


| Basic Information | |
|---|---|
| Family ID | F028767 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MKPAQLEALAGTGLLVFSAFRRGGLGLLAFLGATALIVHATVSRASEGFR |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 18.42 % |
| % of genes near scaffold ends (potentially truncated) | 25.79 % |
| % of genes from short scaffolds (< 2000 bps) | 77.89 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.579 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.684 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.263 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.737 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF07681 | DoxX | 21.05 |
| PF10282 | Lactonase | 14.21 |
| PF03401 | TctC | 10.53 |
| PF01738 | DLH | 3.68 |
| PF00561 | Abhydrolase_1 | 2.11 |
| PF12697 | Abhydrolase_6 | 1.58 |
| PF01042 | Ribonuc_L-PSP | 1.05 |
| PF03480 | DctP | 1.05 |
| PF00005 | ABC_tran | 1.05 |
| PF00664 | ABC_membrane | 1.05 |
| PF13367 | PrsW-protease | 1.05 |
| PF00171 | Aldedh | 1.05 |
| PF13590 | DUF4136 | 1.05 |
| PF12847 | Methyltransf_18 | 0.53 |
| PF04011 | LemA | 0.53 |
| PF05532 | CsbD | 0.53 |
| PF01546 | Peptidase_M20 | 0.53 |
| PF16868 | NMT1_3 | 0.53 |
| PF07045 | DUF1330 | 0.53 |
| PF02826 | 2-Hacid_dh_C | 0.53 |
| PF00563 | EAL | 0.53 |
| PF07332 | Phage_holin_3_6 | 0.53 |
| PF07043 | DUF1328 | 0.53 |
| PF02653 | BPD_transp_2 | 0.53 |
| PF13795 | HupE_UreJ_2 | 0.53 |
| PF00158 | Sigma54_activat | 0.53 |
| PF04909 | Amidohydro_2 | 0.53 |
| PF04355 | SmpA_OmlA | 0.53 |
| PF08240 | ADH_N | 0.53 |
| PF06779 | MFS_4 | 0.53 |
| PF00083 | Sugar_tr | 0.53 |
| PF13434 | Lys_Orn_oxgnase | 0.53 |
| PF00884 | Sulfatase | 0.53 |
| PF01814 | Hemerythrin | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 21.05 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 21.05 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 10.53 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.05 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 1.05 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.05 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.05 |
| COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.53 |
| COG2913 | Outer membrane protein assembly factor BamE, lipoprotein component of the BamABCDE complex | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.53 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.53 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.53 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.53 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.53 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 81.58 % |
| Unclassified | root | N/A | 18.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000041|ARcpr5oldR_c020032 | Not Available | 596 | Open in IMG/M |
| 3300000156|NODE_c0744265 | All Organisms → cellular organisms → Bacteria | 19206 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1054362 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 529 | Open in IMG/M |
| 3300000956|JGI10216J12902_105271874 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300001305|C688J14111_10035924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1484 | Open in IMG/M |
| 3300001686|C688J18823_10009993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6193 | Open in IMG/M |
| 3300001686|C688J18823_10011064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5917 | Open in IMG/M |
| 3300001686|C688J18823_10876124 | Not Available | 570 | Open in IMG/M |
| 3300001686|C688J18823_10918286 | Not Available | 555 | Open in IMG/M |
| 3300003319|soilL2_10031654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5719 | Open in IMG/M |
| 3300003321|soilH1_10122542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1344 | Open in IMG/M |
| 3300003321|soilH1_10242702 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
| 3300003321|soilH1_10297899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1320 | Open in IMG/M |
| 3300003324|soilH2_10039999 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300003324|soilH2_10277636 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300004114|Ga0062593_100052007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2562 | Open in IMG/M |
| 3300004153|Ga0063455_101184020 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300004153|Ga0063455_101567407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
| 3300004463|Ga0063356_101695248 | Not Available | 945 | Open in IMG/M |
| 3300004463|Ga0063356_102220338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300004479|Ga0062595_102002544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300004479|Ga0062595_102116555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Acidihalobacter → Acidihalobacter yilgarnensis | 548 | Open in IMG/M |
| 3300005171|Ga0066677_10032995 | All Organisms → cellular organisms → Bacteria | 2494 | Open in IMG/M |
| 3300005175|Ga0066673_10516542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300005175|Ga0066673_10832257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300005184|Ga0066671_10052904 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2062 | Open in IMG/M |
| 3300005184|Ga0066671_10405408 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300005184|Ga0066671_10949599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 543 | Open in IMG/M |
| 3300005186|Ga0066676_10900485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
| 3300005186|Ga0066676_11044446 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005187|Ga0066675_10600877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 827 | Open in IMG/M |
| 3300005187|Ga0066675_11228890 | Not Available | 555 | Open in IMG/M |
| 3300005329|Ga0070683_100019517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 6022 | Open in IMG/M |
| 3300005329|Ga0070683_100207865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1859 | Open in IMG/M |
| 3300005330|Ga0070690_100857441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300005336|Ga0070680_100895285 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005435|Ga0070714_100054783 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
| 3300005436|Ga0070713_101622526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300005436|Ga0070713_102473796 | Not Available | 502 | Open in IMG/M |
| 3300005437|Ga0070710_10049112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2359 | Open in IMG/M |
| 3300005437|Ga0070710_11252880 | Not Available | 550 | Open in IMG/M |
| 3300005440|Ga0070705_100013025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4244 | Open in IMG/M |
| 3300005440|Ga0070705_100138351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1599 | Open in IMG/M |
| 3300005445|Ga0070708_100618376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1021 | Open in IMG/M |
| 3300005454|Ga0066687_10923597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 520 | Open in IMG/M |
| 3300005455|Ga0070663_102066757 | Not Available | 513 | Open in IMG/M |
| 3300005458|Ga0070681_10665659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 956 | Open in IMG/M |
| 3300005471|Ga0070698_101740104 | Not Available | 576 | Open in IMG/M |
| 3300005518|Ga0070699_100324767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1383 | Open in IMG/M |
| 3300005529|Ga0070741_10002363 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 51329 | Open in IMG/M |
| 3300005529|Ga0070741_10098129 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3123 | Open in IMG/M |
| 3300005529|Ga0070741_10470543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
| 3300005535|Ga0070684_100353708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1351 | Open in IMG/M |
| 3300005540|Ga0066697_10048992 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300005545|Ga0070695_100062781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2413 | Open in IMG/M |
| 3300005547|Ga0070693_100806040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300005560|Ga0066670_10615989 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005561|Ga0066699_10130213 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300005561|Ga0066699_10371380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1023 | Open in IMG/M |
| 3300005566|Ga0066693_10215602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300005576|Ga0066708_10646078 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005614|Ga0068856_100285371 | Not Available | 1668 | Open in IMG/M |
| 3300005617|Ga0068859_101055123 | Not Available | 893 | Open in IMG/M |
| 3300005719|Ga0068861_102333840 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005841|Ga0068863_100869490 | Not Available | 901 | Open in IMG/M |
| 3300005985|Ga0081539_10000462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 86060 | Open in IMG/M |
| 3300006028|Ga0070717_10668595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300006031|Ga0066651_10594440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 588 | Open in IMG/M |
| 3300006031|Ga0066651_10795738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 513 | Open in IMG/M |
| 3300006046|Ga0066652_100631256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300006046|Ga0066652_100828927 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300006046|Ga0066652_101236625 | Not Available | 706 | Open in IMG/M |
| 3300006049|Ga0075417_10510149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300006755|Ga0079222_10206371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1188 | Open in IMG/M |
| 3300006755|Ga0079222_10941899 | Not Available | 732 | Open in IMG/M |
| 3300006755|Ga0079222_11018517 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 715 | Open in IMG/M |
| 3300006755|Ga0079222_11503737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 631 | Open in IMG/M |
| 3300006794|Ga0066658_10160566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1151 | Open in IMG/M |
| 3300006852|Ga0075433_10134112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2201 | Open in IMG/M |
| 3300006854|Ga0075425_100350012 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1701 | Open in IMG/M |
| 3300006854|Ga0075425_100845016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300006854|Ga0075425_100950394 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300006871|Ga0075434_100811042 | Not Available | 952 | Open in IMG/M |
| 3300006871|Ga0075434_100959106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 869 | Open in IMG/M |
| 3300006903|Ga0075426_10451778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 952 | Open in IMG/M |
| 3300006903|Ga0075426_11444165 | Not Available | 523 | Open in IMG/M |
| 3300006904|Ga0075424_101567351 | Not Available | 699 | Open in IMG/M |
| 3300006914|Ga0075436_100001357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 16645 | Open in IMG/M |
| 3300006954|Ga0079219_11696124 | Not Available | 585 | Open in IMG/M |
| 3300007076|Ga0075435_102016465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300007255|Ga0099791_10033490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2263 | Open in IMG/M |
| 3300007265|Ga0099794_10130418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1269 | Open in IMG/M |
| 3300007788|Ga0099795_10496561 | Not Available | 568 | Open in IMG/M |
| 3300009012|Ga0066710_101327622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1116 | Open in IMG/M |
| 3300009012|Ga0066710_102499525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 747 | Open in IMG/M |
| 3300009094|Ga0111539_10055745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4699 | Open in IMG/M |
| 3300009137|Ga0066709_100140210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3067 | Open in IMG/M |
| 3300009143|Ga0099792_10014672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3381 | Open in IMG/M |
| 3300009143|Ga0099792_10057815 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1913 | Open in IMG/M |
| 3300009143|Ga0099792_10327532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300009148|Ga0105243_13098401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 503 | Open in IMG/M |
| 3300010046|Ga0126384_10311446 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300010159|Ga0099796_10302262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 678 | Open in IMG/M |
| 3300010326|Ga0134065_10376930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 564 | Open in IMG/M |
| 3300010371|Ga0134125_12052501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300010397|Ga0134124_10001438 | All Organisms → cellular organisms → Bacteria | 19170 | Open in IMG/M |
| 3300010397|Ga0134124_10723468 | Not Available | 987 | Open in IMG/M |
| 3300010400|Ga0134122_11739412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 653 | Open in IMG/M |
| 3300010401|Ga0134121_10030705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4355 | Open in IMG/M |
| 3300010401|Ga0134121_10729444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 943 | Open in IMG/M |
| 3300010401|Ga0134121_10974562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300010403|Ga0134123_10067786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2739 | Open in IMG/M |
| 3300010403|Ga0134123_11205715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 787 | Open in IMG/M |
| 3300010403|Ga0134123_12357179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300010403|Ga0134123_13144169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 531 | Open in IMG/M |
| 3300011423|Ga0137436_1086104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 822 | Open in IMG/M |
| 3300012203|Ga0137399_10109073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2156 | Open in IMG/M |
| 3300012212|Ga0150985_105890305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2737 | Open in IMG/M |
| 3300012212|Ga0150985_106527739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300012212|Ga0150985_109927021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1786 | Open in IMG/M |
| 3300012212|Ga0150985_120529783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Acidihalobacter → Acidihalobacter yilgarnensis | 708 | Open in IMG/M |
| 3300012212|Ga0150985_123140724 | Not Available | 804 | Open in IMG/M |
| 3300012469|Ga0150984_100932135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300012469|Ga0150984_102875943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300012469|Ga0150984_111193202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1211 | Open in IMG/M |
| 3300012923|Ga0137359_10027555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4860 | Open in IMG/M |
| 3300012927|Ga0137416_11370991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300012927|Ga0137416_11734110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300012944|Ga0137410_11489999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300012987|Ga0164307_10341914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1083 | Open in IMG/M |
| 3300013307|Ga0157372_10922433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1013 | Open in IMG/M |
| 3300014166|Ga0134079_10167633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300015371|Ga0132258_10109769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6525 | Open in IMG/M |
| 3300015371|Ga0132258_10776814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2414 | Open in IMG/M |
| 3300015371|Ga0132258_12529873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300015373|Ga0132257_100080762 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3701 | Open in IMG/M |
| 3300015373|Ga0132257_104584328 | Not Available | 503 | Open in IMG/M |
| 3300015374|Ga0132255_100594244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1636 | Open in IMG/M |
| 3300018433|Ga0066667_11144030 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300018433|Ga0066667_11221653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 655 | Open in IMG/M |
| 3300018468|Ga0066662_10136878 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1824 | Open in IMG/M |
| 3300018476|Ga0190274_10355433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1396 | Open in IMG/M |
| 3300018482|Ga0066669_10274189 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300018482|Ga0066669_10729089 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300020027|Ga0193752_1000196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 73507 | Open in IMG/M |
| 3300021363|Ga0193699_10165707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 912 | Open in IMG/M |
| 3300021444|Ga0213878_10196433 | Not Available | 848 | Open in IMG/M |
| 3300021953|Ga0213880_10147632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300022467|Ga0224712_10478232 | Not Available | 600 | Open in IMG/M |
| 3300024284|Ga0247671_1064920 | Not Available | 590 | Open in IMG/M |
| 3300024286|Ga0247687_1040886 | Not Available | 687 | Open in IMG/M |
| 3300025912|Ga0207707_11668971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300025918|Ga0207662_10186943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1335 | Open in IMG/M |
| 3300025920|Ga0207649_10570327 | Not Available | 868 | Open in IMG/M |
| 3300025929|Ga0207664_10659441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 940 | Open in IMG/M |
| 3300025960|Ga0207651_10462970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300025986|Ga0207658_11480935 | Not Available | 621 | Open in IMG/M |
| 3300026078|Ga0207702_10115795 | Not Available | 2391 | Open in IMG/M |
| 3300026118|Ga0207675_100975616 | Not Available | 865 | Open in IMG/M |
| 3300026319|Ga0209647_1324908 | Not Available | 519 | Open in IMG/M |
| 3300026542|Ga0209805_1045096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2214 | Open in IMG/M |
| 3300026542|Ga0209805_1116634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1264 | Open in IMG/M |
| 3300026542|Ga0209805_1361406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300026550|Ga0209474_10235112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1142 | Open in IMG/M |
| 3300027655|Ga0209388_1102441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300027671|Ga0209588_1160612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 709 | Open in IMG/M |
| 3300027748|Ga0209689_1191592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300027873|Ga0209814_10355194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 641 | Open in IMG/M |
| 3300027903|Ga0209488_10023684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4459 | Open in IMG/M |
| 3300027903|Ga0209488_11111382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 539 | Open in IMG/M |
| 3300028536|Ga0137415_10886241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 702 | Open in IMG/M |
| 3300028802|Ga0307503_10937357 | Not Available | 503 | Open in IMG/M |
| 3300031170|Ga0307498_10217991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
| 3300031226|Ga0307497_10111557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1082 | Open in IMG/M |
| 3300031226|Ga0307497_10123929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1040 | Open in IMG/M |
| 3300031366|Ga0307506_10043686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1270 | Open in IMG/M |
| 3300031366|Ga0307506_10477200 | Not Available | 525 | Open in IMG/M |
| 3300031455|Ga0307505_10677195 | Not Available | 505 | Open in IMG/M |
| 3300031740|Ga0307468_100004922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4556 | Open in IMG/M |
| 3300031740|Ga0307468_100892610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 770 | Open in IMG/M |
| 3300031820|Ga0307473_10446413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 860 | Open in IMG/M |
| 3300032144|Ga0315910_10100480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2124 | Open in IMG/M |
| 3300032157|Ga0315912_10903049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 702 | Open in IMG/M |
| 3300032174|Ga0307470_10032253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2506 | Open in IMG/M |
| 3300032205|Ga0307472_100513082 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300032770|Ga0335085_10726893 | Not Available | 1101 | Open in IMG/M |
| 3300032828|Ga0335080_10134161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2745 | Open in IMG/M |
| 3300033412|Ga0310810_10052656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4955 | Open in IMG/M |
| 3300033550|Ga0247829_11830620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
| 3300034268|Ga0372943_0011124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4687 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.32% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.74% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.68% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 3.16% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.16% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.63% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.63% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.58% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.05% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.05% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.53% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.53% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Host-Associated | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021953 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07 | Environmental | Open in IMG/M |
| 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ARcpr5oldR_0200322 | 3300000041 | Arabidopsis Rhizosphere | MGSKLARSRRMRPAQIEALAGTGLLLLSAFKRGPLGIVSFLGATLLIVHAATQRAGEGFR |
| NODE_07442659 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MNPHQLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVSRTKEGFR* |
| AP72_2010_repI_A10DRAFT_10543622 | 3300000651 | Forest Soil | MNPHQLEALAGTGLLLFSAFKRGALGLAAFLGAAALIVHATVSRTKEGFR* |
| JGI10216J12902_1052718742 | 3300000956 | Soil | MPIMKPAQVEALAGTGLLLFSAFRRGPIGILAFLAATFVIVHAASSRMVDAVKQP* |
| C688J14111_100359242 | 3300001305 | Soil | MRPAQLEALAGTGLLVFSALRRGPLGILSFLGAAALIVHAATQRAAEGFR* |
| C688J18823_100099938 | 3300001686 | Soil | MRPAQLQALAGTGLLLFSAFKRGGIGVLAFLGAATLIVHATLSRAKEGFH* |
| C688J18823_100110647 | 3300001686 | Soil | MKPAQLEALAGTGLLVFSAFKRGGIGVLAFLGAATLIVHATLSRAKEGFH* |
| C688J18823_108761241 | 3300001686 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGILAFLGAAALIVHAAASRVTDAAR* |
| C688J18823_109182861 | 3300001686 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGILAFLGAAALIVHAATSRL |
| soilL2_100316544 | 3300003319 | Sugarcane Root And Bulk Soil | MRPAQVEALAGTGLLLFSAFKRGGIGVLAFLGAATLIVHATLSRAKEGFH* |
| soilH1_101225422 | 3300003321 | Sugarcane Root And Bulk Soil | MKPSQVEALAGTSLLIFSAFRRGPLGLLAFLGATALIVHATVNRAAQGFR* |
| soilH1_102427024 | 3300003321 | Sugarcane Root And Bulk Soil | MKPAQIEALTGTGLLMFSAFRRGPLGILAFLGATVLIVHAATSRLTERA* |
| soilH1_102978993 | 3300003321 | Sugarcane Root And Bulk Soil | MKPAQLEALAGTGLLLFSAFRRGPLGLAAFLGAAALIVHASLTRAKEGFH* |
| soilH2_100399992 | 3300003324 | Sugarcane Root And Bulk Soil | MMRPAQIEALSGTALLLFSALKRGPVGILAFLGAAALIAHATGQRMRQGFH* |
| soilH2_102776363 | 3300003324 | Sugarcane Root And Bulk Soil | MRPAQIEALSGTALLVFSALKRGPVGLLAFLGAAALIAHATKQRIAQGFR* |
| Ga0062593_1000520073 | 3300004114 | Soil | MKPAQIEALAGTTLLVFSAFRRGPIGILAFLAATAVIVHATTQRLGEGFR* |
| Ga0063455_1011840201 | 3300004153 | Soil | MKPAQLEALAGTGLLVFSAFKRGGLGVLAFLGAATLIVHATLARTKQGFR* |
| Ga0063455_1015674072 | 3300004153 | Soil | DCLSPRMKPAQIEALAGTGLLLLSALKRGPLGILAFLGATALIVHATTQRVSEGFR* |
| Ga0063356_1016952482 | 3300004463 | Arabidopsis Thaliana Rhizosphere | CLHMKPAQIEALAGTTLLVFSAFRRGPIGILAFLAATAVIVHATTQRLGEGFR* |
| Ga0063356_1022203382 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKPAQVEALAGTGLLLFSAFRRGPIGILAFLAATFVIVHAASSRVVDAVKQKPA* |
| Ga0062595_1020025442 | 3300004479 | Soil | MNPHQLEALAGTGLLLFSALKRGTLGIAAFLGAAALIVHATVSRAKEGFH* |
| Ga0062595_1021165552 | 3300004479 | Soil | MKPAQIEALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAHA* |
| Ga0066677_100329954 | 3300005171 | Soil | MNPAQLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVSRTKEGFR* |
| Ga0066673_105165422 | 3300005175 | Soil | MKPAQLEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHAATSRALEGFR* |
| Ga0066673_108322571 | 3300005175 | Soil | ALTGTGLLVFSAFRRGSLGLLAFLGATALIVHATLSRAKEGFR* |
| Ga0066671_100529042 | 3300005184 | Soil | MKPAQLEALAGTGLLVFSAFKRGGVGMLAFLGAATLIVHATLARAKQGFR* |
| Ga0066671_104054082 | 3300005184 | Soil | MTPCMKPAQIEALAGTGLLVFSGFRRGPLGLVAFLGATALIVHATVARAAEGFR* |
| Ga0066671_109495992 | 3300005184 | Soil | MNPHQLEALAGTGLLVFSAFKRGGLGMLALLGAATLIVHATLTRAKERFH* |
| Ga0066676_109004852 | 3300005186 | Soil | VCGMKPAQLEALAGTGLLVFSAFRRGGLGLLAFLGATALIVHATVSRASEGFR* |
| Ga0066676_110444462 | 3300005186 | Soil | LEALAGTGLLLFSAFKRGGIGVLAFLGATTLIVHATLSRAKEGFH* |
| Ga0066675_106008771 | 3300005187 | Soil | MKPAQLEALAGTGLLVFSAFKRGGVGMLAFLGAATLIVHATLARAKQGFH* |
| Ga0066675_112288902 | 3300005187 | Soil | MKPAQLEALTGTGLLLFSAFRRGSLGLVAFLGAAALIAHATLSRAKEGFR* |
| Ga0070683_1000195179 | 3300005329 | Corn Rhizosphere | MKPAQMEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVEGFK* |
| Ga0070683_1002078651 | 3300005329 | Corn Rhizosphere | MKPAQLEALAGTSLLLFSAFRRGPLGLAAFLGAAALIVHAAIKRGAEGFR* |
| Ga0070690_1008574411 | 3300005330 | Switchgrass Rhizosphere | MKPAQLEALAGTGLLLFSAFKRGGVGVLAFLGAATLIVHATLSRAKQGFH* |
| Ga0070680_1008952852 | 3300005336 | Corn Rhizosphere | MRPAQIEALGGTALLLFSALKRGPLGLAAFLGAAALIAHATGQRLREGFR* |
| Ga0070714_1000547833 | 3300005435 | Agricultural Soil | MNPHQVEALAGTGLLLFSAFKRGGVGVLALLGAAALIVHATVARAKEGFR* |
| Ga0070713_1016225262 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPAQIEALAGTGLLMFSAFRRGGLGILAFLGATALIVHAAVSRSVDAIKR* |
| Ga0070713_1024737962 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGRMKPAQLEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHATVS |
| Ga0070710_100491123 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MCTGMKPAQVEALAGTGLLLLSAFRRGPIGLLAFLAAAAVIVHAATQRASEGFR* |
| Ga0070710_112528802 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPAQIEALAGTGLLMFSAFRRGGLGILAFLGATALIVHAAVSRSVD |
| Ga0070705_1000130252 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPHQLEALAGTGLLLFSAFKRGTLGIAAFLGAAALIVHATVSRAKEGFH* |
| Ga0070705_1001383512 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRFASHAAMRPAQIEALAGTGLLLFSAFRRGGLGIAAFLGAAALIVHASLTRAKEGFR* |
| Ga0070708_1006183762 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPSQLEALAGTGLLLFSAFKRGGVGVLAFLGAAALIVHATIGRAKEGFR* |
| Ga0066687_109235972 | 3300005454 | Soil | CMVRVMKPAQLEALAGTGLLVFSAFRRGGLGLLAFLGATALIVHATVSRASEGFR* |
| Ga0070663_1020667571 | 3300005455 | Corn Rhizosphere | MKPAQMEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVECFK* |
| Ga0070681_106656591 | 3300005458 | Corn Rhizosphere | MNPHQLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVARTKEGFR* |
| Ga0070698_1017401041 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GMRPAQLEALAGTGLLLFSALRRGPLGILSFLGATALIIHAATQRATEGFR* |
| Ga0070699_1003247672 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAARMNPSQLEALAGTGLLLFSAFKRGGVGVLAFLGAAALIVHATIGRAKEGFR* |
| Ga0070741_1000236320 | 3300005529 | Surface Soil | MKPAQIEALAGTGLLMFSAFRRGGLGLLAFLGATALIVHAAVSRSVDAVKR* |
| Ga0070741_100981292 | 3300005529 | Surface Soil | MKPAQVEALAGTGLLLFSAFKRGGIGVLAFLGAATLIVHATLSRAKEGFH* |
| Ga0070741_104705432 | 3300005529 | Surface Soil | MNPHQLEALAGTGLLLFSAVKRGTLGIAAFLGAAALIVHATVSRAKEGFH* |
| Ga0070684_1003537083 | 3300005535 | Corn Rhizosphere | LASGRGMKPAQLEALAGTSLLLFSAFRRGPLGLAAFLGAAALIVHAAIKRGAEGFR* |
| Ga0066697_100489924 | 3300005540 | Soil | LEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVSRTKEGFR* |
| Ga0070695_1000627813 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAQIEALAGTGLLLFSAFRRGGLGIAAFLGAAALIVHASLTRAKEGFR* |
| Ga0070693_1008060402 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPAQIEALAGTSLLLFSAFRRGPLGLLAFLGATALIVHAAVQRGAQGFR* |
| Ga0066670_106159891 | 3300005560 | Soil | AGTGLLLFSAFKRGGVGVLAFLGAATLIVHATLSRAKEGFH* |
| Ga0066699_101302132 | 3300005561 | Soil | MEALTGTGLLIFSALKRGPIGIVAFLGAAALIVHATMQRASEGFR* |
| Ga0066699_103713802 | 3300005561 | Soil | MVRSMKPAQVEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHAATSRALEGFR* |
| Ga0066693_102156022 | 3300005566 | Soil | QLEALAGTGLLVFSAFKRGTLGLAAFLGAAALIVHATVSRAKEGFR* |
| Ga0066708_106460782 | 3300005576 | Soil | VRPAQIEALAGTALLIFSALQRGPIGILAFLGATTLIVHATKQRVAQRFR* |
| Ga0068856_1002853714 | 3300005614 | Corn Rhizosphere | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATILIVHAATSRLTERG* |
| Ga0068859_1010551233 | 3300005617 | Switchgrass Rhizosphere | ALAGTGLLLFSALRRGPLGILSSLGATALIIHAATQRATEGFR* |
| Ga0068861_1023338402 | 3300005719 | Switchgrass Rhizosphere | MKPAQIEALAGTSLLVFSAFRRGPLGLLAFLGATALIVHATVNRAAQGFK* |
| Ga0068863_1008694902 | 3300005841 | Switchgrass Rhizosphere | MRPAQLEALAGTGLLLFSALRRGPLGILSFLGATALIIHAATQRATEGFR* |
| Ga0081539_1000046277 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKPAQLEALAGTGLLVFSAFKRGGLGLVAFLGAATLIVHATLARAKEGFH* |
| Ga0070717_106685952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MNPHQVEALAGTGLLLFSAFKRGGVGVLAFLGAAALIVHATVARAKEGFR* |
| Ga0066651_105944401 | 3300006031 | Soil | MKPAQLEALAGTGLLVFSAFRRGSLGLLAFLGATALIVHA |
| Ga0066651_107957382 | 3300006031 | Soil | MRPAQIEALAGTSLLIFSAFRRGGLGLLAFLGATALIVHATVSRASEGFK* |
| Ga0066652_1006312562 | 3300006046 | Soil | MRPAQLEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHASVSRAVEGFR* |
| Ga0066652_1008289272 | 3300006046 | Soil | MRPAQLEALAGTGLLLFSAFKRGGIGVLAFLGAATLIVHATLSRAKEGFH* |
| Ga0066652_1012366251 | 3300006046 | Soil | MKSAQIEALTGTGLLMFSAFRRGPLGILAFLGAAALIVHAATSR |
| Ga0075417_105101492 | 3300006049 | Populus Rhizosphere | MRPAQIEALAGTGLLLFSALRRGPLGMVSFLGATLLIVHAATQRAGEGFR* |
| Ga0079222_102063712 | 3300006755 | Agricultural Soil | MNPHQLEALAGTGLLVFSAFKRGALGLAAFLGATALIVHATVSRAKEGFR* |
| Ga0079222_109418992 | 3300006755 | Agricultural Soil | MRPAQIEALSGTALLLFSALKRGPLGLVAFLGAAALIAHATGQRMR* |
| Ga0079222_110185172 | 3300006755 | Agricultural Soil | MRPAQIEALSGTALLLFSALKRGPLGMLAFLGAAALIAHATGQRMREGFR* |
| Ga0079222_115037372 | 3300006755 | Agricultural Soil | MTGMKPAQVEALAGTGLLLLSAFRRGPIGVLAFLGAAAVIVHAATQRAKEGFR* |
| Ga0066658_101605662 | 3300006794 | Soil | MKPAQLEALAGTGLLVFSAFKRGGLGVLAFLGAATLIVHATLARAKQGFR* |
| Ga0075433_101341122 | 3300006852 | Populus Rhizosphere | LHASAGMKPAQIEALAGTALLVLTALKRGPLGLLTFLGAAALIAHATMQRAREGFR* |
| Ga0075425_1003500124 | 3300006854 | Populus Rhizosphere | MNPSQLEALAGTGLLLFSAFKRGGVGIVAFLGAAALIVHATIGRAKEGFR* |
| Ga0075425_1008450162 | 3300006854 | Populus Rhizosphere | MKPAQIEALAGTSLLLFSAFRRGGLGLLAFLGATALIVHAATSRAKEGFK* |
| Ga0075425_1009503941 | 3300006854 | Populus Rhizosphere | MRPEQLEALAGTGLLLFSAFRRGPLGLAAFLGATALIVHASVSRAVEGFR* |
| Ga0075434_1008110421 | 3300006871 | Populus Rhizosphere | MKPAQLEALAGTGLLLFSALKRGPLGILSFLGAAALIVHATTQRAAEGFR* |
| Ga0075434_1009591061 | 3300006871 | Populus Rhizosphere | EQLEALAGTGLLLFSAFRRGPLGLAAFLGATALIVHASVSRAAQGFR* |
| Ga0075426_104517782 | 3300006903 | Populus Rhizosphere | MKPAQIEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHASVSRAVQGFR* |
| Ga0075426_114441652 | 3300006903 | Populus Rhizosphere | MAHGMKPAQVEALAGTGLLIFSAFRRGPLGLVAFLGATALIVHASASRALEGFR* |
| Ga0075424_1015673512 | 3300006904 | Populus Rhizosphere | MKPAQIEALAGTSLLVFSAFRRGPLGLAAFLGATALIVHASVSRAAQGFR* |
| Ga0075436_1000013577 | 3300006914 | Populus Rhizosphere | MNPSQLEALAGTGLLLFSAFKRGGVGIVAFLGAAALIVHATIGRAKEGLR* |
| Ga0079219_116961242 | 3300006954 | Agricultural Soil | MKPAQLEALAGTGLLLFSALRRGPLGILSFLGATALIVHAATQRATEGFR* |
| Ga0075435_1020164652 | 3300007076 | Populus Rhizosphere | MNPSQLEALAGTGLLLFSAFKRGGVGIVAFLGAAALIVHATIGRAK |
| Ga0099791_100334904 | 3300007255 | Vadose Zone Soil | MNPHQLEALAGTGLLLFSAFRRGALGLAAFLGAAALIVHATVSRTREGFR* |
| Ga0099794_101304182 | 3300007265 | Vadose Zone Soil | MRPAQIEALAGTGLLLFSALRRGPLGILAFLGATALIVHAATKRVSEGFR* |
| Ga0099795_104965612 | 3300007788 | Vadose Zone Soil | MKPAQIEALAGTGLLMFSAFRRGPLGILAFLGAAALIVHAAVSRTVDAVR* |
| Ga0066710_1013276222 | 3300009012 | Grasslands Soil | MRPAQIEALAGTGLLLFSAFRRGSLGLLAFLGATALIVHASVARAKEGFR |
| Ga0066710_1024995252 | 3300009012 | Grasslands Soil | MKPAQLEALAGTGLLVFSAFRRGSLGLLAFLGATALIVHATVSRASEGFR |
| Ga0111539_100557456 | 3300009094 | Populus Rhizosphere | MKPAQIEALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAQRLGEGFR* |
| Ga0066709_1001402105 | 3300009137 | Grasslands Soil | MKPAQLEALAGTGLLVFSAFRRGSLGLLAFLGATALIVHATVSRASEGFR* |
| Ga0099792_100146727 | 3300009143 | Vadose Zone Soil | MKPAQLEALTGTGLLLFSAFRRGSLGLVAFLGATALIVHATMSRAKDGFR* |
| Ga0099792_100578151 | 3300009143 | Vadose Zone Soil | LEALTGTGLLLFSAFRRGSLGLVAFLGATALIVHATMSRAKDGFR* |
| Ga0099792_103275322 | 3300009143 | Vadose Zone Soil | MKPAQIEALAGTGLLLFSALRRGPLGILAFLGATALIVHAATKRVSEGFR* |
| Ga0105243_130984011 | 3300009148 | Miscanthus Rhizosphere | MEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQ |
| Ga0126384_103114463 | 3300010046 | Tropical Forest Soil | MRPAQLEALAGTGLLLFSALRRGPLGILSFLGATALIVHAATQRASEGFR* |
| Ga0099796_103022622 | 3300010159 | Vadose Zone Soil | MRPAQVEALAGTSLLIFSAFRRGGLGLLAFLGATALIVHATVSRASEGFK* |
| Ga0134065_103769301 | 3300010326 | Grasslands Soil | MRPAQVEALAGTSLLVFSAFRRGGVGLLAFLGATALIVHATVSRAKEGFK* |
| Ga0134125_120525012 | 3300010371 | Terrestrial Soil | MNPHQLEALAGTGLLLFSAFKRGTLGIAAFLGAAALIVHAT |
| Ga0134124_100014384 | 3300010397 | Terrestrial Soil | MRPAQIEALAGTGLLLLSAFKRGPLGIVSFLGATLLIVHAATQRAGEGFR* |
| Ga0134124_107234682 | 3300010397 | Terrestrial Soil | MKPAQVEALAGTGLLLLSAFRRGPIGLLAFLAAAAVIVHAATQRASEGFR* |
| Ga0134122_117394121 | 3300010400 | Terrestrial Soil | ILGGGAIVACTAGMKPMKPAQIEALAGTSLLLFSAFRRGPLGLLAFLAATGMIVHAATQRAMDGFK* |
| Ga0134121_100307052 | 3300010401 | Terrestrial Soil | MEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVEGFK* |
| Ga0134121_107294441 | 3300010401 | Terrestrial Soil | MRPAQVEALAGTSLLVFSAFRRGGMGLLAFLGATALIVHATVSRAKEGFK* |
| Ga0134121_109745622 | 3300010401 | Terrestrial Soil | MKPAQIEALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAQRLSEGFR* |
| Ga0134123_100677863 | 3300010403 | Terrestrial Soil | MKPHLKPAQIEALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAQRLSEGFR* |
| Ga0134123_112057152 | 3300010403 | Terrestrial Soil | MRPAQIEALAGTGLLLFSAFRRGGLGIAAFLGAAALIFHASLTRAKEGFR* |
| Ga0134123_123571791 | 3300010403 | Terrestrial Soil | LAGTGLLLLSAFKRGPLGIVSFLGATLLIVHAATQRAGEGFR* |
| Ga0134123_131441692 | 3300010403 | Terrestrial Soil | SPGAEVASQPAMKPAQVEALAVTGLLLFSAFRRGPLGMLAFFAAAAVIVHAATQRATDALK* |
| Ga0137436_10861041 | 3300011423 | Soil | MKPAQIEALAGTGLLLFSAFRRGPLGILAFLAAAGVIVHAATQRAAAGFK* |
| Ga0137399_101090733 | 3300012203 | Vadose Zone Soil | MRPAQLEALAGTGLLLFSAFKRGTLGLAAFLGAAALIVHASVSRAKEGFR* |
| Ga0150985_1058903052 | 3300012212 | Avena Fatua Rhizosphere | MRSAQVEALAGTSLLVFSAFRRGGVGLLAFLGATALIVHATVSRAKEGFR* |
| Ga0150985_1065277391 | 3300012212 | Avena Fatua Rhizosphere | QLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVSRTKEGFR* |
| Ga0150985_1099270212 | 3300012212 | Avena Fatua Rhizosphere | MKPAQLEALAGTGLLLFSAFKRGGVGMLAFLGAATLIVHATLSRAKEGFTDLNQVS* |
| Ga0150985_1205297832 | 3300012212 | Avena Fatua Rhizosphere | MKRDIKPAQVEALTGTGLLLFSAFRRGPLGILAFLAATALIVHATTQRVVDAVKQ* |
| Ga0150985_1231407241 | 3300012212 | Avena Fatua Rhizosphere | ALAGTGLLMFSAFRRGPLGILAFLGAATLIIHAAIQRSVDAVR* |
| Ga0150984_1009321351 | 3300012469 | Avena Fatua Rhizosphere | MQAMKPAQIEALAGTGLLLFSAFRRGPIGILAFLAATAIIVHATAERSLQGFR* |
| Ga0150984_1028759431 | 3300012469 | Avena Fatua Rhizosphere | MKPAQLEALAGTGLLLFSAFKRGGVGMLAFLGAATLIVHATLSRAKEGFH* |
| Ga0150984_1111932021 | 3300012469 | Avena Fatua Rhizosphere | MRPAQLEALAGTGLLLFSAFKRGGIGVLAFLGAATLIVHATLS |
| Ga0137359_100275556 | 3300012923 | Vadose Zone Soil | MNPHQLEALAGTGLLLFSAFRRGALGLAAFLGAAALIGGFR* |
| Ga0137416_113709911 | 3300012927 | Vadose Zone Soil | MKPAQLEALTGTGLLLFSAFRRGSLGLVAFLGATALIVHATMSRA |
| Ga0137416_117341102 | 3300012927 | Vadose Zone Soil | MRPAQLEALAGTGLLLFSAFKRGTLGLAAFLGAAALI |
| Ga0137410_114899992 | 3300012944 | Vadose Zone Soil | MKAAQIEALAGTSLLLFSAFRRGGLGLLAFLGAAALIVHA |
| Ga0164307_103419142 | 3300012987 | Soil | MEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVE |
| Ga0157372_109224333 | 3300013307 | Corn Rhizosphere | MKPAQIEALAGTGLLMFSAFRRGGLGILAFLGATALIVHAAVSRSVDAIER* |
| Ga0134079_101676333 | 3300014166 | Grasslands Soil | MKPAQLEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHASVSRAV |
| Ga0132258_101097695 | 3300015371 | Arabidopsis Rhizosphere | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATLLIVHAATSRLTERS* |
| Ga0132258_107768143 | 3300015371 | Arabidopsis Rhizosphere | MRPAQIEALAGTGLLFFSAFRRGGLGIAAFLGAAALIVHASLTRAKEGFH* |
| Ga0132258_125298732 | 3300015371 | Arabidopsis Rhizosphere | MKPAQIEALAGTSLLVFSAFRRGPLGLLAFFAATGLIVHATAQRLGEGFR* |
| Ga0132257_1000807623 | 3300015373 | Arabidopsis Rhizosphere | MRPAQIEALAGTGLLFFSAFRRGGLGIAAFLGAAALIVHASLTRAKEGFR* |
| Ga0132257_1045843283 | 3300015373 | Arabidopsis Rhizosphere | ALTGTGLLMFSAFRRGPLGMLAFLGATLLIVHAATSRLTERS* |
| Ga0132255_1005942442 | 3300015374 | Arabidopsis Rhizosphere | MRPAQTEALAGTGLLFFSAFRRGGLGIAAFLGAAALIFHASLTRAKEGFR* |
| Ga0066667_111440302 | 3300018433 | Grasslands Soil | MNPAQLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVSRTKEGFR |
| Ga0066667_112216532 | 3300018433 | Grasslands Soil | MKPAQLEALAGTGLLVFSAFRRGGLGLLAFLGATALIVHATVSRASEGFR |
| Ga0066662_101368782 | 3300018468 | Grasslands Soil | MKPAQLEALAGTGLLVFSAFKRGGVGMLAFLGAATLIVHATLARAKQGFH |
| Ga0190274_103554334 | 3300018476 | Soil | MKPAQMEALAGTGLLLFSAWRRGPLGILAFLAAAGVIVHAATQRAVERFE |
| Ga0066669_102741891 | 3300018482 | Grasslands Soil | KPAQLEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHASVSRAVEGFR |
| Ga0066669_107290892 | 3300018482 | Grasslands Soil | MKPAQLEALTGTGLLVFSAFKRGGVGMLAFLGAATLIVHATLARAKQGFH |
| Ga0193752_100019637 | 3300020027 | Soil | MKTSKPMKPAQIEALAGTSLLLFSAFRRGPLGLLAFLAATGMIVHAATKRAVEGFK |
| Ga0193699_101657072 | 3300021363 | Soil | MKPAQIEALAGTSLLMFSAFRRGPLGLLAFLAAAGMIVHAATQRAAEGFK |
| Ga0213878_101964332 | 3300021444 | Bulk Soil | MKPAQIEALAGTSLLVFSAFRRGGLGLLAFLGATALIVHATVSRASQGFR |
| Ga0213880_101476321 | 3300021953 | Exposed Rock | LLLMSEALAGTGLLIFSAFRRGPLGLVAFLGATALIVHASVSRAVDGFR |
| Ga0224712_104782322 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | GRGMKPAQLDALAGTSLLLFSACRRGPLGLAAFLGAAALIVHAAIKRGAEGFR |
| Ga0247671_10649202 | 3300024284 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATILIVHAATSRLTER |
| Ga0247687_10408863 | 3300024286 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATILIVHAATSRL |
| Ga0207707_116689711 | 3300025912 | Corn Rhizosphere | MNPHQLEALAGTGLLLFSAFKRGALGMAAFLGAAALIVHATVARTKEGFR |
| Ga0207662_101869433 | 3300025918 | Switchgrass Rhizosphere | AKLARSVRMRPAQLEALAGTGLLLFSALRRGPLGILSFLGATALIIHAATQRATEGFR |
| Ga0207649_105703272 | 3300025920 | Corn Rhizosphere | MKPAQMEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVEGFK |
| Ga0207664_106594411 | 3300025929 | Agricultural Soil | MNPHQVEALAGTGLLLFSAFKRGGVGVLAFLGAAALI |
| Ga0207651_104629701 | 3300025960 | Switchgrass Rhizosphere | EALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAQRLGEGFR |
| Ga0207658_114809352 | 3300025986 | Switchgrass Rhizosphere | MEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVEGFK |
| Ga0207702_101157954 | 3300026078 | Corn Rhizosphere | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATILIVHAATSRLTERG |
| Ga0207675_1009756162 | 3300026118 | Switchgrass Rhizosphere | MKPAQIEALAGTSLLLFSAFRRGPLGLLAFFAATGLIVHATAQRLGEGFR |
| Ga0209647_13249082 | 3300026319 | Grasslands Soil | MKPAQLEALTGTGLLLFSAFRRGSLGLVAFLGATALIVHATMSRAKDGFR |
| Ga0209805_10450963 | 3300026542 | Soil | MNPAQLEALAGTGLLLFSAFKRGALGMAAFLGAAVLIVHATVSRTKEGFR |
| Ga0209805_11166341 | 3300026542 | Soil | MEALTGTGLLIFSALKRGPIGIVAFLGAAALIVHATMQRASEGFR |
| Ga0209805_13614062 | 3300026542 | Soil | MVRSMKPAQVEALAGTGLLVFSAFRRGPLGLVAFLGATALIVHAATSRALEGFR |
| Ga0209474_102351122 | 3300026550 | Soil | MNPHQLEALAGTGLLVFSAFKRGGLGLLAFLGATALIVHATTARAKEGFR |
| Ga0209388_11024412 | 3300027655 | Vadose Zone Soil | MNPHQLEALAGTGLLLFSAFRRGALGLAAFLGAAALIVHATVSRTREGFR |
| Ga0209588_11606122 | 3300027671 | Vadose Zone Soil | MRPAQIEALAGTGLLLFSALRRGPLGILAFLGATALIVHAATKRVSEGFR |
| Ga0209689_11915921 | 3300027748 | Soil | MNPAQLEALAGTGLLLFSAFKRGPLGMAAFLGAAALIVHATVSRTKEGFR |
| Ga0209814_103551942 | 3300027873 | Populus Rhizosphere | MRPAQIEALAGTGLLLFSALRRGPLGMVSFLGATLLIVHAATQRAGEGFR |
| Ga0209488_100236844 | 3300027903 | Vadose Zone Soil | MKPAQIEALAGTGLLLFSALRRGPLGILAFLGATALIVHAATKRVSEGFR |
| Ga0209488_111113821 | 3300027903 | Vadose Zone Soil | ADCLDSRMRPAQVEALAGTSLLIFSAFRRGGLGLLAFLGATALIVHATVSRASEGFK |
| Ga0137415_108862412 | 3300028536 | Vadose Zone Soil | MRPAQLEALAGTGLLLFSAFKRGTLGLAAFLGAAALIVHASVSRAKEGFR |
| Ga0307503_109373571 | 3300028802 | Soil | MKPAQMEALAGTGLLLFSAFRRGPLGILAFLAAAGVIVHAATQRTVEGFK |
| Ga0307498_102179912 | 3300031170 | Soil | MKPMKPAQLEALAGTSLLLFSAFRRGPIGLLAFLAAAGIIVHAATSRAVEGFK |
| Ga0307497_101115572 | 3300031226 | Soil | MKPAQLEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRAVEGFK |
| Ga0307497_101239292 | 3300031226 | Soil | MKPARIDPAQLEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVHAATQRTLEGFK |
| Ga0307506_100436862 | 3300031366 | Soil | MRPAQVEALAGTSLLIFSAFRRGGFGLLAFLGATALIVHATVSRAKEGFR |
| Ga0307506_104772003 | 3300031366 | Soil | IEALTGTGLLMFSAFRRGPLGLLAFLGATALIVHAAASRLTERG |
| Ga0307505_106771951 | 3300031455 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGILAFLGATALIVHAAVSRSVDALK |
| Ga0307468_1000049226 | 3300031740 | Hardwood Forest Soil | MNPHQLEALAGTGLLVFSAFRRGALGLAAFLGAAALIVHASVSRAKEGFR |
| Ga0307468_1008926102 | 3300031740 | Hardwood Forest Soil | MKPAQIEALAGTGLLLFSAFRRGPLGILAFLAAAGVIVHAATQRAVDGFK |
| Ga0307473_104464132 | 3300031820 | Hardwood Forest Soil | MRPEQLEALAGTGLLLFSAFRRGPLGLVAFLGATALIVHASVSRAVQGFR |
| Ga0315910_101004803 | 3300032144 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATALIVHAAVSRSVDALKQGG |
| Ga0315912_109030492 | 3300032157 | Soil | MKTMKPAQIEALTGTGLLMFSAFRRGPLGMLAFLGATALIVHAAVSRSVDAIKR |
| Ga0307470_100322533 | 3300032174 | Hardwood Forest Soil | MRPAQVEALAGTSLLIFSAFRRGGLGLLAFLGATALIVHATVSRASEGFK |
| Ga0307472_1005130822 | 3300032205 | Hardwood Forest Soil | MNPHQLEALAGTGLLVFSAFRRGALGLAAFLGAAALIVHASVSRAKAGFR |
| Ga0335085_107268931 | 3300032770 | Soil | MKPAQIEALTGTGLLMFSAFRRGPLGILAFLGATVLIIHAATSRLTERG |
| Ga0335080_101341613 | 3300032828 | Soil | MKPAQIEALAGTGLLMFSAFRRGTLGMLAFLGAAALIVHAATQRSIDALQR |
| Ga0310810_100526563 | 3300033412 | Soil | MRPAQIEALSGTALLLFSALKRGPLGMLAFLGAAALIAHATGQRMREGFR |
| Ga0247829_118306201 | 3300033550 | Soil | MKPAQMEALAGTGLLLFSAWRRGPLGILAFLAAAGIIVH |
| Ga0372943_0011124_1994_2146 | 3300034268 | Soil | MKPAQIEALAGTGLLVFSALKRGPLGILAFLGATALIVHATTQRVSEGFR |
| ⦗Top⦘ |