Ga0318517_10168335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 983 | Open in IMG/M |
| 3300031860|Ga0318495_10165069 | Not Available | 999 | Open in IMG/M |
| 3300031871|Ga0316036_117376 | Not Available | 525 | Open in IMG/M |
| 3300031879|Ga0306919_10100851 | Not Available | 2030 | Open in IMG/M |
| 3300031912|Ga0306921_10204931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2311 | Open in IMG/M |
| 3300031912|Ga0306921_11947799 | Not Available | 627 | Open in IMG/M |
| 3300031959|Ga0318530_10369349 | Not Available | 594 | Open in IMG/M |
| 3300031962|Ga0307479_11057613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 779 | Open in IMG/M |
| 3300031962|Ga0307479_11712600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300032055|Ga0318575_10282094 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 839 | Open in IMG/M |
| 3300032063|Ga0318504_10313209 | Not Available | 744 | Open in IMG/M |
| 3300032091|Ga0318577_10012092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3425 | Open in IMG/M |
| 3300032091|Ga0318577_10097865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum | 1371 | Open in IMG/M |
| 3300032094|Ga0318540_10025686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2504 | Open in IMG/M |
| 3300032174|Ga0307470_11167012 | Not Available | 623 | Open in IMG/M |
| 3300032180|Ga0307471_103972910 | Not Available | 523 | Open in IMG/M |
| 3300032180|Ga0307471_104341482 | Not Available | 501 | Open in IMG/M |
| 3300032515|Ga0348332_10536710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1710 | Open in IMG/M |
| 3300032515|Ga0348332_14456085 | Not Available | 529 | Open in IMG/M |
| 3300032515|Ga0348332_14632852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1327 | Open in IMG/M |
| 3300032515|Ga0348332_14682145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1191 | Open in IMG/M |
| 3300032895|Ga0335074_10356311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Inquilinus → Inquilinus limosus | 1622 | Open in IMG/M |
| 3300032896|Ga0335075_10013397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 12344 | Open in IMG/M |
| 3300033290|Ga0318519_10240694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1044 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.34% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.99% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.29% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.23% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.23% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.17% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.12% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.12% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 2.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.12% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 1.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.06% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002675 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF122 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300002677 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF124 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004100 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF244 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004117 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF222 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012389 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031677 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_101735502 | 3300001867 | Forest Soil | MKYVVPPIVIPILLFIGIVAYGVLRPPIIAGHLPAPAANSQAR* |
| JGIcombinedJ26739_1001453713 | 3300002245 | Forest Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHPPFPAANSQPR* |
| Ga0005473J37261_1149931 | 3300002675 | Forest Soil | KIGNTMKYLVPPIVIPALLFIGVVAYGMLRPPINVAHSPVPAANSQPR* |
| Ga0005475J37263_1015651 | 3300002677 | Forest Soil | RVLFNLGNLMKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHPPFPAANSQPR* |
| Ga0005475J37263_1125241 | 3300002677 | Forest Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG* |
| JGI26341J46601_1000001336 | 3300003219 | Bog Forest Soil | MRYLVPPIVIPILLFLGVAAYGLFGPPIVAAGHHPASSLNSQPR* |
| JGIcombinedJ51221_100179362 | 3300003505 | Forest Soil | VKYLVPPIVIPVLLFIGVVSYALLRPPLVVGHPVAPVSIAQPR* |
| Ga0062385_104059072 | 3300004080 | Bog Forest Soil | MKYLVPPIVIPILLFIGVAAYGLLGPPIIAGGHPPATAVNTQPR* |
| Ga0062384_1002323421 | 3300004082 | Bog Forest Soil | KYLVPPIVIPVLLFIGVVAYAALRPPFVVAHPAAPVANTQPR* |
| Ga0062384_1003450553 | 3300004082 | Bog Forest Soil | SRFSNKRETMKYLVPPIVIPVLLFIGIVTYGMLRPPISVGPPPISAVSPQTR* |
| Ga0062384_1006000302 | 3300004082 | Bog Forest Soil | VKYLVPPIVIPVLLIIGIAAYALLKPPIVVGHSPASAANTQPR* |
| Ga0062384_1009814971 | 3300004082 | Bog Forest Soil | SRFSNKRETMKYLVPPIVIPVLLFIGIVTYGMLRPPIIVGPPPMSAVSPQTR* |
| Ga0062389_1030045912 | 3300004092 | Bog Forest Soil | YLVPPIVIPVLLFIGIAAYGMLRPPIIVGHAPAPAASAQPR* |
| Ga0062389_1033303112 | 3300004092 | Bog Forest Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVTVGHLPAAAANSQPR* |
| Ga0058900_14297973 | 3300004099 | Forest Soil | MKYLVPPIVIPVLLIIGVLAYGMLKPPIIAGHSPVPVADSRTR* |
| Ga0058904_14358004 | 3300004100 | Forest Soil | VLFNLGNLMKYLVPPIVIPVLLFIGVVAYGILRPPMIVGHPPFPAANSQPH* |
| Ga0058893_10080031 | 3300004117 | Forest Soil | MKYLVPPIVIPVLLVIGIAAYAILAPPIVAGHSSVPVATSQPGKAALAV |
| Ga0058901_13451312 | 3300004120 | Forest Soil | MKYLVPPIVIPILLLIGVAAYGLLRPPIVAVGHLPAAAANSQPG* |
| Ga0058897_108233931 | 3300004139 | Forest Soil | KYLVPPIVIPVLLVIGIAAYAILAPPIVAGHSSLPVATSQPR* |
| Ga0062386_1013182942 | 3300004152 | Bog Forest Soil | KGRTMKYLVPPIVIPVLLFIGIVAYGLLGPPPLAAGHSPASAVSSQPR* |
| Ga0058899_122843134 | 3300004631 | Forest Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQSR* |
| Ga0066672_103391532 | 3300005167 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQHR* |
| Ga0066673_107078032 | 3300005175 | Soil | MKYLVPPIVIPALLLIGVLAYGMLRPPIIVGHAPVPTAHSQAR* |
| Ga0066690_105568571 | 3300005177 | Soil | MGSTMKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQHR* |
| Ga0066688_102333373 | 3300005178 | Soil | MGSTVKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQHR* |
| Ga0066684_100832693 | 3300005179 | Soil | MKYLVPPIVIPVLLFIGVVAYGTLKPPIIVGQPPVPAANSQHR* |
| Ga0066678_106726071 | 3300005181 | Soil | KPMKYLVPPIVIPVLLVIGIAAYVVLGPPIVAGHSPVPVAASQPR* |
| Ga0066671_100551012 | 3300005184 | Soil | MGSTVKYLVPPIVIPVLLFIGVMAYGMLKPPIIVGQPPVPAANSQHR* |
| Ga0070713_1001323541 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLVPPLVIPVLLFVGVVAYGLLKPPIIVGHPPFPAANSQPR* |
| Ga0070710_100433272 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPALLFIGVVAYGMLRPPINVAHSPVPAANSQPR* |
| Ga0070711_1007619572 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPVLLFIGIAAYGMLRPPITVDHPPAPAAISQSR* |
| Ga0070706_1016882632 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPVLLFIGIAAYGMLRPPIIVGHPPAPAANSQ |
| Ga0070707_1011695242 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPVLLVIGIAAYAMLRQPIVLDHPSVSSATSPPR* |
| Ga0070698_1011528381 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LHKGKNMKYLVPPIVIPVLLFIGIAAYGMLRPPITVDHPPAPAAISQSR* |
| Ga0066705_106909311 | 3300005569 | Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPIVVGHPPVP |
| Ga0070717_105495253 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MKFLVPPLVIPVLLFVGVIAYGLLKPPIIVGHPPF |
| Ga0075024_1005809252 | 3300006047 | Watersheds | MKYLVPPIVIPALLFVGIVTYGMLRPPIIGSHPPMSVSSQTR |
| Ga0070712_1000052495 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPVLLFIGVVAYGMLRPPIIVAHPPVPVANSQAR* |
| Ga0070712_1008636762 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KGKNMKYLVPPIVIPVLLFIGIAAYGMLRPPITVDHPPAPAAISQSR* |
| Ga0066653_101672021 | 3300006791 | Soil | NEMKHLVPPIVIPALLLIGVVAYGMLRPPIIVGHAPVPTAHSQAR* |
| Ga0066665_100381014 | 3300006796 | Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPIIVGYAPAPAASAQPR* |
| Ga0066665_103855373 | 3300006796 | Soil | FARNTMKYLVPPIVIPILLLIGIAAYATLRPPLIVGVPAVPAVHSLSR* |
| Ga0066665_105513361 | 3300006796 | Soil | VIGFRYKGATMRYLVPPIVIPVLLLIGIAAFGMLRPPIVSGNAPLPAVSAQTR* |
| Ga0066665_112554601 | 3300006796 | Soil | MKYLVPPIVIPVLLLIGIAAYGMLRPSIVIGNAPLSAVSAQTR* |
| Ga0066665_113326322 | 3300006796 | Soil | FLLDLRTMKYLVPPIVIPVLLMIGIAAYVVFGPPIVAGHSPVPVAASQPR* |
| Ga0066660_100896321 | 3300006800 | Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPIVVGHPPVPAANSQPR |
| Ga0079221_113394502 | 3300006804 | Agricultural Soil | MKYLVPPIVIPVLLFIGILAYGMLRPPIIVGPPVAPANSQPR* |
| Ga0079220_110522492 | 3300006806 | Agricultural Soil | MKYLVPPIVIPVLLFIGVAAYGMLRPPIIVGHPLTPAANSQT |
| Ga0075425_1012543251 | 3300006854 | Populus Rhizosphere | MKYLVPPIVIPILLVIGVAVYGLLGPPIVAVGHAPAAAASSQSR* |
| Ga0073928_100601707 | 3300006893 | Iron-Sulfur Acid Spring | MKYLVPPIVIPVLLFIGVVAYGMLKPPMIVGLPPFPAANSQPR* |
| Ga0075435_1007005721 | 3300007076 | Populus Rhizosphere | MKYLVPPIVIPVLLVIGIAAYVVLGPPIVAGHSPVPVAASQPR |
| Ga0099829_101916323 | 3300009038 | Vadose Zone Soil | MKYLVPPIVIPVLLVIGIAAYGMLRPPIVVGNAPLPAASAQTR* |
| Ga0099830_101140833 | 3300009088 | Vadose Zone Soil | MKYLVPPIVIPVLLVIGIAAYGMLRPPIVAGNTPLPAASAQTR* |
| Ga0099830_116219883 | 3300009088 | Vadose Zone Soil | VPPIVIPVLLFIGIAAYALLRPPIIVAHPAAPAVNSQPR* |
| Ga0099828_114447572 | 3300009089 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPIVVGNAPPPAASVQTR* |
| Ga0066709_1044604261 | 3300009137 | Grasslands Soil | MKYLVPPIVIPILLVIGVAAYGLLGPPIVAVGHAPAAAASSQTR* |
| Ga0099792_1000326310 | 3300009143 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYGMLRSPITVDHPPAPAAISQSR* |
| Ga0099792_110082081 | 3300009143 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPIVVGNAPLPAAIVQTR* |
| Ga0111538_126993722 | 3300009156 | Populus Rhizosphere | MKYVVPPIVIPVLLFIGIVAYAMLRPPITDAHPPTPAANLQ |
| Ga0075423_124198692 | 3300009162 | Populus Rhizosphere | MKYLVPPIVIPILSVIGVAVYGLLGPPIVAVGHAPAAAASSQSR* |
| Ga0126373_100487783 | 3300010048 | Tropical Forest Soil | MKYLVPPIVIPFLLVIGIVAYGMLKSPNIDGHSPAPAVSSQSR* |
| Ga0126372_104066673 | 3300010360 | Tropical Forest Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNSQPR* |
| Ga0126372_131262772 | 3300010360 | Tropical Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIVGHAPAPAASAQPR* |
| Ga0150983_111213073 | 3300011120 | Forest Soil | MKYLVPPIVIPVLLFIGVVAYGMLRPPIIVAHPAVPVANSQAR* |
| Ga0150983_115983972 | 3300011120 | Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIVVGNAPLPAASAQTR* |
| Ga0150983_117282842 | 3300011120 | Forest Soil | MKYLVPPIVIPVLLFIGVVAYGMLRPPIIVGHAPAPAASAQP* |
| Ga0150983_143098882 | 3300011120 | Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLKPPIIVGHAPAPAANAQPR* |
| Ga0150983_153681253 | 3300011120 | Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIAGHVSAPAASAQPR* |
| Ga0137393_100904513 | 3300011271 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPIVAGNTPLPAASAQTR* |
| Ga0153943_11295091 | 3300012177 | Attine Ant Fungus Gardens | VKYLVPPIVIPILLLVGVVSYALLRPPLVAGHPVAPVSIAQPR* |
| Ga0137382_104343032 | 3300012200 | Vadose Zone Soil | MPVILFSLKQKPMKYLVPPIVIPVLLVIGIAAYAILAPPIVAVHSSVPVATSQPR* |
| Ga0137380_107875102 | 3300012206 | Vadose Zone Soil | LHKGKNMKYLVPPIVIPVLLFIGIAAYGMLRPPIAVDHP |
| Ga0137381_100528964 | 3300012207 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPIAVDHPPTPAAISQSR* |
| Ga0137377_115448222 | 3300012211 | Vadose Zone Soil | MPVILFSLKQKPMKYLVPPIVIPVLWGIGIAAYAILAPPIVAVHSSVPVATSQPR* |
| Ga0137360_113729982 | 3300012361 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGILAYGMLRPPIIAGHPPTPA |
| Ga0137361_109625323 | 3300012362 | Vadose Zone Soil | LHKGKNMKYLVPPIVIPVLLFIGIAAYGMLRPPITA |
| Ga0134040_10174963 | 3300012389 | Grasslands Soil | MKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQLPVPAANSQQR* |
| Ga0137394_103251563 | 3300012922 | Vadose Zone Soil | MPVILFSLKQKPMKYLVPPIVIPILLVIGIAAYAALGPPVVAAHSPVPVATSQPR* |
| Ga0137359_113622732 | 3300012923 | Vadose Zone Soil | MKYLVPPIVIPVLLFIGIAAYVMLRPPITVGHAPAPAANAQPR* |
| Ga0137410_113099262 | 3300012944 | Vadose Zone Soil | MKYLVPPIVIPVLLVIGIAAYAMLGPPIVAGHPPVPVATSQ |
| Ga0182032_101327112 | 3300016357 | Soil | VIPILLFIGIVAYGMLRPPITVDHPPASAATSESR |
| Ga0182032_101536221 | 3300016357 | Soil | LVPPIVIPILLVIGVAAYALFGPPIVPAGHSPASALTSQPR |
| Ga0182037_101648564 | 3300016404 | Soil | MKYMVPPIVIPILLFIGVVAYGLFGPPIIAGGHPSATAVNTQPR |
| Ga0182038_110070201 | 3300016445 | Soil | KYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0187818_104550401 | 3300017823 | Freshwater Sediment | LSLKEEKTLKYLVPPIVIPVLLFIGIVAYALLRRPLVVGHPVAPLSIAQPR |
| Ga0187814_104423982 | 3300017932 | Freshwater Sediment | VFKKGKVMKYLVPPIVIPMLLFIGIVAYALLRPPIVVGRSLAPVSIAQPR |
| Ga0187808_100462532 | 3300017942 | Freshwater Sediment | MKYLVPPIVIPMLLFIGIVAYALLRPPIVVGRSLAPVSIAQPR |
| Ga0187819_105187132 | 3300017943 | Freshwater Sediment | MKYLVPPIVIPMLLFIGIVAYALLRPPIVVGHSLAPVSIAQPR |
| Ga0187817_104547672 | 3300017955 | Freshwater Sediment | MKYLVPPIVIPMLLFIGIVAYALLRPPIVVGYSLAPVSIAQPR |
| Ga0187804_102416641 | 3300018006 | Freshwater Sediment | MKYLVPPIVIPMLLFIGIVAYALLRPPIVVGHSLAPVSMAQPR |
| Ga0066667_113006652 | 3300018433 | Grasslands Soil | MIKGTTMKYLVPPIVIPVLLFIGIAAYGMLRPPIVAGNAPLPAASAPTR |
| Ga0066667_119154481 | 3300018433 | Grasslands Soil | MRYLVPPIVIPVLLLIGIAAFGMLRPPIVSGNAPLPAVSA |
| Ga0066662_102213933 | 3300018468 | Grasslands Soil | MGSTVKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQHR |
| Ga0184602_1125923 | 3300019161 | Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQSR |
| Ga0210407_100751732 | 3300020579 | Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIAGHVSAPAASAQPR |
| Ga0210403_102855873 | 3300020580 | Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0210403_111061761 | 3300020580 | Soil | ATMKYLVPPIVIPVLLFIGIAAYAMLRPPIIAGHVSAPAASAQPR |
| Ga0210399_102305293 | 3300020581 | Soil | MRYVVPPIVIPILLFIGVAAYGLLRPPIVAAGAGHYPASSLNSQPR |
| Ga0210399_107303491 | 3300020581 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLRPPMIVGHPPFPAANS |
| Ga0210399_109134312 | 3300020581 | Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIVVGNAPLPAASAQTR |
| Ga0210399_109406061 | 3300020581 | Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIAGHVSAPPA |
| Ga0210399_114524522 | 3300020581 | Soil | MRYLVPPIVIPILLVIGVAAYALFGPPIVPAGHSPA |
| Ga0210395_100012024 | 3300020582 | Soil | VKYLVPPIVIPVLLFIGVVSYALLRPPLVVGHPVAPVSIAQPR |
| Ga0210395_104805053 | 3300020582 | Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHPPFPAANSQ |
| Ga0210401_102591974 | 3300020583 | Soil | MKYLVPPIVIPALLLVGVVAYGMLKPLIIVGHPAVPLAHSLPR |
| Ga0210401_111077212 | 3300020583 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLRPPIIVGHAPAPAASAQP |
| Ga0210404_101676703 | 3300021088 | Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHPPFPAAN |
| Ga0210404_102520863 | 3300021088 | Soil | ENLMKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHPPFPAANSQPR |
| Ga0210406_113050572 | 3300021168 | Soil | MKYLVPPIVIPVLLFIGIAAYGILRPPITVDHPPTPA |
| Ga0213873_100173022 | 3300021358 | Rhizosphere | MRYLVPPIVIPVLLFLGIMAYWLLGPPIVDAGHAPASAVSSQSR |
| Ga0210387_110529122 | 3300021405 | Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIVGHAPAPAASAQPR |
| Ga0210384_116455802 | 3300021432 | Soil | MKYLVPPIVIPILLVIGITAYALFRPPIVAGHPPVPVATS |
| Ga0210390_100096685 | 3300021474 | Soil | MKYLVPPVVIPMLLFIGIVAYALLRPPIVVGHSLAPVPIAQPR |
| Ga0187846_100059968 | 3300021476 | Biofilm | MRYLVPPIVIPILLLIGVVAYGLFGPPIVAAGHHPLPH |
| Ga0187846_100122112 | 3300021476 | Biofilm | MRYLVPPIVIPILLVIGVAAYGLFGPPIAAAGHHPASSLNWQPR |
| Ga0187846_100234292 | 3300021476 | Biofilm | MKYLVPPIVIPILLFIGVAVYTLLGPPIVAGGHPPAAAVNAQPR |
| Ga0210402_106504441 | 3300021478 | Soil | MKYLVPPIVIPVLLFVGIAAYAMLRPPIIVGHAPAPAASAQP |
| Ga0210402_117465722 | 3300021478 | Soil | MKYLVPPIVIPVLLFIGVVAYGVLRPPMIVGHLPFLAAKSQPR |
| Ga0210410_100813673 | 3300021479 | Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPITVDHPPAPAAISQSR |
| Ga0126371_100322109 | 3300021560 | Tropical Forest Soil | MKYLVPPIVIPFLLVIGIVAYGMLKSPNIDGHSPAPAVSSQSR |
| Ga0242654_103512902 | 3300022726 | Soil | MKFLVPPLVIPVLLFVGVVAYGLLKPPIIVGHPPSPAANSQ |
| Ga0242654_103869092 | 3300022726 | Soil | MKYLVPPIVIPVLLIIGVLAYGMLKPPIITGHSPV |
| Ga0247553_1003242 | 3300023672 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGHPPVPAVNSQPR |
| Ga0207693_100145124 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKYLVPPIVIPALLFIGVVAYGMLRPPINVAHSPVPAANSQPR |
| Ga0209686_10984482 | 3300026315 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQHR |
| Ga0209473_11858642 | 3300026330 | Soil | MGSTVKYLVPPIVIPVLLFIGVVAYGTLKPPIIVGQPPVPAANSQHR |
| Ga0257150_10159402 | 3300026356 | Soil | SGNTMKYLVPPIVIPVLLFIGVVAYGVLRPPVIVGHPPVPVANSQAR |
| Ga0257161_11187771 | 3300026508 | Soil | MKYLVPPIVIPVLLFIGIAAYGMLRPPITVDHPPAPA |
| Ga0209156_103228761 | 3300026547 | Soil | MKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQLPVPAANSQQR |
| Ga0209577_107682912 | 3300026552 | Soil | MGSTVKYLVPPIVIPVLLFIGVVAYGMLKPPIIVGQPPVPAANSQH |
| Ga0208097_10004166 | 3300027173 | Forest Soil | MKYLVPPIVIPVLLIIGVLAYGMLKPPIIAGHSPVPVADSRTR |
| Ga0209446_10072186 | 3300027698 | Bog Forest Soil | MRYLVPPIVIPILLFLGVAAYGLFGPPIVAAGHHPASSLNSQPR |
| Ga0207862_12349181 | 3300027703 | Tropical Forest Soil | APLRGKTMKYLVPPIVIPVLLVIGIAAYAILEPLTVAVHPPVPAEISQPR |
| Ga0209006_110510722 | 3300027908 | Forest Soil | MKYLVPPIVIPVLLFIGIVAYGMLKPPIFVGYPPVPAANLQP |
| Ga0307482_10413573 | 3300030730 | Hardwood Forest Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPA |
| Ga0265763_10043801 | 3300030763 | Soil | MKYLVPPIVIPVLLFIGVVAYGILRPPMIVGHPPFPAANSQP |
| Ga0308178_10014751 | 3300030990 | Soil | MKYLVPPIVIPVLLFIGVAAYGMLRPPIIVDHPPAAAASSQPR |
| Ga0308178_10084242 | 3300030990 | Soil | MKFLVPPIVIPVLLFVGVVAYGLLKPPIIVGHPPFPAANAQPR |
| Ga0308178_10223843 | 3300030990 | Soil | MKYLVPPIVIPILLCIRVVAYAILKPPITVEHSPAPAAISQGVTK |
| Ga0170834_1002994813 | 3300031057 | Forest Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVGVGHHPASSMSAQPR |
| Ga0170822_123914586 | 3300031122 | Forest Soil | MKYLVPPIVIPVLLIIGVLAYGVLKPPIIAGHSPIPVADSRTR |
| Ga0170822_139975453 | 3300031122 | Forest Soil | MRYLVPPIVIPILLFIGVAAYGLFGPPIVGVGHHPASSMSAQPR |
| Ga0170823_136971831 | 3300031128 | Forest Soil | MKYLVPPIVIPALLFIGIAAYAILRPPIIVGHVSAPATSAQPR |
| Ga0170824_1026907222 | 3300031231 | Forest Soil | MRYLVPPIVIPILLVIGVAAYALFGPPIVPAGHSPASALTSQPR |
| Ga0170824_1106817153 | 3300031231 | Forest Soil | MRYLVPPIVIPILLVLGVAAYGLFGPPIVDAGHHPASSLNSQAR |
| Ga0170824_1140606031 | 3300031231 | Forest Soil | MKYLVPPIVIPVLLVIGIAAYAMLGPPIVAGHSPVPV |
| Ga0170820_162794871 | 3300031446 | Forest Soil | MRYLVPPIVIPILLVLGVAAYGLFGPPVVDAGHHPASSL |
| Ga0170820_176780062 | 3300031446 | Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIVGHAPAP |
| Ga0170818_1040939022 | 3300031474 | Forest Soil | MKYLVPPIVIPVLLVIGIAAYAMLGPPIVAGHSPVPVTTSQPR |
| Ga0318516_103479752 | 3300031543 | Soil | MKYLVPPIVIPIPLFIGVAAYGLLRPPIVAVSHLPAAAANSQPG |
| Ga0318541_100311183 | 3300031545 | Soil | MRYLVPPIVIPFLLFISVAAYALFGPPTVGAGHPPASVLNSQPR |
| Ga0318541_103567822 | 3300031545 | Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNSQPR |
| Ga0307480_10096982 | 3300031677 | Hardwood Forest Soil | KYLVPPIVIPVLLFIGVVAYGMLRPPIIVAHPPVPVANSQAR |
| Ga0318572_103994432 | 3300031681 | Soil | ENMKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNSQPR |
| Ga0318560_100727814 | 3300031682 | Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVSHLPAAAANSQPG |
| Ga0318560_103444283 | 3300031682 | Soil | VRFFLHGKLMKYVVPPIVIPILLFIGVVAYGLFGPPIIAGGHPSATAMNTQPR |
| Ga0310686_1102911231 | 3300031708 | Soil | MKYLVPPIVIPALLFVGIVTYGMLRPPIIGGHPPM |
| Ga0307476_100462212 | 3300031715 | Hardwood Forest Soil | VKYLVPPVVIPVLLFIGIVSYALLKPPLPVGHSVAPVVNAQPR |
| Ga0306917_111875923 | 3300031719 | Soil | HGKLMKYVVPPIVIPILLFIGVVAYGLFGPPIIAGGHPSATAMNTQPR |
| Ga0318537_100238804 | 3300031763 | Soil | MKYLVPPIVIPILLFIGIVAYGMLRPPITVDHPPAPAA |
| Ga0318552_100065435 | 3300031782 | Soil | MKYLVTPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNSQPR |
| Ga0318550_100744234 | 3300031797 | Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPASSLNSQPR |
| Ga0318567_106566231 | 3300031821 | Soil | AKKTMKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNSQPR |
| Ga0310917_104372021 | 3300031833 | Soil | HGKLMKYVVPPIVIPILLFIGVVAYGLFGPPIIAGGHPSATAVNTQPR |
| Ga0310917_104790981 | 3300031833 | Soil | IPILLFIGVAAYGLFGPPIVAAGHTPASVLTSQPR |
| Ga0318517_101683351 | 3300031835 | Soil | MRYLVPPIVIPFLLFISVAAYALFGPPTVGAGHPPA |
| Ga0318495_101650691 | 3300031860 | Soil | MKYLVPPIVIPVLLFIGIAAYAMLRTPIIVGHAPAPAASA |
| Ga0316036_1173762 | 3300031871 | Soil | LVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQSR |
| Ga0306919_101008512 | 3300031879 | Soil | MKYLVPPIVIPILLFIGIVAYGMLRPPITVDHPPAPAATSESR |
| Ga0306921_102049312 | 3300031912 | Soil | MKYVVPPIVIPILLFIGVVAYGLFGPPIIAGGHPSATAVNTQPR |
| Ga0306921_119477992 | 3300031912 | Soil | PIRVTARKALRYFVPPIVIPILLFIGVAAYGLFGPPIVAAGHTPASVLTSQPR |
| Ga0318530_103693491 | 3300031959 | Soil | LVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0307479_110576131 | 3300031962 | Hardwood Forest Soil | MKYLVPPIVIPVLLFIGVIAYAALRPPIIAAHPLAAVVNSQPR |
| Ga0307479_117126001 | 3300031962 | Hardwood Forest Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGDHPVSSLNSQPR |
| Ga0318575_102820943 | 3300032055 | Soil | MKYLVPPIVIPIPLFIGVAAYGLLRPPIVAVSHLPAA |
| Ga0318504_103132091 | 3300032063 | Soil | ARKTMRYLVPPIVIPFLLFISVAAYALFGPPTVGAGHPPASVLNSQPR |
| Ga0318577_100120928 | 3300032091 | Soil | VHLARKTMKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0318577_100978651 | 3300032091 | Soil | MKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAA |
| Ga0318540_100256864 | 3300032094 | Soil | MKYLVPPIVIPIPLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0307470_111670121 | 3300032174 | Hardwood Forest Soil | ARKTMKYLVPPIVIPILLFIGVAAYGLLRPPIVAVGHLPAAAANSQPG |
| Ga0307471_1039729101 | 3300032180 | Hardwood Forest Soil | MKYLVPPIVIPVLLFIGIAAYAMLRPPIIVGHAPAPAANAQPR |
| Ga0307471_1043414822 | 3300032180 | Hardwood Forest Soil | MKYLVPPIVIPILLFIGVAAYALFGPPIVATGHTPASALTSQPR |
| Ga0348332_105367102 | 3300032515 | Plant Litter | VKYLVPPIVIPVLLVVGVVAYALLRPPLVIGHPVAPVVNAQPR |
| Ga0348332_144560852 | 3300032515 | Plant Litter | MKYLVPPIVIPALLFVGIVAYGMLRPPIIGDHPPVSVSSQTR |
| Ga0348332_146328522 | 3300032515 | Plant Litter | MKYLVPPIVIPVLLVIGIAAYALLKPPTIVSHSPTAAENAQLR |
| Ga0348332_146821453 | 3300032515 | Plant Litter | VKYVIPPIVVPLLIFIGIIAYALLRPPLVVGHSVEPVVN |
| Ga0335074_103563113 | 3300032895 | Soil | VKYFVPPIVIPALIFIGIVSYALLRPPLVVGHSVAPAVSAPPR |
| Ga0335075_1001339720 | 3300032896 | Soil | VKYFVPPIVIPALIFIGIVSYALLRPPLVVGHSVAPAVSAQPR |
| Ga0318519_102406943 | 3300033290 | Soil | MKYLVPPIVIPILLFIGVAAYGLFGPPIVAAGNHPTSSLNS |
| ⦗Top⦘ |