


| Basic Information | |
|---|---|
| Family ID | F028947 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RNCKRVTLDTTEPLQRAMRFYEKNGYRRSGRISDFFGMPLYEYVKAL |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.05 % |
| % of genes near scaffold ends (potentially truncated) | 98.42 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 146 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.158 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.368 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 17.33% β-sheet: 24.00% Coil/Unstructured: 58.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF00121 | TIM | 5.79 |
| PF02687 | FtsX | 3.16 |
| PF00583 | Acetyltransf_1 | 2.63 |
| PF00248 | Aldo_ket_red | 2.63 |
| PF01740 | STAS | 2.11 |
| PF03741 | TerC | 2.11 |
| PF00590 | TP_methylase | 1.58 |
| PF01979 | Amidohydro_1 | 1.05 |
| PF12802 | MarR_2 | 1.05 |
| PF00162 | PGK | 1.05 |
| PF00903 | Glyoxalase | 1.05 |
| PF01243 | Putative_PNPOx | 1.05 |
| PF01980 | TrmO | 1.05 |
| PF02777 | Sod_Fe_C | 1.05 |
| PF07505 | DUF5131 | 1.05 |
| PF13673 | Acetyltransf_10 | 1.05 |
| PF01965 | DJ-1_PfpI | 1.05 |
| PF08592 | Anthrone_oxy | 1.05 |
| PF01872 | RibD_C | 1.05 |
| PF01266 | DAO | 1.05 |
| PF13231 | PMT_2 | 1.05 |
| PF02597 | ThiS | 1.05 |
| PF10543 | ORF6N | 0.53 |
| PF11066 | DUF2867 | 0.53 |
| PF00704 | Glyco_hydro_18 | 0.53 |
| PF04255 | DUF433 | 0.53 |
| PF04248 | NTP_transf_9 | 0.53 |
| PF00873 | ACR_tran | 0.53 |
| PF00795 | CN_hydrolase | 0.53 |
| PF04993 | TfoX_N | 0.53 |
| PF13418 | Kelch_4 | 0.53 |
| PF03795 | YCII | 0.53 |
| PF00581 | Rhodanese | 0.53 |
| PF01242 | PTPS | 0.53 |
| PF00850 | Hist_deacetyl | 0.53 |
| PF11918 | Peptidase_S41_N | 0.53 |
| PF05977 | MFS_3 | 0.53 |
| PF00174 | Oxidored_molyb | 0.53 |
| PF01416 | PseudoU_synth_1 | 0.53 |
| PF13589 | HATPase_c_3 | 0.53 |
| PF01609 | DDE_Tnp_1 | 0.53 |
| PF07978 | NIPSNAP | 0.53 |
| PF13360 | PQQ_2 | 0.53 |
| PF02826 | 2-Hacid_dh_C | 0.53 |
| PF00389 | 2-Hacid_dh | 0.53 |
| PF12706 | Lactamase_B_2 | 0.53 |
| PF00005 | ABC_tran | 0.53 |
| PF11455 | MazE-like | 0.53 |
| PF13414 | TPR_11 | 0.53 |
| PF13671 | AAA_33 | 0.53 |
| PF07136 | DUF1385 | 0.53 |
| PF13460 | NAD_binding_10 | 0.53 |
| PF12900 | Pyridox_ox_2 | 0.53 |
| PF06475 | Glycolipid_bind | 0.53 |
| PF14716 | HHH_8 | 0.53 |
| PF01053 | Cys_Met_Meta_PP | 0.53 |
| PF12681 | Glyoxalase_2 | 0.53 |
| PF00753 | Lactamase_B | 0.53 |
| PF12704 | MacB_PCD | 0.53 |
| PF02738 | MoCoBD_1 | 0.53 |
| PF00069 | Pkinase | 0.53 |
| PF00202 | Aminotran_3 | 0.53 |
| PF05637 | Glyco_transf_34 | 0.53 |
| PF07690 | MFS_1 | 0.53 |
| PF01370 | Epimerase | 0.53 |
| PF10518 | TAT_signal | 0.53 |
| PF03807 | F420_oxidored | 0.53 |
| PF15902 | Sortilin-Vps10 | 0.53 |
| PF04613 | LpxD | 0.53 |
| PF07516 | SecA_SW | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG0149 | Triosephosphate isomerase | Carbohydrate transport and metabolism [G] | 5.79 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.11 |
| COG0861 | Tellurite resistance membrane protein TerC | Inorganic ion transport and metabolism [P] | 2.11 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.05 |
| COG0126 | 3-phosphoglycerate kinase | Carbohydrate transport and metabolism [G] | 1.05 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 1.05 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.05 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 1.05 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 1.05 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 1.05 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 1.05 |
| COG4422 | Bacteriophage protein gp37 | Mobilome: prophages, transposons [X] | 1.05 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.53 |
| COG0101 | tRNA U38,U39,U40 pseudouridine synthase TruA | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.53 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.53 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.53 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.53 |
| COG0653 | Preprotein translocase subunit SecA (ATPase, RNA helicase) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.53 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.53 |
| COG1044 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.53 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.53 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.53 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.53 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.53 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.53 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.53 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.53 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.53 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.53 |
| COG3554 | Uncharacterized conserved protein | Function unknown [S] | 0.53 |
| COG3872 | Uncharacterized conserved protein YqhQ, DUF1385 family | Function unknown [S] | 0.53 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.53 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.53 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.53 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.53 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.16 % |
| Unclassified | root | N/A | 6.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000893|AP72_2010_repI_A001DRAFT_1034171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 801 | Open in IMG/M |
| 3300001305|C688J14111_10199251 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300001356|JGI12269J14319_10100220 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300001471|JGI12712J15308_10211549 | Not Available | 511 | Open in IMG/M |
| 3300001661|JGI12053J15887_10278080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 824 | Open in IMG/M |
| 3300004092|Ga0062389_101319007 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300004092|Ga0062389_103218242 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300004153|Ga0063455_101531982 | Not Available | 522 | Open in IMG/M |
| 3300004635|Ga0062388_101334254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 717 | Open in IMG/M |
| 3300005175|Ga0066673_10882056 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005176|Ga0066679_10086152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1885 | Open in IMG/M |
| 3300005177|Ga0066690_10486808 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300005327|Ga0070658_11139254 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005332|Ga0066388_101732639 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300005435|Ga0070714_100568243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 1087 | Open in IMG/M |
| 3300005436|Ga0070713_101169787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300005456|Ga0070678_100577107 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005458|Ga0070681_10089559 | All Organisms → cellular organisms → Bacteria | 3029 | Open in IMG/M |
| 3300005529|Ga0070741_10237582 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300005529|Ga0070741_10917475 | Not Available | 756 | Open in IMG/M |
| 3300005536|Ga0070697_100199385 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300005537|Ga0070730_10003943 | All Organisms → cellular organisms → Bacteria | 13169 | Open in IMG/M |
| 3300005542|Ga0070732_10889815 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005542|Ga0070732_11039932 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300005561|Ga0066699_10028529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3195 | Open in IMG/M |
| 3300005713|Ga0066905_100895274 | Not Available | 776 | Open in IMG/M |
| 3300005764|Ga0066903_106022911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 635 | Open in IMG/M |
| 3300005764|Ga0066903_106335650 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005764|Ga0066903_108798587 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005844|Ga0068862_101740148 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006052|Ga0075029_100912771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 603 | Open in IMG/M |
| 3300006163|Ga0070715_10863170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300006173|Ga0070716_101375119 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300006794|Ga0066658_10031100 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300006796|Ga0066665_10250798 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300006797|Ga0066659_11491501 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006800|Ga0066660_10581406 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300006845|Ga0075421_101733719 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006854|Ga0075425_101871997 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300007076|Ga0075435_100141579 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300009012|Ga0066710_101127496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1213 | Open in IMG/M |
| 3300009012|Ga0066710_101882810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300009038|Ga0099829_11425783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300009089|Ga0099828_10857305 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300009093|Ga0105240_10207323 | All Organisms → cellular organisms → Bacteria | 2293 | Open in IMG/M |
| 3300009093|Ga0105240_11781652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300009093|Ga0105240_12572567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009101|Ga0105247_10823737 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300009137|Ga0066709_101378273 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300009137|Ga0066709_104139232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300009137|Ga0066709_104655500 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300009148|Ga0105243_11529580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300009522|Ga0116218_1014523 | All Organisms → cellular organisms → Bacteria | 3481 | Open in IMG/M |
| 3300009616|Ga0116111_1066018 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300009826|Ga0123355_11047737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300010046|Ga0126384_11014847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300010048|Ga0126373_11540246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300010159|Ga0099796_10240404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300010335|Ga0134063_10080553 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300010335|Ga0134063_10262448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300010358|Ga0126370_10265958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1339 | Open in IMG/M |
| 3300010358|Ga0126370_11207461 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 704 | Open in IMG/M |
| 3300010360|Ga0126372_10869354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300010366|Ga0126379_10817075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300010366|Ga0126379_11104315 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010366|Ga0126379_11160238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300010366|Ga0126379_12324615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300010376|Ga0126381_100943373 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300010376|Ga0126381_103632769 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010379|Ga0136449_100424355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2347 | Open in IMG/M |
| 3300010397|Ga0134124_12648455 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300011020|Ga0138602_114712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 505 | Open in IMG/M |
| 3300011270|Ga0137391_10460511 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300011270|Ga0137391_10874480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300012189|Ga0137388_11750143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300012198|Ga0137364_10127795 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300012202|Ga0137363_10044341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3152 | Open in IMG/M |
| 3300012202|Ga0137363_10360791 | All Organisms → cellular organisms → Bacteria | 1204 | Open in IMG/M |
| 3300012202|Ga0137363_11249372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300012203|Ga0137399_10728453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 835 | Open in IMG/M |
| 3300012206|Ga0137380_11064351 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300012210|Ga0137378_11651644 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012211|Ga0137377_11743994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300012349|Ga0137387_10321586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1119 | Open in IMG/M |
| 3300012349|Ga0137387_11077293 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300012351|Ga0137386_11103737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012357|Ga0137384_10809893 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300012357|Ga0137384_10859766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012359|Ga0137385_10225011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1631 | Open in IMG/M |
| 3300012361|Ga0137360_11570419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300012362|Ga0137361_10767291 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012363|Ga0137390_11213328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300012363|Ga0137390_11720775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300012918|Ga0137396_10541052 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012924|Ga0137413_10855621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300012948|Ga0126375_11445387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 585 | Open in IMG/M |
| 3300012971|Ga0126369_10217511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1856 | Open in IMG/M |
| 3300012976|Ga0134076_10175515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300012977|Ga0134087_10394083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300014160|Ga0181517_10505488 | Not Available | 611 | Open in IMG/M |
| 3300014166|Ga0134079_10712773 | Not Available | 513 | Open in IMG/M |
| 3300014968|Ga0157379_11228861 | Not Available | 721 | Open in IMG/M |
| 3300015193|Ga0167668_1002747 | All Organisms → cellular organisms → Bacteria | 3789 | Open in IMG/M |
| 3300015264|Ga0137403_10585313 | Not Available | 982 | Open in IMG/M |
| 3300015357|Ga0134072_10116727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300015371|Ga0132258_11825952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1531 | Open in IMG/M |
| 3300016270|Ga0182036_10814958 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 761 | Open in IMG/M |
| 3300016319|Ga0182033_11314338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300016387|Ga0182040_11203789 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300016404|Ga0182037_11873179 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300016422|Ga0182039_10982514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300017936|Ga0187821_10490778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300017939|Ga0187775_10322508 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300017942|Ga0187808_10088220 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300017970|Ga0187783_11289875 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018006|Ga0187804_10118999 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300018047|Ga0187859_10459752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300018062|Ga0187784_11610303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300018063|Ga0184637_10279583 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1014 | Open in IMG/M |
| 3300018468|Ga0066662_12525133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300019275|Ga0187798_1555335 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300020579|Ga0210407_10493463 | Not Available | 957 | Open in IMG/M |
| 3300020580|Ga0210403_10534940 | Not Available | 950 | Open in IMG/M |
| 3300021168|Ga0210406_10176784 | All Organisms → cellular organisms → Bacteria | 1781 | Open in IMG/M |
| 3300021406|Ga0210386_10457808 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300021407|Ga0210383_10641747 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300021420|Ga0210394_11713613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300021474|Ga0210390_10871374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 742 | Open in IMG/M |
| 3300021559|Ga0210409_11159362 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300021560|Ga0126371_12954963 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025900|Ga0207710_10393684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300025904|Ga0207647_10048841 | All Organisms → cellular organisms → Bacteria | 2627 | Open in IMG/M |
| 3300025906|Ga0207699_11023699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300025909|Ga0207705_11023176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300025912|Ga0207707_10018890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6011 | Open in IMG/M |
| 3300026089|Ga0207648_11535681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300026121|Ga0207683_10618748 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300026323|Ga0209472_1055879 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300026528|Ga0209378_1272970 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026551|Ga0209648_10062862 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
| 3300026551|Ga0209648_10557037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300026557|Ga0179587_11113174 | Not Available | 520 | Open in IMG/M |
| 3300027173|Ga0208097_1034701 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027471|Ga0209995_1094903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300027591|Ga0209733_1132792 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300027604|Ga0208324_1019896 | All Organisms → cellular organisms → Bacteria | 2081 | Open in IMG/M |
| 3300027604|Ga0208324_1132078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 686 | Open in IMG/M |
| 3300027824|Ga0209040_10343928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300027862|Ga0209701_10374020 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300027875|Ga0209283_10090209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1996 | Open in IMG/M |
| 3300027875|Ga0209283_10954126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300027882|Ga0209590_10757448 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300027889|Ga0209380_10862426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300027903|Ga0209488_10043928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3281 | Open in IMG/M |
| 3300027905|Ga0209415_11018287 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300027908|Ga0209006_10470452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300028420|Ga0210366_10339916 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300028597|Ga0247820_10885638 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300028666|Ga0265336_10149672 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300029944|Ga0311352_11102351 | Not Available | 607 | Open in IMG/M |
| 3300030058|Ga0302179_10199960 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 882 | Open in IMG/M |
| 3300030969|Ga0075394_10948744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300031231|Ga0170824_120577790 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300031236|Ga0302324_100492211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300031548|Ga0307408_101836294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300031573|Ga0310915_10094826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2006 | Open in IMG/M |
| 3300031736|Ga0318501_10566683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300031753|Ga0307477_11129495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300031819|Ga0318568_10084573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1883 | Open in IMG/M |
| 3300031879|Ga0306919_10110616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1950 | Open in IMG/M |
| 3300031880|Ga0318544_10165948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300031890|Ga0306925_10074481 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3576 | Open in IMG/M |
| 3300031910|Ga0306923_12342354 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300031910|Ga0306923_12399037 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300031941|Ga0310912_10918304 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
| 3300032059|Ga0318533_11288498 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300032094|Ga0318540_10554307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300032160|Ga0311301_11845363 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300032174|Ga0307470_11690521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300032180|Ga0307471_100355663 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 1577 | Open in IMG/M |
| 3300032261|Ga0306920_100932550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300032261|Ga0306920_103899316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300032783|Ga0335079_10191043 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
| 3300032783|Ga0335079_10395966 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300032783|Ga0335079_12132377 | Not Available | 536 | Open in IMG/M |
| 3300033134|Ga0335073_10589398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1245 | Open in IMG/M |
| 3300033134|Ga0335073_10627829 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300033134|Ga0335073_11849161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300033158|Ga0335077_10109335 | All Organisms → cellular organisms → Bacteria | 3231 | Open in IMG/M |
| 3300033158|Ga0335077_10310787 | All Organisms → cellular organisms → Bacteria | 1722 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.21% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.16% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.63% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.58% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.05% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.53% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.53% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.53% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.53% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.53% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011020 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 78 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027173 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF036 (SPAdes) | Environmental | Open in IMG/M |
| 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028420 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A001DRAFT_10341711 | 3300000893 | Forest Soil | NTTEPLLAAMKFYEKQGYSRTGRVADFFGMRLIEYAKEFGETHD* |
| C688J14111_101992512 | 3300001305 | Soil | RVGLDTTDPLERAIRFYEKNGYRRTGHIEDFFGMPLHEFVKELK* |
| JGI12269J14319_101002203 | 3300001356 | Peatlands Soil | DTTLPLQAAMKFYEKNGYRRSANIADFFGMPLLEYIKQL* |
| JGI12712J15308_102115491 | 3300001471 | Forest Soil | CSRVSLDTTSVLQRALRFYEKQGFCRSGKVADFFGMELIEYVKALAPGLDV* |
| JGI12053J15887_102780802 | 3300001661 | Forest Soil | LDTTEPLLRAMRFYEKNGFTRSGKITGFFGMPLIEYAKQ* |
| Ga0062389_1013190071 | 3300004092 | Bog Forest Soil | SVETELRARGCSRVSLDTTSVLQRAMRFYERHEFRRSGRISDFFGMELIEYVKVLR* |
| Ga0062389_1032182421 | 3300004092 | Bog Forest Soil | EFELRARGCQRVTLDTTQPLERAMRFYEKSGYRRSGKVSDFFGMPLVEYAKPLQP* |
| Ga0063455_1015319822 | 3300004153 | Soil | RITLDTTFPLEAAMKFYEKHGYSKSGRLSDFFGMPLIEYVKNLRDT* |
| Ga0062388_1013342542 | 3300004635 | Bog Forest Soil | DTTAPLWRAVRFYQRHGFVPSGKVTDFFGMPLYEYVKPLHEN* |
| Ga0066673_108820561 | 3300005175 | Soil | TLDTTEPLQRAVRFYEKHGFRPSGRVSDFFGMPLYQYVKLL* |
| Ga0066679_100861523 | 3300005176 | Soil | HLRAAGCKRASLDTTAPLERAIRFYAKHGYRASGKVGDFFGMPLYEYVREL* |
| Ga0066690_104868082 | 3300005177 | Soil | RNCKRVTLDTTEPLQRAMRFYEKNGYRRSGRISDFFGMPLYEYVKAL* |
| Ga0070658_111392542 | 3300005327 | Corn Rhizosphere | GLLDCAQNELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS |
| Ga0066388_1017326393 | 3300005332 | Tropical Forest Soil | QRCTHVTLDTTEPLARAMRFYARHGFTLSGRVSDFFGMPLHEWVKFL* |
| Ga0070714_1005682433 | 3300005435 | Agricultural Soil | SRCAVITLDTTEPLIRAIEFYKRHGFIASGRVTDFFGMPLYEYTKGLH* |
| Ga0070713_1011697872 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GCERITLDTTEPLIQATRFYERNGFLRTGKISDFFGMPLIEYAKESAALLG* |
| Ga0070678_1005771072 | 3300005456 | Miscanthus Rhizosphere | QNELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS* |
| Ga0070681_100895591 | 3300005458 | Corn Rhizosphere | CAQNELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS* |
| Ga0070741_102375823 | 3300005529 | Surface Soil | VTLDTTEPLVSAMRFYERNGFRRTGKISDFFGMSLIEYAKQLREPN* |
| Ga0070741_109174751 | 3300005529 | Surface Soil | VTLDTTEPLRRAARFYEKCGYRRSGVTTDFFGMPLTEFEKVLAPIQQ* |
| Ga0070697_1001993851 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RITLDTTLPLEAAMRFYEKNGYHRSGNILDFFGMPLIEYEKRL* |
| Ga0070730_100039433 | 3300005537 | Surface Soil | MELRLSGCVRITLDTTEPLERAMRFYEKNGYRRSGRVSDFFEMPLIEYQKTLP* |
| Ga0070732_108898152 | 3300005542 | Surface Soil | RITLDTTLPLVSAMKFYERNGYRRSGNISDFFGMPLIEYEKQLS* |
| Ga0070732_110399322 | 3300005542 | Surface Soil | TTEPLAAAIAFYEKHGYRRSGSVSDFFGMPLIEYVKRL* |
| Ga0066699_100285294 | 3300005561 | Soil | TTEPLRRAIRFYERNEFRPSGSVGDFFGMPLAEYVKEIGQIATSSA* |
| Ga0066905_1008952741 | 3300005713 | Tropical Forest Soil | LRERSCTRISLDTTEPLARAVRFYRGQGFRASGTVRDYFGMPLLEYVKELA* |
| Ga0066903_1060229111 | 3300005764 | Tropical Forest Soil | GCRRITLDTTAPLERAMTFYVKHGYRPSGTIRDFFGMPLFEYVKTL* |
| Ga0066903_1063356502 | 3300005764 | Tropical Forest Soil | LDTTAPLTRAIRFYERNGYVRSGVVSDFFGMPLYEYEKWLQSCK* |
| Ga0066903_1087985871 | 3300005764 | Tropical Forest Soil | LDTTAPLTRAIRFYERNGYVRSGIVSDFFGMPLYEYEKWLPCSK* |
| Ga0068862_1017401482 | 3300005844 | Switchgrass Rhizosphere | RITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS* |
| Ga0075029_1009127711 | 3300006052 | Watersheds | TLDTTQPLERAMRFYEKHGYRRSGKVSDFFGMPLVEYVKPVLA* |
| Ga0070715_108631702 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RRVTLDTTLPLSAAMKFYENHGYRKSGQVMDFFGMPLVEYVKELF* |
| Ga0070716_1013751192 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | CTRVKLDTTEPLQQAMRFYQKLGFRRTGHVGDFFGMRLHEYVKQL* |
| Ga0066658_100311004 | 3300006794 | Soil | VSLDTTEPLQRAMRFYEKNGFERTGKVTDFFGMPLIEYVKHLRVC* |
| Ga0066665_102507981 | 3300006796 | Soil | TLDTTEPLQRAVRCYEKHGFRPSGRVSDFFGMPLYQYVKLL* |
| Ga0066659_114915011 | 3300006797 | Soil | DTTDPLQRAVRFYMKHGYRPSGRVTDFFGMPLHEYVKQLST* |
| Ga0066660_105814061 | 3300006800 | Soil | GCTRVTLDTTLPLLAAMKFYEKHGYSRSGRRSDFFGMPLIEYVKQLD* |
| Ga0075421_1017337191 | 3300006845 | Populus Rhizosphere | LRLRKCSRMTLDTTQPLLRAIRFYERNGFRPSGRISDFFGMPLFEYVKNLAPE* |
| Ga0075425_1018719972 | 3300006854 | Populus Rhizosphere | GCSRVTLDTTAPLQRAIHFYEKNGYRRSGKVGDFFGMPLYEYVKDLLPTTGTPSTDNDAR |
| Ga0075435_1001415791 | 3300007076 | Populus Rhizosphere | KDSGCARVTLDTTLPLGAAIKFYEKNGYRRSGQVTDFFGMPLVEYVKELA* |
| Ga0066710_1011274962 | 3300009012 | Grasslands Soil | ITLDTTLPLATAMKFYEKHGYHRSGNIGDFFGMPLIEYERNL |
| Ga0066710_1018828101 | 3300009012 | Grasslands Soil | LDTTDPLERARHFYEKRGYRRSGRVTDFFGMPLTEYVKTL |
| Ga0099829_114257832 | 3300009038 | Vadose Zone Soil | TEPLRRAMRFYERNGYERSGKIADFFGMALIEYVKNL* |
| Ga0099828_108573051 | 3300009089 | Vadose Zone Soil | ITLDTTEPLKRAMRFYEKHGYRRSGRISDFFGMPLFEYQKPSLREDTPGS* |
| Ga0105240_102073234 | 3300009093 | Corn Rhizosphere | RITLDTTEPLKRAIRFYERNGFCATGRTEDFFGMSLYEYAKRY* |
| Ga0105240_117816522 | 3300009093 | Corn Rhizosphere | RITLDTTEPLKRAIRFYERNGFCATGRTEDFFGMSLYEYAKAVLSPQN* |
| Ga0105240_125725672 | 3300009093 | Corn Rhizosphere | KGLLDCAQNELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS* |
| Ga0105247_108237372 | 3300009101 | Switchgrass Rhizosphere | TLDTTEPLQRAMRFYEKHGYQKSGTVTDFFGMRLHEYVKNSK* |
| Ga0066709_1013782731 | 3300009137 | Grasslands Soil | DTTEPLQRAMRFYEKHGFRSSGKVSQFFGMPLYEYIKELS* |
| Ga0066709_1041392321 | 3300009137 | Grasslands Soil | LKDHGCRRVTLDTTLPVSAAMKFYENNGYRKSGQVMDFFGMPLVEYVKELD* |
| Ga0066709_1046555001 | 3300009137 | Grasslands Soil | VMLDTMLPLQTAIKFYEKNGYRRSRRIEDFFGMPLLEYVKELG* |
| Ga0105243_115295802 | 3300009148 | Miscanthus Rhizosphere | KQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS* |
| Ga0116218_10145231 | 3300009522 | Peatlands Soil | QGCRRVTLDTTQPLERAMRFYEKNGYQRSDKVSDFFGMPLVEYVKPVLA* |
| Ga0116111_10660182 | 3300009616 | Peatland | RRCVRITLDTTEPLRRAVRFYERNGYRPSGRVMDFYGMPLYEYAKG* |
| Ga0123355_110477371 | 3300009826 | Termite Gut | CSQITLDTTEPLRRAMHFYERHGYRRSGKVGDFFGMPLVEFAKVLRAKS* |
| Ga0126384_110148472 | 3300010046 | Tropical Forest Soil | AELRRHNRRRVTLDTTEPLKRAIRFYEKNGFRATGKIADFFGMRLFEYEKSL* |
| Ga0126373_115402461 | 3300010048 | Tropical Forest Soil | VTLDTTAPLTRAIRFYERNGYVRSGIVSDFFGMPLYEYEKWLPCSK* |
| Ga0099796_102404041 | 3300010159 | Vadose Zone Soil | LRNRKCSCVSLDATAPLQRAMRFYERNGYQRSGKVTDFFGMTLIEYIKEL* |
| Ga0134063_100805533 | 3300010335 | Grasslands Soil | LDTTEPLQRATRFYEKQGFRASGRIADFFGMRLHEYVKQL* |
| Ga0134063_102624481 | 3300010335 | Grasslands Soil | HVTLDTTQPLITAMRFYEKHGYSRSGRASDFFGMPLIEYVKQIG* |
| Ga0126370_102659584 | 3300010358 | Tropical Forest Soil | GLDTTAPLKRAVRFYEKSGYSATGKVSDFFGMPLFEYVKRLR* |
| Ga0126370_112074611 | 3300010358 | Tropical Forest Soil | TLDTTEPLARAMRFYARHGFTLSGRVSDFFGMPLHEWVKFL* |
| Ga0126372_108693542 | 3300010360 | Tropical Forest Soil | QEMLCRGCARVTLDTTEPLERAMRFYEKHGYRRSERISDFFGMPLIEYQKTLP* |
| Ga0126379_108170752 | 3300010366 | Tropical Forest Soil | DRGCTHVTLDTTEPLNRAMRFYQKHGFTPSGRVSDFFGMNLYEYKKSW* |
| Ga0126379_111043152 | 3300010366 | Tropical Forest Soil | TLDTTEPLERAMRFYERNGFVRSGKVQDFFGMRLIQYEKVMRS* |
| Ga0126379_111602381 | 3300010366 | Tropical Forest Soil | QCCSRITLDTTEPLQRAMRFYERHGYERSGKVGDFFGMPLIEYEKHIRAKI* |
| Ga0126379_123246152 | 3300010366 | Tropical Forest Soil | LDTTEPLRRAMRFYEKHGYRPSGRITDFFGMPLHEYVKAIGTVQR* |
| Ga0126381_1009433734 | 3300010376 | Tropical Forest Soil | SRITLDTTEPLERATRFYSKHGYRSSGNITDFFGMPLYEYAKELLKDT* |
| Ga0126381_1036327691 | 3300010376 | Tropical Forest Soil | ITLDTTEPLLAAMKFYEKYGYRRSGRVSDFFGMTLLEYAKELRG* |
| Ga0136449_1004243553 | 3300010379 | Peatlands Soil | GCNRITLDTTLPLQAAMKFYEKNGYRRSANIADFSGMPLLEYVKQL* |
| Ga0134124_126484551 | 3300010397 | Terrestrial Soil | THVTLDTTEPLKRAAAFYQKHGYRRSGRVSDFYGMKLIEYEKHLVSSADQG* |
| Ga0138602_1147122 | 3300011020 | Peatlands Soil | QPLERAMRFYEKNGYRRSGKVSDFFGMPLVEYVKPVLT* |
| Ga0137391_104605112 | 3300011270 | Vadose Zone Soil | RVTLDTTEPLLRAMRFYEKHGYCKSGRVIDFFGMPLHEYVKSL* |
| Ga0137391_108744801 | 3300011270 | Vadose Zone Soil | RVSLDTTEPLRRAMRFYERNGYERSGKIADFFGMALIEYVKKL* |
| Ga0137388_117501432 | 3300012189 | Vadose Zone Soil | DTTEPLKRAVAFYEKNGYRPSGKITDFFGMRLYEYAKTLR* |
| Ga0137364_101277951 | 3300012198 | Vadose Zone Soil | ACTRVTLDTTGPLQRAAHFYEKCGYERTGRVTDFFGMPLFEYAKSLLSTPC* |
| Ga0137363_100443411 | 3300012202 | Vadose Zone Soil | GCTRISLDTTEPLRRAMRFYEKNGFRRTGKVTDFFGMPLIEYLKHL* |
| Ga0137363_103607911 | 3300012202 | Vadose Zone Soil | EGCARISLDTTEPLRRAMRFYEKNGFRRTGKVSDFFGMSLIEYLKHLPLAKFI* |
| Ga0137363_112493723 | 3300012202 | Vadose Zone Soil | RKQGCIRVTLNTALPLHAAMRFYERNGYVRSGRTSDFFGMTLVEYVKAL* |
| Ga0137399_107284533 | 3300012203 | Vadose Zone Soil | LDTTTPLQRATRFYEKHGYRRSGKVTDFFGMELFEYVKELGV* |
| Ga0137380_110643511 | 3300012206 | Vadose Zone Soil | SLDTTEPLRRAMRFYEKNGFQRTGKVADFFGMPLIEYLKHR* |
| Ga0137378_116516442 | 3300012210 | Vadose Zone Soil | QGLLETTQKHLIAAGCTRISLDTTEPLQRAMCFYEKNGFHLTGKVSDFLGMPLIEYAKDL |
| Ga0137377_117439941 | 3300012211 | Vadose Zone Soil | MRISLDTTEPLQRAMRFYEKNGFQRTGNVADFFGMPLIEYLKRL* |
| Ga0137387_103215862 | 3300012349 | Vadose Zone Soil | SLDTTEPLLRAMRFYEKDGFQRTGKVADFFGMPLIEYLKHL* |
| Ga0137387_110772931 | 3300012349 | Vadose Zone Soil | ISLDTTEPLQRAMCFYEKNGFHLTGKVSDFFGMPLIEYAKDL* |
| Ga0137386_111037371 | 3300012351 | Vadose Zone Soil | GNGCVRISLDTTRPLQRAIRFYEKHGFRSSGKVSDFFGMPLHEYIKELS* |
| Ga0137384_108098932 | 3300012357 | Vadose Zone Soil | AQGCTRISLDTTEPLQRAMCFYEKNGFHLTGKVSDFFGMPLIEYAKDL* |
| Ga0137384_108597662 | 3300012357 | Vadose Zone Soil | TLPLQAAIKFYEKNGYRRSGQIADFFGIPLVEYVKELV* |
| Ga0137385_102250111 | 3300012359 | Vadose Zone Soil | RISLDTTEPLYRAMRFYEKNGFQRTAKVADFFGMPLIEFVKHFPPR* |
| Ga0137360_115704191 | 3300012361 | Vadose Zone Soil | LRNRKCSRVSLDTTAPLRRAMRFYERNGYQRSGKVTDFFGMTLIEYIKKL* |
| Ga0137361_107672911 | 3300012362 | Vadose Zone Soil | AQQLLEREELELRERKCLRVSLDTTEPLRRAMRFYERNGYERSGKVADFFGMALIEYVKKV* |
| Ga0137390_112133281 | 3300012363 | Vadose Zone Soil | ARKCERITLDTTEYLKRAIRFYERNGYRASGKISDFFGMAIHEYIKDVGSGLNAG* |
| Ga0137390_117207752 | 3300012363 | Vadose Zone Soil | CSRVTLDTTEPLRRAMRFYERNGYERSGKVADFFDMALIEYVKKV* |
| Ga0137396_105410522 | 3300012918 | Vadose Zone Soil | SELRERKCSRVSLDTTEPLRRAMRFYERNGYQRSGNVKDFFGMVMMEYIKKL* |
| Ga0137413_108556211 | 3300012924 | Vadose Zone Soil | SRVSLDTTAPLQRAMRFYERNGYQRSGKVTDFFGMTLIEYIKEL* |
| Ga0126375_114453871 | 3300012948 | Tropical Forest Soil | PLARAMRFYARHGFTLSGRVSDFFGMLLHEWVKFL* |
| Ga0126369_102175111 | 3300012971 | Tropical Forest Soil | LAGCTRVTLDTTAPLRRAIRFYEKHGYRATGRVTDFFGMPLYEYEKKLGTGSSGSPQLR* |
| Ga0134076_101755152 | 3300012976 | Grasslands Soil | SLDTTRPLQRAIRFYEKHGFRSSGKVSDFFGMPLYEYIKELR* |
| Ga0134087_103940831 | 3300012977 | Grasslands Soil | RVTLDTTEPLRRAIRFYERNGFRPSGNVGDFFGMPLVEYVKKIGQVATS* |
| Ga0181517_105054882 | 3300014160 | Bog | ADAELRRRGCSIISLDTTAPLGRAMRFYEKNGFRRSGKVTDFFGMPLYEFVKSLEP* |
| Ga0134079_107127732 | 3300014166 | Grasslands Soil | CKRVSLDTTAPLERAIHFYTKHGYRVSGKVGDFFGMPLYEYRKLLL* |
| Ga0157379_112288611 | 3300014968 | Switchgrass Rhizosphere | EIARANCSRIILDTTEPLQRAMRFYERHGYRRSGRTQDFFGMLLIEYVKIMTRED* |
| Ga0167668_10027472 | 3300015193 | Glacier Forefield Soil | MKRITLDTTEPLNRAIRFYEKNGYRPTGKIGRFYGMPLLEYSKAI* |
| Ga0137403_105853131 | 3300015264 | Vadose Zone Soil | PLKAAISFYEKAGYCYSGKTADFFGMPLLEYVKQL* |
| Ga0134072_101167272 | 3300015357 | Grasslands Soil | WLKDQGCRRVTLDTTLPLSAAMKFYENNGYRKSGQITDFFGMPLVEYVKELN* |
| Ga0132258_118259521 | 3300015371 | Arabidopsis Rhizosphere | ITLDTTEPLQRAMRFYERHGYGRSGKIGDFFGMPLIEYVKELTRRAH* |
| Ga0182036_108149581 | 3300016270 | Soil | TEPLARAMRFYAHHGFTLSGVSDFFGMPLREWVKFL |
| Ga0182033_113143381 | 3300016319 | Soil | LDTTEPLERAMHFYERHGYRRSGKVGDFFGMPLIEFVKGLRAKS |
| Ga0182040_112037891 | 3300016387 | Soil | VTLDTTEPLNRAMRFYQKHGFTPSGRVSDFFGMNLYEYKKSL |
| Ga0182037_118731791 | 3300016404 | Soil | TLDTTQPLARAMRFYARHGFRLSGRVSDFFGMPLQEWVKFL |
| Ga0182039_109825142 | 3300016422 | Soil | WERKCSRIRLETTAPLRRAMRFYERNGFRPSGTVTDFFGMPLFEYVKPVG |
| Ga0187821_104907782 | 3300017936 | Freshwater Sediment | CKRISLDTTAPLVRAMRFYEKNGFQRSGKVTDFFGMPLFEFVKIVRA |
| Ga0187775_103225081 | 3300017939 | Tropical Peatland | RGCQRLTLDTTAPLKRAMRFYERNGYRPSGKVGDYHGMPLFEYVKALRGRSD |
| Ga0187808_100882201 | 3300017942 | Freshwater Sediment | RRITLDTTLPLARATRFYEKNGFRKSGRIADYFGMPLVEYFRELA |
| Ga0187783_112898752 | 3300017970 | Tropical Peatland | DTTQPLQRAISFYKKHGYRASGKAADFFGMPLFEYVKKLDLE |
| Ga0187804_101189993 | 3300018006 | Freshwater Sediment | CKRITLDTTLPLKAAMKFYEKNGYRRSGNIADFFGMPLLEYVKQL |
| Ga0187859_104597521 | 3300018047 | Peatland | CGRITLDTTEPLHRAMRFYEKHGYRRSGRVTDFFGMGLCEFVKELRVPGAR |
| Ga0187784_116103032 | 3300018062 | Tropical Peatland | VRSKCSRITLDTTEPLQRATRFYEKNGYRASGKITDFFGMPLHEYVKELTGGS |
| Ga0184637_102795832 | 3300018063 | Groundwater Sediment | LDTTQPLERAIRFYERRGYEATGRVTDFFGMALFEYAKSLRGGTAA |
| Ga0066662_125251332 | 3300018468 | Grasslands Soil | AAEAELKRQGCSRATRDTTEPLQRATRFYEKQGFRSSGRISDLFGMPLHEYVKQL |
| Ga0187798_15553354 | 3300019275 | Peatland | MTNERFLERAMRFYEKHGNRRSGKVSDFFGMPLFEYVKLLA |
| Ga0210407_104934633 | 3300020579 | Soil | ITLDTTLPLQRAIRFYESHGYRHSGITANFFGMVLYEYAKEGSGLAG |
| Ga0210403_105349403 | 3300020580 | Soil | GCHRITLDTTLPLQRAIRFYESHGYRHSGITANFFGMVLYEYAKEGSGLAG |
| Ga0210406_101767843 | 3300021168 | Soil | RQNCTRITLDTTVPLERAMRFYEKSGYRRSGKTADFFGMPLFEYEKRRSTKT |
| Ga0210386_104578081 | 3300021406 | Soil | HVSLDTTLPLQPAMKFYEKHGYLRSGCITDFFGMHLIEYVKMLG |
| Ga0210383_106417472 | 3300021407 | Soil | LDTTEPLRAAIAFYEKHGYRRSGNVSDFFAMPLIEYVKVL |
| Ga0210394_117136131 | 3300021420 | Soil | SQGCKRITLDTTLPLQPAMKFYEKNGYQRSGNITDFFAMPLIEYFKQL |
| Ga0210390_108713743 | 3300021474 | Soil | EASLAERGCVRVTLDTTQVLSRAKRFYERNGYRLSGIVTDFFGMPLYEFFKNLT |
| Ga0210409_111593621 | 3300021559 | Soil | RGCKRITLDTTLPLQAAMKFYEKNGYRRSAKIADFFGMPLLEYVKQL |
| Ga0126371_129549632 | 3300021560 | Tropical Forest Soil | KGCRRITLDTTEPLERAMRFYERNGFRRSGKVQDFFGMSLMEYEKAVGPR |
| Ga0207710_103936842 | 3300025900 | Switchgrass Rhizosphere | TLDTTEPLQRAMRFYEKHGYQKSGTVTDFFGMRLHEYVKNSK |
| Ga0207647_100488414 | 3300025904 | Corn Rhizosphere | RITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS |
| Ga0207699_110236992 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TLDTTEPLVSAMRFYERNGFRRTGKISDFFGMSLIEYAKQLREPN |
| Ga0207705_110231762 | 3300025909 | Corn Rhizosphere | GCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS |
| Ga0207707_100188901 | 3300025912 | Corn Rhizosphere | NELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS |
| Ga0207648_115356811 | 3300026089 | Miscanthus Rhizosphere | TLDTTEPLRRAVRFYERNGYRASGRVTAFFGMPLFEYVKRLES |
| Ga0207683_106187482 | 3300026121 | Miscanthus Rhizosphere | AQNELKQLGCERITLDTTEPLISAIRFYEWNGFRRTGKVSDFFGMRLIEYAKAIS |
| Ga0209472_10558791 | 3300026323 | Soil | VTLDTTQPLITAMRFYEKHGYSRSGRASDFFGMPLIEYVKQIG |
| Ga0209378_12729701 | 3300026528 | Soil | SWLNDYGCKRVTLNTTLPLQPAIKFYEKNGYTRSGRIADFFGMPLVEYVKELV |
| Ga0209648_100628625 | 3300026551 | Grasslands Soil | GGCTRISLDTTETLLRAMRFYEKNGFQRTGKVSDFFGMPLIEYLKHR |
| Ga0209648_105570372 | 3300026551 | Grasslands Soil | ITLDTTEPLNRAIRFYEKNGFRPTGKIGRFFGMPLIEFSKPIGR |
| Ga0179587_111131742 | 3300026557 | Vadose Zone Soil | RVALDTTLPLKTAISFYEKAGYCYLGKTADFFGMPLLEYVKQL |
| Ga0208097_10347012 | 3300027173 | Forest Soil | GCKRITLDTTLPLQAAMKFYEKNGYCRSAKIADFFGMPLLEYVKQL |
| Ga0209995_10949031 | 3300027471 | Arabidopsis Thaliana Rhizosphere | LDTTAPLERAIAFYEKHGYRASGKVSDFFGMPLYEYAKELG |
| Ga0209733_11327921 | 3300027591 | Forest Soil | TAPLERAMRFYEKFGFHRSGKITDFFGMPLFEFAKLLPSSGTPAE |
| Ga0208324_10198961 | 3300027604 | Peatlands Soil | VTLDTTQPLERAMRFYEKNGYQRSDKVSDFFGMPLVEYVKPVLA |
| Ga0208324_11320781 | 3300027604 | Peatlands Soil | CHRITLDTTQPLERAMRFYEKNGYRRSGKVSDFFGMPLVEYVKPVLT |
| Ga0209040_103439282 | 3300027824 | Bog Forest Soil | DELVRRKCERITLDTTEPLQRATRFYEKRGYRRSGKVSDFFAMRLHEYVKELRRSSPG |
| Ga0209701_103740201 | 3300027862 | Vadose Zone Soil | EPLKRAMRFYEKHGYRRSGKISDFFGMPLFEYQKPLPREDTPGS |
| Ga0209283_100902091 | 3300027875 | Vadose Zone Soil | CTRISLDTTEPLQGAMRFYEKNGFQRTGKVTDFFGMPLIEYVKRL |
| Ga0209283_109541262 | 3300027875 | Vadose Zone Soil | ECLRISLDTTEPLRQAIRFYEKCGFSPSGKIADFFGMPLLEYVKTLPG |
| Ga0209590_107574482 | 3300027882 | Vadose Zone Soil | KCTRITLDTTEPLKRAMRFYEKHGYRRSGKISDFFGMPLFEYYKPLVREDTPGS |
| Ga0209380_108624262 | 3300027889 | Soil | QPLQTAMHFYEKNGFRRSGKIKDFFGMPLFEYVKALAD |
| Ga0209488_100439281 | 3300027903 | Vadose Zone Soil | SRITLDTTAPLQRAIRFYEKNGFHRSGVVGDFFGMPLFEYVKKLDGDST |
| Ga0209415_110182871 | 3300027905 | Peatlands Soil | TQPLERAMRFYEKNGYRRSGNAGDFFGMPLVEYVKPVLT |
| Ga0209006_104704522 | 3300027908 | Forest Soil | TRGCSWISLDTTEPLIAAQRFYEKNGYSRSGKITDFFGMPLIEYVKTLTS |
| Ga0210366_103399161 | 3300028420 | Estuarine | SLDTTEPLARAIAFYEKHGYRASGRVSDFFGMPLYEYTKALA |
| Ga0247820_108856381 | 3300028597 | Soil | RVTLDTTEPLHKAMRFYGKHGYVLSGRVTDFFGMPLHEYVKPLVP |
| Ga0265336_101496722 | 3300028666 | Rhizosphere | RQNGSRITLDTTEPLQRAMRFYEKHGYRRSGKTTDFFGMPLHEYVKNAER |
| Ga0311352_111023512 | 3300029944 | Palsa | ISLDTTAVLQRAMRFYEKQGFRRSGRITDFFGMELIEYVKALR |
| Ga0302179_101999602 | 3300030058 | Palsa | TLDVTAPLQRAARFYEKNGFVATGVTGDFFGMPLYEYVKQLK |
| Ga0075394_109487441 | 3300030969 | Soil | ITLYTTEPLERAMRFYERHGFRRSEEVRDFFGMPLIEYVKEVTAGG |
| Ga0170824_1205777903 | 3300031231 | Forest Soil | ADLIQQNCTCITLDTTDPLQRAMRFYEKHGYRRSGRSSDFFGMPLHEYMKDL |
| Ga0302324_1004922111 | 3300031236 | Palsa | ELSSLGCTRVSLDATLPLQRAMRFYEKHGFQKSGQITDFFGMNVVEYVKDLSTLRR |
| Ga0307408_1018362941 | 3300031548 | Rhizosphere | LDTTAPLRPAVAFYQKYGYRRSGRVSEFFGMPLYEFEKRG |
| Ga0310915_100948261 | 3300031573 | Soil | HITLDTTEPLERAMHFYERHGYRRSGKVGDFFGMPLIEFVKGLRAKS |
| Ga0318501_105666831 | 3300031736 | Soil | TTEPLLRAMRFYEKHGYRRSGKTKGFFGMPLIEYQKALL |
| Ga0307477_111294952 | 3300031753 | Hardwood Forest Soil | TEPLQRAMHFYEKFGFRRSGRISDFFGMPLVEYHKPLPPDV |
| Ga0318568_100845733 | 3300031819 | Soil | RLNCSRITLDTTKPLQRAMRFYERHGYQRSGKISDFFGMPLIEYVKELPAKR |
| Ga0306919_101106165 | 3300031879 | Soil | KRVTLNTTEPLARAMRFYERHGFSRSGRVSDFFGMPLHEWVKFL |
| Ga0318544_101659482 | 3300031880 | Soil | LHQRKCTRITLDTTEPLLRAMRFYEKHGYRRSGKTKGFFGMPLIEYQKALL |
| Ga0306925_100744811 | 3300031890 | Soil | LDTTQPLARAMRFYARHGFRLSGRVSDFFGMPLYEWVKFL |
| Ga0306923_123423542 | 3300031910 | Soil | IRQNCSRITLDTTEPLQRAMRFYERHGYRRSSKIGDFFGMPLIEYVKPLTTKD |
| Ga0306923_123990371 | 3300031910 | Soil | KRVTIDTTEPLTRAMRFYARHGFTLSGRVSDFFGMPLYEWVKFL |
| Ga0310912_109183041 | 3300031941 | Soil | ELIRQNCSRITLDTTEPLQRAMRFYERHGYRRSSKIGDFFGMPLIEYVKPLTTKD |
| Ga0318533_112884982 | 3300032059 | Soil | ELRSRNCSRISLDTTVPLRRAMRFYERNGFHPSGTVADFFGMPLIQFIKTVE |
| Ga0318540_105543071 | 3300032094 | Soil | LDTTEPLQRAMRFYERHGYRRSSKIGDFFGMPLIEYVKPLTTKD |
| Ga0311301_118453633 | 3300032160 | Peatlands Soil | RAQGCRRVTLDTTQPLERAMRFYEKHGYRRSGKVSDFFGMPLVEYAKPLQT |
| Ga0307470_116905211 | 3300032174 | Hardwood Forest Soil | SLDTTETLQRAMRFYEKNGFTRTGKITDFFGMPLIEYAKSFPLR |
| Ga0307471_1003556631 | 3300032180 | Hardwood Forest Soil | LELRKRKCSRVSLDTTEPLRRAMRFYERNGYERSGKVADFFGMALIEFVKKV |
| Ga0306920_1009325501 | 3300032261 | Soil | TLDTTEPLKRAMLFYERNGYRRTGHVGDFFGMPLIEYAKAL |
| Ga0306920_1038993161 | 3300032261 | Soil | CAESELAQRNCLHITLDTTEPLERAMHFYERHGYRRSGKVGDFFGMPLIEFVKVLRAES |
| Ga0335079_101910431 | 3300032783 | Soil | EPLERAMAFYEHHGYRRSGKTTDFFGMPLHEYVKEVGRSGC |
| Ga0335079_103959664 | 3300032783 | Soil | TLDTTQPLKAAMAFYESNGYRSSGKISNFFGMPLLEYVKQLQA |
| Ga0335079_121323772 | 3300032783 | Soil | NCSQITLDTTEPLERAMRFYERHGYRRSGRIQDFFEMPLIEYVKALRA |
| Ga0335073_105893982 | 3300033134 | Soil | PLTRAIAFYRKHGYTATGQVQDFFGMPLLEFAKLLGS |
| Ga0335073_106278291 | 3300033134 | Soil | HITLDTTEPLQRALHFYERHGYRRSGRVTDFFGMPLHELRKDL |
| Ga0335073_118491611 | 3300033134 | Soil | AELRSTGCELVTLDTTRPLKRAIRFYGRHGFVSSERVTDFFGMELFEYKKRL |
| Ga0335077_101093351 | 3300033158 | Soil | ITLDTTLPLQPAMKFYEKNGYRRSGKISDFFGMPLIEYAKDL |
| Ga0335077_103107873 | 3300033158 | Soil | KCRRITLDTTAPLERAIGFYEKHGYCRSGRVGDFFGMPLYESANKL |
| ⦗Top⦘ |