


| Basic Information | |
|---|---|
| Family ID | F028745 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MTDLERLGLALVGFAVAVVAAGVLLGLIGAWIKRGRR |
| Number of Associated Samples | 121 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.84 % |
| % of genes near scaffold ends (potentially truncated) | 18.95 % |
| % of genes from short scaffolds (< 2000 bps) | 70.53 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (83.158 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.105 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.211 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.421 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 13.16 |
| PF00072 | Response_reg | 5.79 |
| PF01738 | DLH | 3.16 |
| PF07045 | DUF1330 | 3.16 |
| PF08240 | ADH_N | 3.16 |
| PF00892 | EamA | 2.63 |
| PF00107 | ADH_zinc_N | 1.58 |
| PF00296 | Bac_luciferase | 1.58 |
| PF14824 | Sirohm_synth_M | 1.05 |
| PF04191 | PEMT | 1.05 |
| PF11154 | DUF2934 | 1.05 |
| PF00589 | Phage_integrase | 1.05 |
| PF01381 | HTH_3 | 1.05 |
| PF13229 | Beta_helix | 1.05 |
| PF00692 | dUTPase | 1.05 |
| PF00069 | Pkinase | 1.05 |
| PF09832 | DUF2059 | 1.05 |
| PF01297 | ZnuA | 0.53 |
| PF00496 | SBP_bac_5 | 0.53 |
| PF13458 | Peripla_BP_6 | 0.53 |
| PF00581 | Rhodanese | 0.53 |
| PF13462 | Thioredoxin_4 | 0.53 |
| PF13592 | HTH_33 | 0.53 |
| PF12399 | BCA_ABC_TP_C | 0.53 |
| PF12680 | SnoaL_2 | 0.53 |
| PF03264 | Cytochrom_NNT | 0.53 |
| PF14539 | DUF4442 | 0.53 |
| PF06742 | DUF1214 | 0.53 |
| PF01226 | Form_Nir_trans | 0.53 |
| PF01522 | Polysacc_deac_1 | 0.53 |
| PF01189 | Methyltr_RsmB-F | 0.53 |
| PF01966 | HD | 0.53 |
| PF13087 | AAA_12 | 0.53 |
| PF04226 | Transgly_assoc | 0.53 |
| PF07364 | DUF1485 | 0.53 |
| PF13302 | Acetyltransf_3 | 0.53 |
| PF00975 | Thioesterase | 0.53 |
| PF01494 | FAD_binding_3 | 0.53 |
| PF08388 | GIIM | 0.53 |
| PF04290 | DctQ | 0.53 |
| PF07080 | DUF1348 | 0.53 |
| PF00378 | ECH_1 | 0.53 |
| PF05726 | Pirin_C | 0.53 |
| PF04234 | CopC | 0.53 |
| PF04015 | DUF362 | 0.53 |
| PF02653 | BPD_transp_2 | 0.53 |
| PF13795 | HupE_UreJ_2 | 0.53 |
| PF00701 | DHDPS | 0.53 |
| PF07676 | PD40 | 0.53 |
| PF10282 | Lactonase | 0.53 |
| PF02518 | HATPase_c | 0.53 |
| PF10759 | BPA | 0.53 |
| PF03928 | HbpS-like | 0.53 |
| PF07040 | DUF1326 | 0.53 |
| PF10771 | DUF2582 | 0.53 |
| PF00565 | SNase | 0.53 |
| PF08797 | HIRAN | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 13.16 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.21 |
| COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 3.16 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.58 |
| COG0329 | 4-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyase | Cell wall/membrane/envelope biogenesis [M] | 1.05 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.05 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 1.05 |
| COG0756 | dUTP pyrophosphatase (dUTPase) | Defense mechanisms [V] | 1.05 |
| COG0144 | 16S rRNA C967 or C1407 C5-methylase, RsmB/RsmF family | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.53 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.53 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.53 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.53 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 0.53 |
| COG2116 | Formate/nitrite transporter FocA, FNT family | Inorganic ion transport and metabolism [P] | 0.53 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.53 |
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 0.53 |
| COG3005 | Tetraheme cytochrome c subunit NapC of nitrate or TMAO reductase | Energy production and conversion [C] | 0.53 |
| COG3558 | Uncharacterized conserved protein, nuclear transport factor 2 (NTF2) superfamily | Function unknown [S] | 0.53 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.53 |
| COG5402 | Uncharacterized protein, contains DUF1214 domain | Function unknown [S] | 0.53 |
| COG5476 | Microcystin degradation protein MlrC, contains DUF1485 domain | General function prediction only [R] | 0.53 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.16 % |
| Unclassified | root | N/A | 16.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_100110655 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300002558|JGI25385J37094_10042003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1568 | Open in IMG/M |
| 3300002558|JGI25385J37094_10094619 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium 21-54-25 | 898 | Open in IMG/M |
| 3300002561|JGI25384J37096_10219494 | Not Available | 556 | Open in IMG/M |
| 3300005445|Ga0070708_100399782 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300005471|Ga0070698_101910919 | Not Available | 546 | Open in IMG/M |
| 3300005540|Ga0066697_10116283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1566 | Open in IMG/M |
| 3300005552|Ga0066701_10025613 | All Organisms → cellular organisms → Bacteria | 3000 | Open in IMG/M |
| 3300005552|Ga0066701_10145260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1425 | Open in IMG/M |
| 3300005552|Ga0066701_10359032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 902 | Open in IMG/M |
| 3300005552|Ga0066701_10750586 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005552|Ga0066701_10896962 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300005555|Ga0066692_10585076 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
| 3300005555|Ga0066692_10975938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300005557|Ga0066704_10147546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1576 | Open in IMG/M |
| 3300005558|Ga0066698_10002025 | All Organisms → cellular organisms → Bacteria | 9186 | Open in IMG/M |
| 3300005558|Ga0066698_10087630 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
| 3300005558|Ga0066698_10133049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1668 | Open in IMG/M |
| 3300005559|Ga0066700_10961673 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005568|Ga0066703_10239536 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300005568|Ga0066703_10726163 | Not Available | 570 | Open in IMG/M |
| 3300005586|Ga0066691_10006865 | All Organisms → cellular organisms → Bacteria | 5066 | Open in IMG/M |
| 3300005713|Ga0066905_100088850 | All Organisms → cellular organisms → Bacteria | 2058 | Open in IMG/M |
| 3300005764|Ga0066903_100530099 | Not Available | 2009 | Open in IMG/M |
| 3300005764|Ga0066903_101175063 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005764|Ga0066903_101501091 | Not Available | 1272 | Open in IMG/M |
| 3300005764|Ga0066903_102209239 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300005764|Ga0066903_103532861 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300006034|Ga0066656_10370198 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 926 | Open in IMG/M |
| 3300006034|Ga0066656_10860230 | Not Available | 581 | Open in IMG/M |
| 3300006046|Ga0066652_100019005 | All Organisms → cellular organisms → Bacteria | 4675 | Open in IMG/M |
| 3300006049|Ga0075417_10007186 | All Organisms → cellular organisms → Bacteria | 3919 | Open in IMG/M |
| 3300006797|Ga0066659_11305305 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300006845|Ga0075421_102565841 | Not Available | 530 | Open in IMG/M |
| 3300006904|Ga0075424_100858023 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300006904|Ga0075424_102657485 | Not Available | 523 | Open in IMG/M |
| 3300007255|Ga0099791_10151792 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300007258|Ga0099793_10263701 | Not Available | 833 | Open in IMG/M |
| 3300007258|Ga0099793_10332544 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 741 | Open in IMG/M |
| 3300007265|Ga0099794_10061107 | All Organisms → cellular organisms → Bacteria | 1830 | Open in IMG/M |
| 3300007265|Ga0099794_10233271 | Not Available | 947 | Open in IMG/M |
| 3300007265|Ga0099794_10500197 | Not Available | 640 | Open in IMG/M |
| 3300009012|Ga0066710_100022436 | All Organisms → cellular organisms → Bacteria | 7053 | Open in IMG/M |
| 3300009012|Ga0066710_100087111 | All Organisms → cellular organisms → Bacteria | 4107 | Open in IMG/M |
| 3300009012|Ga0066710_100094161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3974 | Open in IMG/M |
| 3300009012|Ga0066710_101695284 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium 21-54-25 | 962 | Open in IMG/M |
| 3300009012|Ga0066710_101805928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 923 | Open in IMG/M |
| 3300009038|Ga0099829_10135170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1956 | Open in IMG/M |
| 3300009038|Ga0099829_10318421 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1277 | Open in IMG/M |
| 3300009038|Ga0099829_10440100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1080 | Open in IMG/M |
| 3300009038|Ga0099829_10465634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1048 | Open in IMG/M |
| 3300009038|Ga0099829_10894983 | Not Available | 736 | Open in IMG/M |
| 3300009038|Ga0099829_11048765 | Not Available | 676 | Open in IMG/M |
| 3300009088|Ga0099830_10008458 | All Organisms → cellular organisms → Bacteria | 6149 | Open in IMG/M |
| 3300009088|Ga0099830_10117004 | All Organisms → cellular organisms → Bacteria | 2013 | Open in IMG/M |
| 3300009088|Ga0099830_11626435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 538 | Open in IMG/M |
| 3300009089|Ga0099828_10045953 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300009089|Ga0099828_10937703 | Not Available | 772 | Open in IMG/M |
| 3300009090|Ga0099827_10112785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2178 | Open in IMG/M |
| 3300009090|Ga0099827_10173766 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1777 | Open in IMG/M |
| 3300009090|Ga0099827_10884743 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300009090|Ga0099827_11186719 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 663 | Open in IMG/M |
| 3300009137|Ga0066709_100011268 | All Organisms → cellular organisms → Bacteria | 8222 | Open in IMG/M |
| 3300009137|Ga0066709_100155257 | All Organisms → cellular organisms → Bacteria | 2935 | Open in IMG/M |
| 3300009143|Ga0099792_10820032 | Not Available | 611 | Open in IMG/M |
| 3300009156|Ga0111538_10516226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1514 | Open in IMG/M |
| 3300009792|Ga0126374_10365065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 996 | Open in IMG/M |
| 3300009792|Ga0126374_11221251 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009810|Ga0105088_1083781 | Not Available | 574 | Open in IMG/M |
| 3300009814|Ga0105082_1071811 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009820|Ga0105085_1126380 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010046|Ga0126384_12440013 | Not Available | 507 | Open in IMG/M |
| 3300010047|Ga0126382_10308646 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300010130|Ga0127493_1061195 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1158 | Open in IMG/M |
| 3300010304|Ga0134088_10026548 | All Organisms → cellular organisms → Bacteria | 2594 | Open in IMG/M |
| 3300010336|Ga0134071_10007137 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4348 | Open in IMG/M |
| 3300010337|Ga0134062_10065013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1513 | Open in IMG/M |
| 3300010359|Ga0126376_10752932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 945 | Open in IMG/M |
| 3300010360|Ga0126372_10114505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2066 | Open in IMG/M |
| 3300010360|Ga0126372_11653965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
| 3300010360|Ga0126372_13126236 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300010366|Ga0126379_11025383 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300012096|Ga0137389_10131882 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2027 | Open in IMG/M |
| 3300012189|Ga0137388_10011047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 6389 | Open in IMG/M |
| 3300012189|Ga0137388_10521299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1104 | Open in IMG/M |
| 3300012198|Ga0137364_10096824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2071 | Open in IMG/M |
| 3300012204|Ga0137374_10025608 | All Organisms → cellular organisms → Bacteria | 6576 | Open in IMG/M |
| 3300012205|Ga0137362_10225150 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300012205|Ga0137362_10989302 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300012211|Ga0137377_10684468 | Not Available | 960 | Open in IMG/M |
| 3300012349|Ga0137387_10005497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7025 | Open in IMG/M |
| 3300012351|Ga0137386_10001679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14040 | Open in IMG/M |
| 3300012351|Ga0137386_10386273 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1008 | Open in IMG/M |
| 3300012355|Ga0137369_10547118 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 812 | Open in IMG/M |
| 3300012355|Ga0137369_10912689 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300012358|Ga0137368_10761139 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012359|Ga0137385_10022275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5668 | Open in IMG/M |
| 3300012360|Ga0137375_10688689 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
| 3300012362|Ga0137361_10153008 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2063 | Open in IMG/M |
| 3300012685|Ga0137397_10039787 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
| 3300012685|Ga0137397_10203387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1473 | Open in IMG/M |
| 3300012685|Ga0137397_10932796 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012918|Ga0137396_10898806 | Not Available | 649 | Open in IMG/M |
| 3300012944|Ga0137410_10551616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 947 | Open in IMG/M |
| 3300012948|Ga0126375_11492553 | Not Available | 577 | Open in IMG/M |
| 3300012975|Ga0134110_10063573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1463 | Open in IMG/M |
| 3300012976|Ga0134076_10006468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3886 | Open in IMG/M |
| 3300014154|Ga0134075_10010545 | All Organisms → cellular organisms → Bacteria | 3558 | Open in IMG/M |
| 3300015170|Ga0120098_1034158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300015245|Ga0137409_10361679 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300017656|Ga0134112_10175787 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 831 | Open in IMG/M |
| 3300017659|Ga0134083_10025380 | All Organisms → cellular organisms → Bacteria | 2126 | Open in IMG/M |
| 3300017974|Ga0187777_10302872 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
| 3300017997|Ga0184610_1170730 | Not Available | 720 | Open in IMG/M |
| 3300017999|Ga0187767_10041450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1105 | Open in IMG/M |
| 3300018028|Ga0184608_10007960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3518 | Open in IMG/M |
| 3300018053|Ga0184626_10012188 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3391 | Open in IMG/M |
| 3300018056|Ga0184623_10181749 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 970 | Open in IMG/M |
| 3300018063|Ga0184637_10220988 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300018077|Ga0184633_10115860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1386 | Open in IMG/M |
| 3300018077|Ga0184633_10211998 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300018431|Ga0066655_10022767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2943 | Open in IMG/M |
| 3300018431|Ga0066655_10103508 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1600 | Open in IMG/M |
| 3300018433|Ga0066667_10082739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2074 | Open in IMG/M |
| 3300018433|Ga0066667_10955730 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300018468|Ga0066662_10088168 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300018468|Ga0066662_10241285 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300018468|Ga0066662_10246398 | All Organisms → cellular organisms → Bacteria | 1457 | Open in IMG/M |
| 3300018468|Ga0066662_10249877 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1449 | Open in IMG/M |
| 3300018468|Ga0066662_12361799 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300019789|Ga0137408_1058731 | Not Available | 1053 | Open in IMG/M |
| 3300019789|Ga0137408_1363337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1274 | Open in IMG/M |
| 3300019789|Ga0137408_1378446 | Not Available | 1025 | Open in IMG/M |
| 3300020004|Ga0193755_1226722 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300020170|Ga0179594_10042697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1503 | Open in IMG/M |
| 3300021476|Ga0187846_10398756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylovirgula → Methylovirgula ligni | 565 | Open in IMG/M |
| 3300021560|Ga0126371_10385263 | Not Available | 1542 | Open in IMG/M |
| 3300021560|Ga0126371_12252350 | Not Available | 658 | Open in IMG/M |
| 3300025910|Ga0207684_10012798 | All Organisms → cellular organisms → Bacteria | 7271 | Open in IMG/M |
| 3300025910|Ga0207684_10039714 | All Organisms → cellular organisms → Bacteria | 3990 | Open in IMG/M |
| 3300025910|Ga0207684_10080326 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300025910|Ga0207684_10138725 | All Organisms → cellular organisms → Bacteria | 2089 | Open in IMG/M |
| 3300025922|Ga0207646_10041736 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 4123 | Open in IMG/M |
| 3300026295|Ga0209234_1286531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300026296|Ga0209235_1003566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8679 | Open in IMG/M |
| 3300026296|Ga0209235_1072798 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300026297|Ga0209237_1057250 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300026306|Ga0209468_1003560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6262 | Open in IMG/M |
| 3300026313|Ga0209761_1213693 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300026313|Ga0209761_1320828 | Not Available | 530 | Open in IMG/M |
| 3300026326|Ga0209801_1327426 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300026328|Ga0209802_1044145 | All Organisms → cellular organisms → Bacteria | 2247 | Open in IMG/M |
| 3300026328|Ga0209802_1141124 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1031 | Open in IMG/M |
| 3300026335|Ga0209804_1278706 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300026536|Ga0209058_1036420 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
| 3300026538|Ga0209056_10000102 | All Organisms → cellular organisms → Bacteria | 87037 | Open in IMG/M |
| 3300026538|Ga0209056_10213355 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300026540|Ga0209376_1004613 | All Organisms → cellular organisms → Bacteria | 11909 | Open in IMG/M |
| 3300026551|Ga0209648_10000738 | All Organisms → cellular organisms → Bacteria | 25588 | Open in IMG/M |
| 3300026551|Ga0209648_10128234 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2035 | Open in IMG/M |
| 3300027209|Ga0209875_1025701 | Not Available | 700 | Open in IMG/M |
| 3300027332|Ga0209861_1005904 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300027490|Ga0209899_1025321 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300027646|Ga0209466_1031685 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300027655|Ga0209388_1002745 | All Organisms → cellular organisms → Bacteria | 4304 | Open in IMG/M |
| 3300027846|Ga0209180_10005983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6147 | Open in IMG/M |
| 3300027846|Ga0209180_10204739 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1138 | Open in IMG/M |
| 3300027846|Ga0209180_10383498 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 798 | Open in IMG/M |
| 3300027846|Ga0209180_10691592 | Not Available | 555 | Open in IMG/M |
| 3300027862|Ga0209701_10273642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 979 | Open in IMG/M |
| 3300027873|Ga0209814_10031047 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300027875|Ga0209283_10070561 | All Organisms → cellular organisms → Bacteria | 2249 | Open in IMG/M |
| 3300027875|Ga0209283_10616144 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027882|Ga0209590_10133414 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300027903|Ga0209488_10292862 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300027909|Ga0209382_11172072 | Not Available | 788 | Open in IMG/M |
| 3300027909|Ga0209382_12149529 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027961|Ga0209853_1100050 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300028536|Ga0137415_10152203 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300028536|Ga0137415_11106706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300028878|Ga0307278_10316933 | Not Available | 689 | Open in IMG/M |
| 3300031543|Ga0318516_10730199 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300031770|Ga0318521_10316593 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031820|Ga0307473_10080279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1670 | Open in IMG/M |
| 3300031890|Ga0306925_11050324 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 827 | Open in IMG/M |
| 3300031910|Ga0306923_10693588 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1134 | Open in IMG/M |
| 3300032043|Ga0318556_10686944 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032180|Ga0307471_100776136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1125 | Open in IMG/M |
| 3300032180|Ga0307471_103474036 | Not Available | 558 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 32.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.26% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.32% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.68% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.58% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.05% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.53% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.53% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010130 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1001106552 | 3300000559 | Soil | MTDLERLGVALVGVALAVLVAGVLLGLIGAWIRRASRR* |
| JGI25385J37094_100420034 | 3300002558 | Grasslands Soil | RAQMTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGKS* |
| JGI25385J37094_100946191 | 3300002558 | Grasslands Soil | MTDLERLGLGLVGFALAVVGGGVLLGLIGTWINKGRRGGKP* |
| JGI25384J37096_102194941 | 3300002561 | Grasslands Soil | MTDLERLGLALVGFAVAVVVAGVLLGLIGTWIKRGQRVTGRR* |
| Ga0070708_1003997822 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLERLGLALVGFAVAVVVAGVLLGLIGTWIKRGQRATGRR* |
| Ga0070698_1019109191 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | NRPMTDLERLGLALVGFAVAVVVAGVLLGLIGARITRGRG* |
| Ga0066697_101162835 | 3300005540 | Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGKS* |
| Ga0066701_100256131 | 3300005552 | Soil | MTDLERLGLALVGFAVAVVAAGVLLGLIGAWIKRGRR* |
| Ga0066701_101452602 | 3300005552 | Soil | MTDLVRLGLALVGFAAAVIAVGVLLGLSGAWIKRERK* |
| Ga0066701_103590321 | 3300005552 | Soil | HAMTDLERLGLALVGFALAVVVGGVLLGLIGTWIKKAK* |
| Ga0066701_107505862 | 3300005552 | Soil | MTDLERLGLALVGFAVAVVVAGVLLGLIGARITRGRR* |
| Ga0066701_108969622 | 3300005552 | Soil | MTDLDRLGLALVGFAMAVVVGGVLLGFIGRLIKK* |
| Ga0066692_105850762 | 3300005555 | Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGK |
| Ga0066692_109759382 | 3300005555 | Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGTWIKKAK* |
| Ga0066704_101475462 | 3300005557 | Soil | MTDLERLGLALVGFAVAVVVARVLLGLIGTWIKRGQRVTGRR* |
| Ga0066698_100020255 | 3300005558 | Soil | MTDLERLGLALVGFAVAVVVAGVLLGLIGARITRGRG* |
| Ga0066698_100876304 | 3300005558 | Soil | MTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGTR* |
| Ga0066698_101330493 | 3300005558 | Soil | MTDLERLGLALVGFAVAVVGGGVLLGLIGAWIRR* |
| Ga0066700_109616731 | 3300005559 | Soil | MTDLVRLGLGLVGFAAAVIAVGVLLGLSGAWIKRERK* |
| Ga0066703_102395362 | 3300005568 | Soil | MTDLDRLGLALVGFAVSVVVGGVLLGLIGRLIKGGKL* |
| Ga0066703_107261632 | 3300005568 | Soil | MNDLERLGLALVGFALAVVGCGVLLGLIGTWIKRAK* |
| Ga0066691_100068652 | 3300005586 | Soil | MTDLERLGLGLVGFAVAVVGGGVLLGLIGAWFKRR* |
| Ga0066905_1000888506 | 3300005713 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGAWIKRRRG* |
| Ga0066903_1005300993 | 3300005764 | Tropical Forest Soil | MTDLERLGLAMIGFAVAIIVGGVLLGLIGAAIKRGRG* |
| Ga0066903_1008026792 | 3300005764 | Tropical Forest Soil | MTPGGQEGDRSMTDLERLGLAMIGFAVAIIVGGVLLGLIGAAIKRGRG* |
| Ga0066903_1011750632 | 3300005764 | Tropical Forest Soil | MTDLERLGLAMIGFAVAIIVGGVLLGLVGAAIKRGRG* |
| Ga0066903_1015010914 | 3300005764 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGRWIKGRRR* |
| Ga0066903_1022092394 | 3300005764 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGAWIKRGRG* |
| Ga0066903_1035328612 | 3300005764 | Tropical Forest Soil | MTDLERLGLGLIGFAVAVVIGGVLLGLIGAWIKERRSK* |
| Ga0066656_103701982 | 3300006034 | Soil | MTDLDRLGLALVGFMVAVIIAGVLLGLIGRFIKGGKS* |
| Ga0066656_108602302 | 3300006034 | Soil | MTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGKR* |
| Ga0066652_1000190052 | 3300006046 | Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS* |
| Ga0075417_100071864 | 3300006049 | Populus Rhizosphere | MTDLERLGVALVGVALAVLVAGVLLGLIGAWIRKAK* |
| Ga0066659_113053051 | 3300006797 | Soil | RRVQMTDLDRLGLALVGFAVSVVVGGVLLGLIGRLVKGGKL* |
| Ga0075421_1025658411 | 3300006845 | Populus Rhizosphere | GGLCMTDLERLGVALVGVALAVLVAGVLLGLIGAWIRKAK* |
| Ga0075424_1008580233 | 3300006904 | Populus Rhizosphere | GLCMTDLERLGVALVGVALAVLVAGVLLGLIGAWIRKAK* |
| Ga0075424_1026574852 | 3300006904 | Populus Rhizosphere | MTDLVRLGLGLIGFAVAVVAIGILIGLIGTWINKRRNK* |
| Ga0099791_101517922 | 3300007255 | Vadose Zone Soil | MTDLERLGFALVGFAVAVVSAGVLLGLIGAWIKRGKR* |
| Ga0099793_102637011 | 3300007258 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVAGVLFGLIGAWIKKA* |
| Ga0099793_103325441 | 3300007258 | Vadose Zone Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKDGKS* |
| Ga0099794_100611073 | 3300007265 | Vadose Zone Soil | MTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGKR* |
| Ga0099794_102332711 | 3300007265 | Vadose Zone Soil | MTDLERLGLGLIGFAVAVVVAGVLLGLIAAWITKSRGRRD* |
| Ga0099794_105001972 | 3300007265 | Vadose Zone Soil | MTDLERLGLALVGFPLVVVVGGVLLGLIGAWITKAK* |
| Ga0066710_1000224367 | 3300009012 | Grasslands Soil | MTDLERLGLALVGFAIVVVVAGVLLGLVGARITKR |
| Ga0066710_1000871114 | 3300009012 | Grasslands Soil | ERLGLGLVGFAVVVVVAGVLLGLIGAWITKKRGGRG |
| Ga0066710_1000941616 | 3300009012 | Grasslands Soil | MTDLERLGLALVRFAVPVVVAGVLLGLIGTRITRGRG |
| Ga0066710_1016952841 | 3300009012 | Grasslands Soil | NHQMTDLERLGLGLVGFALAVVGGGVLLGLIGTWINKGRRGGKP |
| Ga0066710_1018059282 | 3300009012 | Grasslands Soil | MTDLERLGLVLVGFAVAVIVAGGLLGLVGAWLNRRIR |
| Ga0099829_101351703 | 3300009038 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGAWITKAK* |
| Ga0099829_103184212 | 3300009038 | Vadose Zone Soil | MTDLDRLGFALVGFALTVVVGGVLLGLIGAWIKKAR* |
| Ga0099829_104401001 | 3300009038 | Vadose Zone Soil | RFDMTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGKR* |
| Ga0099829_104656342 | 3300009038 | Vadose Zone Soil | MTDLVRLGLALGFAAAIIAVGVLLGLIGARIKRGRK* |
| Ga0099829_108949832 | 3300009038 | Vadose Zone Soil | MTDLERLGLGLVGFAVAVMASGVLLGLIGAWINKRRNG* |
| Ga0099829_110487651 | 3300009038 | Vadose Zone Soil | MTDLERLGLALVGFPLVVVVGGVLIGLIGAWITKAK* |
| Ga0099830_100084584 | 3300009088 | Vadose Zone Soil | MTDLERLGLALVGFPLAVVVGGVLLGLIGAWIKKAK* |
| Ga0099830_101170042 | 3300009088 | Vadose Zone Soil | MTDLDRLGLALVGFALTVVVGGVLLGLIGAWIKKAR* |
| Ga0099830_116264352 | 3300009088 | Vadose Zone Soil | SHLTDLERLGLALVGFAVAVIASGVLLGLIGAGIKRGTR* |
| Ga0099828_100459533 | 3300009089 | Vadose Zone Soil | MTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGRR* |
| Ga0099828_109377032 | 3300009089 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGAWIKEAK* |
| Ga0099827_101127854 | 3300009090 | Vadose Zone Soil | LTDLERLGLALVGFAVAVIASGVLLGLIGAGIKRGTR* |
| Ga0099827_101737662 | 3300009090 | Vadose Zone Soil | MTDLERLGLALVGFALAVVAGGVVLGLIGAWIKKAR* |
| Ga0099827_108847432 | 3300009090 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGAWIKKA* |
| Ga0099827_111867192 | 3300009090 | Vadose Zone Soil | MTDLDRLGLALVGFALAVVVGGVLFGLIGAWIKKAR* |
| Ga0066709_1000112688 | 3300009137 | Grasslands Soil | MTDLERLGLALVGFMVAVIAAGILLGLIGAWIKRDRR* |
| Ga0066709_1001552576 | 3300009137 | Grasslands Soil | MTDLDRLGLALVGFAVAVIVGGVLLGLIGRLIKGGKS* |
| Ga0099792_108200321 | 3300009143 | Vadose Zone Soil | MTDLVRLGLALVGFAAAVIAVGVLLGLIGARIKRGRK* |
| Ga0111538_105162262 | 3300009156 | Populus Rhizosphere | MTDLQRVGLALIGLMLAIGVGGVLFGLIGAWIRKAK* |
| Ga0126374_103650652 | 3300009792 | Tropical Forest Soil | MTDLERLGLAMIGFAIAIIVGGVLLGLIGAAIKRGRG* |
| Ga0126374_112212512 | 3300009792 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGAWIKRGRE* |
| Ga0105088_10837812 | 3300009810 | Groundwater Sand | MTDLERLGLALVGFAVAVVAAGVLLGLIGAWITRGRRSE* |
| Ga0105082_10718112 | 3300009814 | Groundwater Sand | MTDLERLGLALIGVPVAVVAAGVLLGLIGAWIKRGTR* |
| Ga0105085_11263802 | 3300009820 | Groundwater Sand | MTDLARFGLALVGVAVAVIVVGVLLGLISAWLKRDRR* |
| Ga0126384_124400132 | 3300010046 | Tropical Forest Soil | MTDLARFGLALVGVAAAVIVAGLLLGLAGAWIKRERR* |
| Ga0126382_103086463 | 3300010047 | Tropical Forest Soil | MNDLERLGLGLVGFAVAVVVAGVLLGLIGAWIKRGRE* |
| Ga0127493_10611952 | 3300010130 | Grasslands Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGTWIKKA |
| Ga0134088_100265483 | 3300010304 | Grasslands Soil | MTDLDRLGLALVGFALAVVVGGVLLGLIGAWIKKA* |
| Ga0134071_100071372 | 3300010336 | Grasslands Soil | MTDLERLGLALVGFAVAAVAAGVLLGLIGAWIKRGKR* |
| Ga0134062_100650133 | 3300010337 | Grasslands Soil | DLDRLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS* |
| Ga0126376_107529321 | 3300010359 | Tropical Forest Soil | MTDLERLGLAMIGFAIAIIVGGVLLGLIGAAFKRGRG* |
| Ga0126372_101145051 | 3300010360 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGAWIKRWR |
| Ga0126372_116539652 | 3300010360 | Tropical Forest Soil | MTDLERLGLAMIGFAVAIIVGGVLLGLIGAAIKRGR |
| Ga0126372_131262362 | 3300010360 | Tropical Forest Soil | MTDIARFGLALIGFAVAVIVIGIVIGLIGRSMTGRH* |
| Ga0126379_110253832 | 3300010366 | Tropical Forest Soil | MTDLERLGLAMIGFAIAIIVGGVLLGLIGAAIKRARG* |
| Ga0137389_101318822 | 3300012096 | Vadose Zone Soil | MTDLERLGLALVGFAAAVIAVGVLLGLSGAWIKRERK* |
| Ga0137388_100110476 | 3300012189 | Vadose Zone Soil | MTDLERLGLALVGFAAAVIAVGVLFGLSGAWIKRERK* |
| Ga0137388_105212992 | 3300012189 | Vadose Zone Soil | MTDLDRLGLALVGFALAVVVGGVLLGLIGAWITKAK* |
| Ga0137364_100968243 | 3300012198 | Vadose Zone Soil | MTDLERLGLALVGFALVVVVAGVLFGLVGAWIKKAG* |
| Ga0137374_100256082 | 3300012204 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGAWIKKAK* |
| Ga0137362_102251504 | 3300012205 | Vadose Zone Soil | MTDLVRLGLALVGSAVAVVVAGVLLGLIGARITRGRG* |
| Ga0137362_109893023 | 3300012205 | Vadose Zone Soil | MTDLQRLGLALIGLPLAIGAGGVLLGLIGAWIRQAKYKAK* |
| Ga0137377_106844681 | 3300012211 | Vadose Zone Soil | MTDLVRLGFALVGFAAAVIAVGVLLGLSGAWIKRERK* |
| Ga0137387_100054975 | 3300012349 | Vadose Zone Soil | MTDLERLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS* |
| Ga0137386_1000167915 | 3300012351 | Vadose Zone Soil | VLRRARMTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS* |
| Ga0137386_103862731 | 3300012351 | Vadose Zone Soil | LERLGLALVGFAVAVVSAGVLLGLIGAWIKRGKR* |
| Ga0137369_105471182 | 3300012355 | Vadose Zone Soil | MNDLERLGLALVGFALAVVVGGVLLGLIGAWIKKAK* |
| Ga0137369_109126892 | 3300012355 | Vadose Zone Soil | EGRFDMTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGTR* |
| Ga0137368_107611391 | 3300012358 | Vadose Zone Soil | DLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGTR* |
| Ga0137385_100222757 | 3300012359 | Vadose Zone Soil | LDRLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS* |
| Ga0137375_106886893 | 3300012360 | Vadose Zone Soil | FDMTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGTR* |
| Ga0137361_101530085 | 3300012362 | Vadose Zone Soil | LDMTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGKR* |
| Ga0137397_100397877 | 3300012685 | Vadose Zone Soil | MTDLVRLGLALVGFAAAVIAVGVLLGLIGARIKRRRK* |
| Ga0137397_102033872 | 3300012685 | Vadose Zone Soil | MTDLERLGLALVGVAVAVVVAGVLLGLIGARITRGRR* |
| Ga0137397_109327961 | 3300012685 | Vadose Zone Soil | MTDLEQLGLVLVGFALAVVVAGVLFGLFGAWIKKAR* |
| Ga0137396_108988061 | 3300012918 | Vadose Zone Soil | MTLSDLGLALVGFAVGVVVAGLLLGLIGAWIKKAK* |
| Ga0137410_105516163 | 3300012944 | Vadose Zone Soil | MLEGRLDMTDLERLGLALVGFAVAVVAAGVGLGLIGAWFKRSR* |
| Ga0126375_114925531 | 3300012948 | Tropical Forest Soil | MNDLERLGLALVGFAVAEVVPGVLLGLIGAWLKRGHQ* |
| Ga0134110_100635733 | 3300012975 | Grasslands Soil | MTDLDRLGLALIGFAVSVVVGGVILGLIGRLIKGGKS* |
| Ga0134076_100064685 | 3300012976 | Grasslands Soil | MTDLDRLGLALVGFMVAVIIAGVLLGLIGRFIKSGKS* |
| Ga0134075_100105454 | 3300014154 | Grasslands Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRLIRGGQS* |
| Ga0120098_10341582 | 3300015170 | Fossill | MNDLERLGLALVGFALAAVVGGVLLGLIGAWIKKAK* |
| Ga0137409_103616793 | 3300015245 | Vadose Zone Soil | MTDLERLGLALVGFPLAVVVGGVLLGLIGAWITKAK* |
| Ga0134112_101757873 | 3300017656 | Grasslands Soil | DLDRLGLALIGFAVSVVVGGVILGLIGRLIKGGKS |
| Ga0134083_100253802 | 3300017659 | Grasslands Soil | MTDLDRLGLALVGFALAVVVGGVLLGLIGAWIKKA |
| Ga0187777_103028722 | 3300017974 | Tropical Peatland | MTDLERLGRAMIGFAVTIIVGDVLLGLIGAAIKRGRG |
| Ga0184610_11707302 | 3300017997 | Groundwater Sediment | MTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGKR |
| Ga0187767_100414503 | 3300017999 | Tropical Peatland | MTDLERLGRAMIGFAVTIIVGGVLLGLIGAAIKRGRG |
| Ga0184608_100079603 | 3300018028 | Groundwater Sediment | MTDLERLGFALVGFAVAVVSAGVLLGLIGAWIKRGKR |
| Ga0184626_100121884 | 3300018053 | Groundwater Sediment | MTDLERLGLALVGFAVAVVAAGVLLGLIGAWIKRGAR |
| Ga0184623_101817491 | 3300018056 | Groundwater Sediment | MTDLVRLGLALGFAAAIIAVGVLLGLIGARIKRGRTSEGH |
| Ga0184637_102209881 | 3300018063 | Groundwater Sediment | MTDLERLGLALVGFPLAVVVGGVLLGLIGAWVTKAK |
| Ga0184633_101158601 | 3300018077 | Groundwater Sediment | MTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRG |
| Ga0184633_102119982 | 3300018077 | Groundwater Sediment | MTDLERLGLALIGFPLAVVVGGVLLGLIGAWVTKAK |
| Ga0066655_100227672 | 3300018431 | Grasslands Soil | MTDLDRLGLALVGFMVAVIIAGVLLGLIGRFIKGGKS |
| Ga0066655_101035082 | 3300018431 | Grasslands Soil | MTDLERLGLALVGFAVAVVVAGVLLGLIGARITRGRG |
| Ga0066667_100827391 | 3300018433 | Grasslands Soil | MTDLDRLGLALVGFAVAVIVGGVLLGLIGRLIKGGKS |
| Ga0066667_109557301 | 3300018433 | Grasslands Soil | MNDLERLGLALVGFALAVVGCGVLLGLIGTWIKRAK |
| Ga0066662_100881683 | 3300018468 | Grasslands Soil | MTDLERLGLALVGFAVAVVVAGVLLGLIGTWIKRGQRVTGRR |
| Ga0066662_102412851 | 3300018468 | Grasslands Soil | DLVRLGLGLVGFAAAVIAVGVLLGLSGAWIKRERK |
| Ga0066662_102463982 | 3300018468 | Grasslands Soil | MTDLDRLGLALVGFALAVVVGGVLFGLIGAWIKKAR |
| Ga0066662_102498772 | 3300018468 | Grasslands Soil | MTDLERLGLALVGFALAVVVGGVLLGLIGTWIKKAK |
| Ga0066662_123617991 | 3300018468 | Grasslands Soil | RGSIHMTDLERLGLALVGFALVVVVAGVLFGLVGAWIKKAR |
| Ga0137408_10587312 | 3300019789 | Vadose Zone Soil | DLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGKS |
| Ga0137408_13633371 | 3300019789 | Vadose Zone Soil | MTDLQRLGLALIGLPLAIGAGGVLLGLIGAWIRQAKYKAK |
| Ga0137408_13784462 | 3300019789 | Vadose Zone Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGKS |
| Ga0193755_12267221 | 3300020004 | Soil | MTDLQRLGLALIGLPLAIGAGGVLLGLIGAWIKQAKYKAK |
| Ga0179594_100426972 | 3300020170 | Vadose Zone Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFVKGGKS |
| Ga0187846_103987562 | 3300021476 | Biofilm | MTDLERLGLGLVGFAFAVVLAGLVLGLIGALIKRAK |
| Ga0126371_103852631 | 3300021560 | Tropical Forest Soil | MTDLERLGLAMIGFAIAIIVGGVLLGLIGAAVKGGRG |
| Ga0126371_122523502 | 3300021560 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGRWIKGRRR |
| Ga0207684_100127987 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLERLGLALVGFAVAVVVAGVLLGLIGARITRGRR |
| Ga0207684_100397142 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLERLGLALVGFAVAVVVAGVLLGLIGARIKRGRG |
| Ga0207684_100803264 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDLERLGLALVGFAVAVVVAGVLLGLIGTWIKRGQRATGRR |
| Ga0207684_101387251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDLVRLGFALIGFAVAVVVAGVLLGLIGARITRGRG |
| Ga0207646_1004173612 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LERLGLALVGFAVAVVVAGVLLGLIGTWIKRGQRATGRR |
| Ga0209234_12865312 | 3300026295 | Grasslands Soil | MTDLERLGLALVGFALVVVVAGVLFGLVGAWIKKAR |
| Ga0209235_10035661 | 3300026296 | Grasslands Soil | RAQMTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKGGKS |
| Ga0209235_10727982 | 3300026296 | Grasslands Soil | MTDLERLGLTLVGFAVVIVGGGVLLGLVGAWITKQRGR |
| Ga0209237_10572501 | 3300026297 | Grasslands Soil | MTDLERLGLGLVGFALAVVGGGVLLGLIGTWINKGRRGGKP |
| Ga0209468_10035605 | 3300026306 | Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIKSGKS |
| Ga0209761_12136931 | 3300026313 | Grasslands Soil | MTDLERLGLALVGFALAVVVGGVLLGLVGAWITKSRGPGGL |
| Ga0209761_13208282 | 3300026313 | Grasslands Soil | MTDLDRLGLALVGFAVAVVVGGVLLGLIGRLIKGEKW |
| Ga0209801_13274261 | 3300026326 | Soil | MTDLDRLGLALVGFAVAVIVGGVLLGLIGRLIKGG |
| Ga0209802_10441451 | 3300026328 | Soil | MTDLVRLGLALVGFAAAVIAVGVLLGLSGAWIKRERK |
| Ga0209802_11411243 | 3300026328 | Soil | MTDLDRLGLALVGFMVAVIVAGVLLGLIGRFIRGGQS |
| Ga0209804_12787061 | 3300026335 | Soil | MTDLDRLGLALVGFAVSVVVGGVLLGLIGRLIKGGKL |
| Ga0209058_10364202 | 3300026536 | Soil | MTDLERLGLALVGFAVAVVSAGVLLGLIGAWIKRGTR |
| Ga0209056_100001025 | 3300026538 | Soil | MTDLERLGLALVGFMVAVIAAGILLGLIGAWIKRDRR |
| Ga0209056_102133552 | 3300026538 | Soil | MTDLDRLGLALVGFALAVVVGGVLLGLIGAWIKKT |
| Ga0209376_100461314 | 3300026540 | Soil | MTDLDRLGLALIGFAVSVVVGGVILGLIGRLIKGGKS |
| Ga0209648_1000073818 | 3300026551 | Grasslands Soil | MTDLERLGLALVGFPLAVVVGGVLLGLIGAWIKKAK |
| Ga0209648_101282342 | 3300026551 | Grasslands Soil | MTDLERLGLALVGFPLAVVVGGALLGVIGAWIRRAKEGEL |
| Ga0209875_10257012 | 3300027209 | Groundwater Sand | MTDLERLGLALVGFAVAVVAAGVLLGLIGAWITRGRRSE |
| Ga0209861_10059042 | 3300027332 | Groundwater Sand | MTDLERLGLALVDFAVGAAGVLLGLIGAWIKRGKR |
| Ga0209899_10253212 | 3300027490 | Groundwater Sand | MTDLERLGLALIGVPVAVVAAGVLLGLIGAWIKRGTR |
| Ga0209466_10316853 | 3300027646 | Tropical Forest Soil | MNDLERLGLALVGFAVAVVVAGVLLGLIGAWIKRRRG |
| Ga0209388_10027455 | 3300027655 | Vadose Zone Soil | MTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGKR |
| Ga0209180_100059832 | 3300027846 | Vadose Zone Soil | MTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGRR |
| Ga0209180_102047393 | 3300027846 | Vadose Zone Soil | RFDMTDLERLGLALVGFAGAVVSAGVLLGLIGAWIKRGKR |
| Ga0209180_103834982 | 3300027846 | Vadose Zone Soil | MTDLDRLGFALVGFALTVVVGGVLLGLIGAWITKAK |
| Ga0209180_106915922 | 3300027846 | Vadose Zone Soil | MTDLVRLGLALGFAAAIIAVGVLLGLIGARIKRGRK |
| Ga0209701_102736421 | 3300027862 | Vadose Zone Soil | MTDLDRLGLALVGFALAVVVGGVLLGLIGAWIKKAK |
| Ga0209814_100310473 | 3300027873 | Populus Rhizosphere | MTDLERLGVALVGVALAVLVAGVLLGLIGAWIRRASRR |
| Ga0209283_100705613 | 3300027875 | Vadose Zone Soil | MTDLDRLGLALVGFALTVVVGGVLLGLIGAWIKKAR |
| Ga0209283_106161442 | 3300027875 | Vadose Zone Soil | LTDLERLGLALVGFAVAVIASGVLLGLIGAGIKRGTR |
| Ga0209590_101334142 | 3300027882 | Vadose Zone Soil | MTDLERLGLALVGFAVAVIASGVLLGLIVARINKRRTGNR |
| Ga0209488_102928621 | 3300027903 | Vadose Zone Soil | MTDLVRLGLALVGFAAAVIAVGVLLGLIGARIKRGRK |
| Ga0209382_111720721 | 3300027909 | Populus Rhizosphere | MTDLERLGVALVGVALAVLVAGVLLGLIGAWIRKAK |
| Ga0209382_121495291 | 3300027909 | Populus Rhizosphere | MTDLQRVGLALIGLMLAIGVGGVLFGLIGAWIRKAK |
| Ga0209853_11000501 | 3300027961 | Groundwater Sand | MNDLERLGLALVGFALAVVVGGVPLGLIGAWIKKAR |
| Ga0137415_101522032 | 3300028536 | Vadose Zone Soil | MTDLERLGLALVGFALAVVVAGVLFGLIGAWIKKA |
| Ga0137415_111067062 | 3300028536 | Vadose Zone Soil | MTLSDLGLALVGFAVGVVVAGLLLGLIGAWIKKAK |
| Ga0307278_103169332 | 3300028878 | Soil | MTDLQRLGLALIGFMLAIGVGGVLLGLIGAWIRKAKHKAK |
| Ga0318516_107301992 | 3300031543 | Soil | MTDLERLGLAMIGFAVAIIVGGVLLGLIGAAIKRGRG |
| Ga0318521_103165931 | 3300031770 | Soil | SMTDLERLGLAMIGFAVTIIVGGVLLGLIGAAIKRGRG |
| Ga0307473_100802792 | 3300031820 | Hardwood Forest Soil | MTDIARFGLALIGFAVAVIVIGIVIGLIGRSMTGRH |
| Ga0306925_110503242 | 3300031890 | Soil | MTDLARFGHALVGVAVAVIVVGVLLGLAGAWIKRERR |
| Ga0306923_106935883 | 3300031910 | Soil | MTDLERLGLTMIGFAVAIIVGGVLLGLIGAAIKRGRG |
| Ga0318556_106869441 | 3300032043 | Soil | TRRDRSMTDLERLGLAMIGFAVAIIVGGVLLGLIGAAIKRGRG |
| Ga0307471_1007761362 | 3300032180 | Hardwood Forest Soil | MTDLDRLGFALVGFALTVVVGGVLLGLIGAWIKKAR |
| Ga0307471_1034740362 | 3300032180 | Hardwood Forest Soil | MTDLERLGLALVGFALAVVVVGVLLGLVGAWMKKAG |
| ⦗Top⦘ |