


| Basic Information | |
|---|---|
| Family ID | F028729 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPS |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 22.63 % |
| % of genes near scaffold ends (potentially truncated) | 97.37 % |
| % of genes from short scaffolds (< 2000 bps) | 91.58 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (88.947 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.421 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.263 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 13.43% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 6.84 |
| PF02586 | SRAP | 3.68 |
| PF14520 | HHH_5 | 3.16 |
| PF00580 | UvrD-helicase | 2.63 |
| PF00589 | Phage_integrase | 2.11 |
| PF01844 | HNH | 2.11 |
| PF00106 | adh_short | 1.05 |
| PF10108 | DNA_pol_B_exo2 | 1.05 |
| PF08843 | AbiEii | 0.53 |
| PF00190 | Cupin_1 | 0.53 |
| PF00582 | Usp | 0.53 |
| PF13458 | Peripla_BP_6 | 0.53 |
| PF03551 | PadR | 0.53 |
| PF00034 | Cytochrom_C | 0.53 |
| PF12680 | SnoaL_2 | 0.53 |
| PF04430 | DUF498 | 0.53 |
| PF00903 | Glyoxalase | 0.53 |
| PF03779 | SPW | 0.53 |
| PF13589 | HATPase_c_3 | 0.53 |
| PF04226 | Transgly_assoc | 0.53 |
| PF00389 | 2-Hacid_dh | 0.53 |
| PF00872 | Transposase_mut | 0.53 |
| PF12706 | Lactamase_B_2 | 0.53 |
| PF00005 | ABC_tran | 0.53 |
| PF00664 | ABC_membrane | 0.53 |
| PF01135 | PCMT | 0.53 |
| PF13460 | NAD_binding_10 | 0.53 |
| PF13406 | SLT_2 | 0.53 |
| PF11159 | DUF2939 | 0.53 |
| PF04298 | Zn_peptidase_2 | 0.53 |
| PF02594 | DUF167 | 0.53 |
| PF13560 | HTH_31 | 0.53 |
| PF04828 | GFA | 0.53 |
| PF00166 | Cpn10 | 0.53 |
| PF02735 | Ku | 0.53 |
| PF13964 | Kelch_6 | 0.53 |
| PF09994 | DUF2235 | 0.53 |
| PF01972 | SDH_sah | 0.53 |
| PF01070 | FMN_dh | 0.53 |
| PF00857 | Isochorismatase | 0.53 |
| PF01068 | DNA_ligase_A_M | 0.53 |
| PF01527 | HTH_Tnp_1 | 0.53 |
| PF03466 | LysR_substrate | 0.53 |
| PF04317 | DUF463 | 0.53 |
| PF07669 | Eco57I | 0.53 |
| PF00561 | Abhydrolase_1 | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 6.84 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 3.68 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 2.63 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 2.63 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 2.63 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.53 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.53 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.53 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.53 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.53 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.53 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.53 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.53 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.53 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.53 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.53 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 0.53 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.53 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.53 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.53 |
| COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| COG2738 | Zn-dependent membrane protease YugP | Posttranslational modification, protein turnover, chaperones [O] | 0.53 |
| COG3106 | Ras-like GTP-binding stress-induced protein YcjX, DUF463 family | Signal transduction mechanisms [T] | 0.53 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.53 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.53 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.53 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 88.95 % |
| Unclassified | root | N/A | 11.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT02G4TO5 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
| 2170459021|G14TP7Y02F3ADX | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 675 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10016408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1788 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10078114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1059983 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300004479|Ga0062595_101110328 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 692 | Open in IMG/M |
| 3300005093|Ga0062594_102961358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300005445|Ga0070708_101368801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300005447|Ga0066689_10286404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1020 | Open in IMG/M |
| 3300005459|Ga0068867_101896450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300005564|Ga0070664_101020300 | Not Available | 778 | Open in IMG/M |
| 3300005587|Ga0066654_10545779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 638 | Open in IMG/M |
| 3300005598|Ga0066706_10769111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300005598|Ga0066706_11059295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 622 | Open in IMG/M |
| 3300005713|Ga0066905_100084206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2101 | Open in IMG/M |
| 3300005713|Ga0066905_100912370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300005713|Ga0066905_101983743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
| 3300005764|Ga0066903_102916785 | Not Available | 927 | Open in IMG/M |
| 3300005764|Ga0066903_104039059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 786 | Open in IMG/M |
| 3300005764|Ga0066903_104654149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300005764|Ga0066903_106618612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 603 | Open in IMG/M |
| 3300005764|Ga0066903_106756595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005764|Ga0066903_107701198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 554 | Open in IMG/M |
| 3300006050|Ga0075028_100196401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1087 | Open in IMG/M |
| 3300006059|Ga0075017_101685723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300006086|Ga0075019_10656125 | Not Available | 661 | Open in IMG/M |
| 3300006086|Ga0075019_10893067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → unclassified Acidithiobacillales → Acidithiobacillales bacterium SG8_45 | 570 | Open in IMG/M |
| 3300006881|Ga0068865_101078131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 707 | Open in IMG/M |
| 3300009094|Ga0111539_11829694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300009137|Ga0066709_102824756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300009148|Ga0105243_13000051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 512 | Open in IMG/M |
| 3300009162|Ga0075423_12832484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300009519|Ga0116108_1051812 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300009521|Ga0116222_1277849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300009522|Ga0116218_1291619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300009553|Ga0105249_11064578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 878 | Open in IMG/M |
| 3300009630|Ga0116114_1001372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 12966 | Open in IMG/M |
| 3300009637|Ga0116118_1198488 | Not Available | 630 | Open in IMG/M |
| 3300009640|Ga0116126_1105407 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300009698|Ga0116216_10481566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 751 | Open in IMG/M |
| 3300009839|Ga0116223_10607757 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300009839|Ga0116223_10892790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 507 | Open in IMG/M |
| 3300010043|Ga0126380_10548744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300010043|Ga0126380_12270794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methylocapsa → Methylocapsa aurea | 503 | Open in IMG/M |
| 3300010046|Ga0126384_11747331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
| 3300010047|Ga0126382_11380380 | Not Available | 641 | Open in IMG/M |
| 3300010166|Ga0126306_11408045 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300010339|Ga0074046_10611910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. | 644 | Open in IMG/M |
| 3300010358|Ga0126370_10177034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1586 | Open in IMG/M |
| 3300010376|Ga0126381_100358792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2017 | Open in IMG/M |
| 3300010376|Ga0126381_101828873 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300010376|Ga0126381_103786214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 591 | Open in IMG/M |
| 3300010376|Ga0126381_104377858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300010379|Ga0136449_100616009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1845 | Open in IMG/M |
| 3300010379|Ga0136449_102290876 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 784 | Open in IMG/M |
| 3300010379|Ga0136449_103524130 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010400|Ga0134122_11465600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300010403|Ga0134123_13484839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300012096|Ga0137389_11225919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300012199|Ga0137383_10616255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300012200|Ga0137382_10893985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300012202|Ga0137363_11208941 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012210|Ga0137378_10315596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1454 | Open in IMG/M |
| 3300012359|Ga0137385_10782116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 794 | Open in IMG/M |
| 3300012361|Ga0137360_11823479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300012361|Ga0137360_11829309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
| 3300012977|Ga0134087_10045092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1721 | Open in IMG/M |
| 3300012987|Ga0164307_11644899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Shewanellaceae | 544 | Open in IMG/M |
| 3300014159|Ga0181530_10032343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3699 | Open in IMG/M |
| 3300014162|Ga0181538_10378307 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300014325|Ga0163163_11830977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 667 | Open in IMG/M |
| 3300014495|Ga0182015_10828014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 581 | Open in IMG/M |
| 3300014638|Ga0181536_10319353 | Not Available | 716 | Open in IMG/M |
| 3300015372|Ga0132256_102605758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 606 | Open in IMG/M |
| 3300015372|Ga0132256_102615555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 605 | Open in IMG/M |
| 3300015374|Ga0132255_104035684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300016270|Ga0182036_10712150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300016294|Ga0182041_10388652 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1184 | Open in IMG/M |
| 3300016294|Ga0182041_10876922 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300016294|Ga0182041_10883815 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300016294|Ga0182041_10982513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300016294|Ga0182041_11075287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 730 | Open in IMG/M |
| 3300016294|Ga0182041_11158433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 704 | Open in IMG/M |
| 3300016319|Ga0182033_10858081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → Xanthobacter flavus | 802 | Open in IMG/M |
| 3300016319|Ga0182033_11231593 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300016341|Ga0182035_10584507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 963 | Open in IMG/M |
| 3300016371|Ga0182034_10357384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1187 | Open in IMG/M |
| 3300016371|Ga0182034_10724776 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300016371|Ga0182034_11278075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300016387|Ga0182040_10585635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300016387|Ga0182040_11773091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300016387|Ga0182040_11962369 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300016404|Ga0182037_11148209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 681 | Open in IMG/M |
| 3300016404|Ga0182037_11268187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300016422|Ga0182039_10070743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2466 | Open in IMG/M |
| 3300017926|Ga0187807_1341197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 503 | Open in IMG/M |
| 3300017939|Ga0187775_10207155 | Not Available | 731 | Open in IMG/M |
| 3300017943|Ga0187819_10341174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 866 | Open in IMG/M |
| 3300017946|Ga0187879_10725132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 554 | Open in IMG/M |
| 3300017948|Ga0187847_10492120 | Not Available | 679 | Open in IMG/M |
| 3300017955|Ga0187817_10752655 | Not Available | 622 | Open in IMG/M |
| 3300017955|Ga0187817_10810123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300017972|Ga0187781_10838064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 668 | Open in IMG/M |
| 3300017974|Ga0187777_10111130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1807 | Open in IMG/M |
| 3300017974|Ga0187777_10586188 | Not Available | 785 | Open in IMG/M |
| 3300017995|Ga0187816_10483667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300017995|Ga0187816_10511724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300017996|Ga0187891_1000785 | All Organisms → cellular organisms → Bacteria | 30174 | Open in IMG/M |
| 3300018003|Ga0187876_1309184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300018007|Ga0187805_10341698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300018014|Ga0187860_1036315 | Not Available | 2625 | Open in IMG/M |
| 3300018017|Ga0187872_10004416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae | 10610 | Open in IMG/M |
| 3300018017|Ga0187872_10074596 | Not Available | 1749 | Open in IMG/M |
| 3300018017|Ga0187872_10179035 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300018019|Ga0187874_10119049 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300018058|Ga0187766_11118136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300018081|Ga0184625_10588305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 547 | Open in IMG/M |
| 3300018085|Ga0187772_11183856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300018469|Ga0190270_12413539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 587 | Open in IMG/M |
| 3300018469|Ga0190270_13026938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300021168|Ga0210406_10121612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2206 | Open in IMG/M |
| 3300021168|Ga0210406_10997496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300021178|Ga0210408_11206382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300021420|Ga0210394_11155633 | Not Available | 666 | Open in IMG/M |
| 3300021432|Ga0210384_11595558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300021478|Ga0210402_10660101 | Not Available | 968 | Open in IMG/M |
| 3300021479|Ga0210410_11506148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 566 | Open in IMG/M |
| 3300021559|Ga0210409_10792150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300021559|Ga0210409_11289528 | Not Available | 606 | Open in IMG/M |
| 3300021860|Ga0213851_1756298 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 742 | Open in IMG/M |
| 3300025916|Ga0207663_10021625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3665 | Open in IMG/M |
| 3300025929|Ga0207664_11824167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300025945|Ga0207679_11943158 | Not Available | 536 | Open in IMG/M |
| 3300025945|Ga0207679_12094468 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300026277|Ga0209350_1129497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 568 | Open in IMG/M |
| 3300026308|Ga0209265_1052868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300026547|Ga0209156_10173129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300026896|Ga0207730_1001776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2433 | Open in IMG/M |
| 3300027583|Ga0209527_1020657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1454 | Open in IMG/M |
| 3300027909|Ga0209382_11498642 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300027910|Ga0209583_10289977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 738 | Open in IMG/M |
| 3300027915|Ga0209069_10692975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300028710|Ga0307322_10176069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 577 | Open in IMG/M |
| 3300028713|Ga0307303_10172868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300028720|Ga0307317_10330023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300029636|Ga0222749_10090432 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1422 | Open in IMG/M |
| 3300029636|Ga0222749_10403602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300030707|Ga0310038_10396453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 601 | Open in IMG/M |
| 3300031231|Ga0170824_122245502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 706 | Open in IMG/M |
| 3300031474|Ga0170818_114222589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 794 | Open in IMG/M |
| 3300031543|Ga0318516_10030841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2828 | Open in IMG/M |
| 3300031640|Ga0318555_10035717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2450 | Open in IMG/M |
| 3300031682|Ga0318560_10369306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300031682|Ga0318560_10493983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 663 | Open in IMG/M |
| 3300031682|Ga0318560_10745640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 529 | Open in IMG/M |
| 3300031708|Ga0310686_104312436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031719|Ga0306917_11399760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 539 | Open in IMG/M |
| 3300031724|Ga0318500_10690943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300031744|Ga0306918_10352202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Xanthobacter → Xanthobacter flavus | 1142 | Open in IMG/M |
| 3300031748|Ga0318492_10427604 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031765|Ga0318554_10066386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1993 | Open in IMG/M |
| 3300031768|Ga0318509_10374615 | Not Available | 796 | Open in IMG/M |
| 3300031777|Ga0318543_10012080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3047 | Open in IMG/M |
| 3300031777|Ga0318543_10376597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300031793|Ga0318548_10196090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 990 | Open in IMG/M |
| 3300031845|Ga0318511_10129593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1092 | Open in IMG/M |
| 3300031890|Ga0306925_11499549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 660 | Open in IMG/M |
| 3300031894|Ga0318522_10012632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2590 | Open in IMG/M |
| 3300031910|Ga0306923_11855708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 617 | Open in IMG/M |
| 3300031910|Ga0306923_12249856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Variibacter → Variibacter gotjawalensis | 545 | Open in IMG/M |
| 3300031912|Ga0306921_11249741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300031912|Ga0306921_11491167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300031941|Ga0310912_10725156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
| 3300031942|Ga0310916_10070236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2738 | Open in IMG/M |
| 3300031945|Ga0310913_10829899 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 651 | Open in IMG/M |
| 3300031954|Ga0306926_11265675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 863 | Open in IMG/M |
| 3300031954|Ga0306926_11972381 | Not Available | 657 | Open in IMG/M |
| 3300031954|Ga0306926_12141210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300032051|Ga0318532_10091981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1066 | Open in IMG/M |
| 3300032059|Ga0318533_10154112 | Not Available | 1627 | Open in IMG/M |
| 3300032063|Ga0318504_10637714 | Not Available | 512 | Open in IMG/M |
| 3300032067|Ga0318524_10459567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 666 | Open in IMG/M |
| 3300032160|Ga0311301_12419568 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300032160|Ga0311301_12495508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 578 | Open in IMG/M |
| 3300032261|Ga0306920_102507567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300032261|Ga0306920_102863413 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300033289|Ga0310914_10620011 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
| 3300033289|Ga0310914_10757522 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300033289|Ga0310914_11034901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300033805|Ga0314864_0058605 | Not Available | 890 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.32% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.26% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.21% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.63% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.11% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.58% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.58% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.05% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 1.05% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.53% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.53% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.53% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.53% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.53% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.53% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.53% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 2170459021 | Litter degradation NP4 | Engineered | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018014 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_00041780 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MCGRVIQSGGPLRYAIVDGLNVRDSRVHDYPRDGTAAPSQELLV |
| 4NP_01040960 | 2170459021 | Switchgrass, Maize And Mischanthus Litter | MCGRVIQSSGPLRYAMVDGVNVRDSRVHNYPPRLN |
| AF_2010_repII_A001DRAFT_100164083 | 3300000793 | Forest Soil | MRPLCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPP |
| AF_2010_repII_A001DRAFT_100781141 | 3300000793 | Forest Soil | MCGRVIQSSGPLRYAIVDGISVRDSRVHNYPPRWNAAPSQELLV |
| AP72_2010_repI_A100DRAFT_10599832 | 3300000837 | Forest Soil | MCGRVIQAQSSDPLRYAIVDGMNVRDSRVHNYPPRW |
| Ga0062595_1011103281 | 3300004479 | Soil | MCGRVIQSSAPIKYGIVDGLNVRDSRLQNYPSRWNGAPSQGLLVI |
| Ga0062594_1029613581 | 3300005093 | Soil | MCGRIIQSGGPLRYAIVDGLNTRDSRVHNYPPRWNAAPSQELLV |
| Ga0070708_1013688012 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRIIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPSQDLL |
| Ga0066689_102864042 | 3300005447 | Soil | MCGRVIQSSGPLRYAIVDGMNVREGRLHNYPPRWNAAPSQDL* |
| Ga0068867_1018964501 | 3300005459 | Miscanthus Rhizosphere | MCGRVIQSSGSLRYSFVDGMNVRDSRVHSYPPRWDAAPSQE |
| Ga0070664_1010203003 | 3300005564 | Corn Rhizosphere | MCGRVIQSSEPLAYAIVDGMDVRDTRLHNHPPRWN |
| Ga0066654_105457791 | 3300005587 | Soil | MCERVIQSGGPLRYGIVEGLDVRDNRVHNYPPRWNAAPSQELLVI |
| Ga0066706_107691112 | 3300005598 | Soil | MCGRVIQSGGPIRYAIVDGIDVPDSRVHNYPPRWNAA |
| Ga0066706_110592952 | 3300005598 | Soil | MCGRVIQRSGPLRYAIVDGMNVRDSRVHNYPPRWNG |
| Ga0066905_1000842067 | 3300005713 | Tropical Forest Soil | MQAMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQ |
| Ga0066905_1009123702 | 3300005713 | Tropical Forest Soil | MCGRVIQSSGPLRYALVDGMNVRDSRVHNYPPRWNAAPSQELLVI |
| Ga0066905_1019837431 | 3300005713 | Tropical Forest Soil | MTIWLPVCGRVIQSSGPLRYAIVDGMNVRDSRVHNY |
| Ga0066903_1029167851 | 3300005764 | Tropical Forest Soil | MCGRVIQSGGPLRYTIVDGLNVRDSRVHNYPARWN |
| Ga0066903_1040390591 | 3300005764 | Tropical Forest Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQEL |
| Ga0066903_1046541492 | 3300005764 | Tropical Forest Soil | MCGRIIQSSGPVRYAIIDGLNMCDSRVHNYPPRWN |
| Ga0066903_1066186121 | 3300005764 | Tropical Forest Soil | CGRVIQASSPLKLAIVDGMSVRDSRLTNHPPHYNGAPSQDLW* |
| Ga0066903_1067565951 | 3300005764 | Tropical Forest Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRFHNYPPRWNGAPSQE |
| Ga0066903_1077011982 | 3300005764 | Tropical Forest Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGAPSQDLL |
| Ga0075028_1001964011 | 3300006050 | Watersheds | MCGRVIQSSGPLRYAILEGMDVRDSRTHNYPPRWNGAPSQD |
| Ga0075017_1016857231 | 3300006059 | Watersheds | MCGRVIQSSGPLRYAILEGMDVRDNRVHNYPARWN |
| Ga0075019_106561251 | 3300006086 | Watersheds | MCGRVIQSSPLTRLAIVEGLDVGDSRFHNYPPRWNGA |
| Ga0075019_108930672 | 3300006086 | Watersheds | IQSSAPIRYAIVDGMNVRDSRVHNYPPRWNAAPKQLHPVSDEPLPQ* |
| Ga0068865_1010781311 | 3300006881 | Miscanthus Rhizosphere | MCGRVIQSSGPLRYSFVDGMSVRDSRVHSYPPRWDAAPSQELLVIR |
| Ga0111539_118296942 | 3300009094 | Populus Rhizosphere | MCGRIIQSGGPFRYAIVDGMNARDSRVHNYPPRWNGAPSQELLVI |
| Ga0066709_1028247562 | 3300009137 | Grasslands Soil | MCGRVIQSGGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLV |
| Ga0105243_130000512 | 3300009148 | Miscanthus Rhizosphere | MCGRIIQSGGPLRYAIVDGLNARDSRVHNYPPRWNAAPSQ |
| Ga0075423_128324842 | 3300009162 | Populus Rhizosphere | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWN |
| Ga0116108_10518122 | 3300009519 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAA |
| Ga0116222_12778492 | 3300009521 | Peatlands Soil | MTTMCGRIVQSSGPVRYAIIDGMSVGNSPGNNYPQRWNAGPGQ |
| Ga0116218_12916191 | 3300009522 | Peatlands Soil | MCGRVIQSSGPVCYGIVERMDLRDSRAHNYPPRWNGAPSQDLL |
| Ga0105249_110645781 | 3300009553 | Switchgrass Rhizosphere | MCGRIIQSSGPLRHAIVEGLNVSDSRMGNVPPRYNAAPSQELLVI |
| Ga0116114_10013721 | 3300009630 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQDL |
| Ga0116118_11984882 | 3300009637 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAAPS |
| Ga0116126_11054072 | 3300009640 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQ |
| Ga0116216_104815663 | 3300009698 | Peatlands Soil | MCGRVIQSSGPLRYAILEGMHVRDSRVHNYPSEAQS |
| Ga0116223_106077571 | 3300009839 | Peatlands Soil | MCGRVIQSSGLVRYAIVDGMNVRDSRVHNYPPRWNAA |
| Ga0116223_108927901 | 3300009839 | Peatlands Soil | MCGRIIQSSGPVRYAIVDGMNARDSRVHNYPPRWNAA |
| Ga0126380_105487441 | 3300010043 | Tropical Forest Soil | MDDYIRAMCGRVIQSSGPLRYAMVDGMNVRDSRVHNCPPRWNAAPSQELLVI |
| Ga0126380_122707941 | 3300010043 | Tropical Forest Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNVAPSQELLIIR |
| Ga0126384_117473311 | 3300010046 | Tropical Forest Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRFHNYPPRWNGAPSQ |
| Ga0126382_113803802 | 3300010047 | Tropical Forest Soil | MCGRVIQSSGRLRYAIVDGMDARDSRVRDYRPRWNGAP |
| Ga0126306_114080452 | 3300010166 | Serpentine Soil | MCGRVIQARGPLSYAIVDGLDVRDSRLSNYPRRWNGCP |
| Ga0074046_106119101 | 3300010339 | Bog Forest Soil | VIQSSGPLRYATVEGMDARHIRVHDYPPGWNAAPSQDLLVIR |
| Ga0126370_101770341 | 3300010358 | Tropical Forest Soil | MCGRVIQSSGPLRYVIVDGINVRDSRVHNYPPRWNA |
| Ga0126381_1003587921 | 3300010376 | Tropical Forest Soil | VIQSSGPIRYAIVDGIDVPDNRLHNYPLRWNAAPSQDLLMI |
| Ga0126381_1018288733 | 3300010376 | Tropical Forest Soil | MTISDPCGRVIQSSGPLRYAAVDGMNLRDSRVHNYPP |
| Ga0126381_1037862142 | 3300010376 | Tropical Forest Soil | MTISCGMCGRVIQSSRPLRYAVVDGMNVRDSRVHNYPPRW |
| Ga0126381_1043778582 | 3300010376 | Tropical Forest Soil | MCGRVIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPS |
| Ga0136449_1006160091 | 3300010379 | Peatlands Soil | MCGRIIQSSGPLQFAFVEGMNVRDRRVHNYPPRWNAAPSQD |
| Ga0136449_1022908762 | 3300010379 | Peatlands Soil | MCGRLIQSSGPLRYAILEGMDVRDSRVQNYPARWNGAPSQ |
| Ga0136449_1035241302 | 3300010379 | Peatlands Soil | MCGRVIQSSGPVRYAIVDGMNVRDSRLHNYPPRWNAA |
| Ga0134122_114656002 | 3300010400 | Terrestrial Soil | MLTGDYIENMCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGAPS |
| Ga0134123_134848391 | 3300010403 | Terrestrial Soil | MCGRVIQSSGPLRYAIIDGMNVRDSRVHNYPPRWNAAPSQELLVV |
| Ga0137389_112259191 | 3300012096 | Vadose Zone Soil | MGMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPRRWNAAPSQELLV |
| Ga0137383_106162552 | 3300012199 | Vadose Zone Soil | MCGRVIQSSGPLRYAIVDGVNVRDSRVHNYPPRWNAAPSQ |
| Ga0137382_108939851 | 3300012200 | Vadose Zone Soil | MCGRVIQSGGPLRYAIVDGMRDSRVHNYPPRWNAAPNQELLEPISKSFEE |
| Ga0137363_112089411 | 3300012202 | Vadose Zone Soil | MDDYILPMCGRVIQSSGPLRYAIVDGMNVRDSRLHNHPPRWNAAPS |
| Ga0137378_103155963 | 3300012210 | Vadose Zone Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAP |
| Ga0137385_107821161 | 3300012359 | Vadose Zone Soil | MCGRIIQSSGPLRYAIVDGMNVREDRLHNCPPRWNGAPSQDLL |
| Ga0137360_118234791 | 3300012361 | Vadose Zone Soil | MCGRVVQSSGPLRYAIVDGMNVRADRLHNYPPRWNGAPSQDLLV |
| Ga0137360_118293092 | 3300012361 | Vadose Zone Soil | MCGRVIQSSGPLRYAIVDGMNVRADRLHNYPPRWNGAPSQDLLV |
| Ga0134087_100450921 | 3300012977 | Grasslands Soil | MCGRVIQSGGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQEL |
| Ga0164307_116448992 | 3300012987 | Soil | IQSSGPLRYAIVDGMDVRDSRVHNYPPRWNAAPSQELLVTRRNYARLP* |
| Ga0181530_100323437 | 3300014159 | Bog | MCGRVIQSSGPLSYAILDGMNVRDSRVHNYPPRWNAAPSQDLLV |
| Ga0181538_103783071 | 3300014162 | Bog | MCGRVIQSSGPVRYAIVDGMNVRDSRLHNYPPRWNAAPSQDLL |
| Ga0163163_118309772 | 3300014325 | Switchgrass Rhizosphere | MCGRVIQSSGPLNLAIVDGMNVRDSRVHNYPPRWNAAP |
| Ga0182015_108280141 | 3300014495 | Palsa | MCGRIIQSSGWLRYAIVDGMNVRDSRVHNYPPRWNAAPGQDLL |
| Ga0181536_103193531 | 3300014638 | Bog | MCGRVIQSSGPLGYAIVEGMDVRDSRTHNYPPRWN |
| Ga0132256_1026057581 | 3300015372 | Arabidopsis Rhizosphere | MCGRVIQSSGPLRYAIVDGINVRYSRVHNYPPRWNAAPSQE |
| Ga0132256_1026155551 | 3300015372 | Arabidopsis Rhizosphere | MCGRVIQSSGPLSYAIVDGMNVRDSRVHNYPPRWNAAPNAASIPWY |
| Ga0132255_1040356841 | 3300015374 | Arabidopsis Rhizosphere | MCGRVIQSTGPLRYAIIDGMNVRDSRVHNYPPRWNAAPS |
| Ga0182036_107121503 | 3300016270 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNG |
| Ga0182041_103886522 | 3300016294 | Soil | MCGRVIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPSQ |
| Ga0182041_108769221 | 3300016294 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNFRSGGTPRQAKNC |
| Ga0182041_108838152 | 3300016294 | Soil | MCGRVIQSSGPLRYAIVDGMNARDSRVHNYPPRWNGAPSQ |
| Ga0182041_109825131 | 3300016294 | Soil | MTKCSAVCGRIIQSSLSLRYAIVDGLNVRDSRVHNYPPRWNAAPSQE |
| Ga0182041_110752872 | 3300016294 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGAP |
| Ga0182041_111584331 | 3300016294 | Soil | MCGRVIQSSGPLRYGIVEGMDVHDSRAHNYPPRWNAAPSQDLLV |
| Ga0182033_108580812 | 3300016319 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGA |
| Ga0182033_112315931 | 3300016319 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNAADRRGLARPIAMGLI |
| Ga0182035_105845071 | 3300016341 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNVAPSQELLVIR |
| Ga0182034_103573844 | 3300016371 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNGAPS |
| Ga0182034_107247763 | 3300016371 | Soil | MCGRVIQSSEPLHYAIVDGLNVRDSRVHNYPPRWNGAPSQELL |
| Ga0182034_112780752 | 3300016371 | Soil | MCGRIIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLVI |
| Ga0182040_105856351 | 3300016387 | Soil | MFANSYTPAMCGRVIQSSGPLRYAIVDGMNVRDNRVHNYPPRWNAAP |
| Ga0182040_117730912 | 3300016387 | Soil | MCGRIIQSTGPLRYAIVDGMNVRDSRVHNYPPRWN |
| Ga0182040_119623691 | 3300016387 | Soil | MCGRVIQSSGPLRYAIVDGMSVRDSRVHNYPPRWN |
| Ga0182037_111482091 | 3300016404 | Soil | MCGRVVQSSGPLRYAIVDGLDVRDSRVHNYPPRWNAAPSQD |
| Ga0182037_112681871 | 3300016404 | Soil | MCGRVIQSSRPLRYAIVDGMNVRDSRFHNYPPRWNGAPSQ |
| Ga0182039_100707431 | 3300016422 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNG |
| Ga0187807_13411973 | 3300017926 | Freshwater Sediment | MCGRVIQSSGPLSYGIVKGMDMRDSRAHNRPPRWNAAPSQDF |
| Ga0187775_102071551 | 3300017939 | Tropical Peatland | MCGRVIQSSGPIRYGIVEGMDLRDSRTHNYPARWN |
| Ga0187819_103411741 | 3300017943 | Freshwater Sediment | MCGRVIQSSGPLRYGIVAGMDMRDSRVHNYPPRWNGAPSQDL |
| Ga0187879_107251321 | 3300017946 | Peatland | MCGRVIQSSGPLRYAILDGINVRDSRVHNYPPRWNGAPSQDLLI |
| Ga0187847_104921201 | 3300017948 | Peatland | MCGRVIQSSGPLSYAILDGMNVRDSRVHNYPPRWNGAPSRDLL |
| Ga0187817_107526552 | 3300017955 | Freshwater Sediment | MCGRVIQSSGPLRYGIVEGMDVSDSRAHNYPAWNAAPSEE |
| Ga0187817_108101231 | 3300017955 | Freshwater Sediment | MCGRVVQSSGPLRYGIVEGMDMRDSRAHNYPPRWNAAPSQDLLV |
| Ga0187781_108380643 | 3300017972 | Tropical Peatland | MCGRVIQSSGPLHYSIVAGMNVCDSRAHNYPPRWNGAP |
| Ga0187777_101111302 | 3300017974 | Tropical Peatland | VCGRVIQSSGSLRSGIVAGMDVRDSRVHNYPSRWNGAPS |
| Ga0187777_105861882 | 3300017974 | Tropical Peatland | IMCGRVIQSSGPLHYGIVEGMDMRDSRTHNYPPRWNVRQAKTCW |
| Ga0187816_104836672 | 3300017995 | Freshwater Sediment | VIQSTGPLRYAILEGMDVRDNRRVHNYPQRWNAAPSQDLLVQSPLRRKK |
| Ga0187816_105117242 | 3300017995 | Freshwater Sediment | MCGRVIQSSGPLRCGIVEGMDMRDSRAHIHPPRWNTAPSQDLL |
| Ga0187891_10007851 | 3300017996 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQDLLV |
| Ga0187876_13091842 | 3300018003 | Peatland | MCGRVIQSSELLRYAIVEGMDVRDTRVHNPPRWNGAPNQDLLVIRR |
| Ga0187805_103416981 | 3300018007 | Freshwater Sediment | MCGRVVQSSGPLRYGIVEGMDMRDSRAHNYPPRWNAAPAR |
| Ga0187860_10363151 | 3300018014 | Peatland | MCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQDLL |
| Ga0187872_100044161 | 3300018017 | Peatland | VAPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQDLL |
| Ga0187872_100745962 | 3300018017 | Peatland | MCGRVIQSSGPLSYAILDGMNVRDSRVHNYPPRWNGAPS |
| Ga0187872_101790351 | 3300018017 | Peatland | MCGRVIQSSAPVRYAIVDGMNVRDSRVHNYPPRWNAAPSQD |
| Ga0187874_101190492 | 3300018019 | Peatland | MMCGRVIQSSGPVRYAIVDGMNVRDSRVHNYPPRWNAA |
| Ga0187766_111181361 | 3300018058 | Tropical Peatland | MCGRIVQSSGPLGYAIVDGMSVRDSRVHNCPPRWNA |
| Ga0184625_105883052 | 3300018081 | Groundwater Sediment | MCGRVIQSSGPLRYAIVDGMSVRDSRVHNYPPKWNAAPSQELLV |
| Ga0187772_111838562 | 3300018085 | Tropical Peatland | MPWMCGRVIQSSGPLRYGIVEGLDARDSRVHNFPPRWNGVPSQE |
| Ga0190270_124135392 | 3300018469 | Soil | MSSGPLRYAIVDGMNVRDSRVHNYPQRWNAAPSQELLVIR |
| Ga0190270_130269382 | 3300018469 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPS |
| Ga0210406_101216121 | 3300021168 | Soil | MCGRVIQSSAPIRYGIVDGMNVRDSRVHNYFGGVV |
| Ga0210406_109974962 | 3300021168 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELRVIRRN |
| Ga0210408_112063821 | 3300021178 | Soil | MHHHIAIMCGRVVQSSGPIRYAIVDGMNVRDSRVHNYPPRWN |
| Ga0210394_111556332 | 3300021420 | Soil | MCGRVIQSSAPIRYGIVDGMNVRDSRVHNYPLRWNGAPSQ |
| Ga0210384_115955581 | 3300021432 | Soil | MCGRVIQSSGPLRYAFVDGMNVRDSRVSNYPPRWNA |
| Ga0210402_106601011 | 3300021478 | Soil | MCGRVIQSSAPIRYAIVDGMNVRDSRVHNYPPRWNGAPSQDLP |
| Ga0210410_115061481 | 3300021479 | Soil | MHGRVIQSSAPIRYAIVDGMNVRDSRVHNYPPRWN |
| Ga0210409_107921501 | 3300021559 | Soil | MCGRVIQSSAPIRYAIVDGMNVRDSRVANYPPRWKGAPSPQ |
| Ga0210409_112895281 | 3300021559 | Soil | MCGRVIQSSAPIRYAIVDGMNVRDSRVHNYPPRWN |
| Ga0213851_17562981 | 3300021860 | Watersheds | MYGRIIQSNAPVRLAIVEGMDARDSRVHNYPPRWNGAPSQ |
| Ga0207663_100216253 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MCGRVIQSSGPLRYAFVEGMNVRDSRVSNYPPRWNAAP |
| Ga0207664_118241671 | 3300025929 | Agricultural Soil | MCGRVIQSSGPLRYAFVEGMNVRDSRVSNYPPRWNAAPSQELL |
| Ga0207679_119431581 | 3300025945 | Corn Rhizosphere | MCGRVIQSSEPLAYAIVDGMDVRDTRLHNHPPRWNAAP |
| Ga0207679_120944682 | 3300025945 | Corn Rhizosphere | MCGRVIQSSAPIKYGIVDGLNVRDSRLQNYPSRWNGAP |
| Ga0209350_11294972 | 3300026277 | Grasslands Soil | MCGRVIQSSGPLRYAIVDGMNVREGRLHNYPPRWNAAPS |
| Ga0209265_10528682 | 3300026308 | Soil | MCGRVIQSSGPLRYAIVDGMGVREGLHNYPPRWNGAPSQDLLV |
| Ga0209156_101731294 | 3300026547 | Soil | HYIRTMCGRVIQSSGPLRYSIVDGMNVRDSRVHNYPPRWMQR |
| Ga0207730_10017762 | 3300026896 | Tropical Forest Soil | MTMCGRVIQSSGPLRYGIVEGMDMRDSRTHNYPPRWNARQAKTCW |
| Ga0209527_10206571 | 3300027583 | Forest Soil | MCGRVIQSSGPLRYAFVDGMNVRDSRVSNYPPRWNAAP |
| Ga0209382_114986421 | 3300027909 | Populus Rhizosphere | IQGSGPLRYAIVDGMNVRASRVHNYPPRWNAAPSQDLLVIR |
| Ga0209583_102899773 | 3300027910 | Watersheds | MCGRVIQSSAPIRYAIVDGMNVRDSRVHNHPPRWNGAPS |
| Ga0209069_106929751 | 3300027915 | Watersheds | MCGRVIQSSAPIRLAIVDGLDACDSRVHNYPPRWNGAPSQD |
| Ga0307322_101760692 | 3300028710 | Soil | MCGRIIQSGGPLRYAIVDGLNARDSRVHNYPPRWNAA |
| Ga0307303_101728682 | 3300028713 | Soil | MCGRIIQSGGPLRYAIVDGLNTRDSRVHNYPLRWNAAPSQEL |
| Ga0307317_103300231 | 3300028720 | Soil | MCGRIIQSGGPLRYAIVDGLNARDSRVHNYPPRWNAAPSQEL |
| Ga0222749_100904321 | 3300029636 | Soil | MCGRVIQSSAPIRYGIVDGMNVRDSRVHNYPPRWNG |
| Ga0222749_104036022 | 3300029636 | Soil | MCGRVIQSSGPLRYAFVEGMNVPDSRVSNYPPRWNAAP |
| Ga0310038_103964532 | 3300030707 | Peatlands Soil | MCGRVIQSSPLTRLAIIEGLDVRDSRVHNYPPHWNGAP |
| Ga0170824_1222455022 | 3300031231 | Forest Soil | MCGRVIQSSAPIRLAIVEGMDVRDSRVHNYPPRWNGAPS |
| Ga0170818_1142225891 | 3300031474 | Forest Soil | MCGRVIQSSGPRRYAIVDGMNVRDSRVHNYPPRWNGAPSQDLL |
| Ga0318516_100308415 | 3300031543 | Soil | MCGRVIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPSQD |
| Ga0318555_100357176 | 3300031640 | Soil | MCGRIIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPS |
| Ga0318560_103693061 | 3300031682 | Soil | MCGRIIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAA |
| Ga0318560_104939832 | 3300031682 | Soil | YIRPLMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPLRWNAAPS |
| Ga0318560_107456401 | 3300031682 | Soil | MCGRVIQSSGPLHYAFVEGMNVRDSRVHNYPPRWNA |
| Ga0310686_1043124362 | 3300031708 | Soil | MCGRVIQSSAPIRYAIVDGMSVRDSRVANYPPRWNG |
| Ga0306917_113997602 | 3300031719 | Soil | RPLMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPLRWNAAPS |
| Ga0318500_106909432 | 3300031724 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNAAPSQELLVIR |
| Ga0306918_103522023 | 3300031744 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGAPSE |
| Ga0318492_104276041 | 3300031748 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNAAPSQELLVI |
| Ga0318554_100663861 | 3300031765 | Soil | MCGRVIQSSAPLRYAIVDGMNVRDSRLHNHPPRWN |
| Ga0318509_103746153 | 3300031768 | Soil | MCGRVIQSGGPIRYGIVEGLDVHDSRVHNYPPRWNVAPSQE |
| Ga0318543_100120805 | 3300031777 | Soil | MCGRIIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAPSQD |
| Ga0318543_103765971 | 3300031777 | Soil | VADDYISAMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELL |
| Ga0318548_101960901 | 3300031793 | Soil | MFANSYIPAMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLVI |
| Ga0318511_101295931 | 3300031845 | Soil | MFANSYIPAMCGRVIQSSGALRYSIVDGMNVRDSRVHNYPPRWNAAP |
| Ga0306925_114995491 | 3300031890 | Soil | VWHCTDRHIAIMCGRVIQSGGPLRYGIVEGTDMRDNRVRNY |
| Ga0318522_100126321 | 3300031894 | Soil | MCGRVIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAP |
| Ga0306923_118557081 | 3300031910 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRGHNYPPRWNAAP |
| Ga0306923_122498561 | 3300031910 | Soil | RHMCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNAAPSQELLVIRARVWIE |
| Ga0306921_112497411 | 3300031912 | Soil | MDPYIAAMCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLVTRRN |
| Ga0306921_114911671 | 3300031912 | Soil | MCGRIIQSSGPIRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLVI |
| Ga0310912_107251561 | 3300031941 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQE |
| Ga0310916_100702363 | 3300031942 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPLRWNAAPS |
| Ga0310913_108298992 | 3300031945 | Soil | MCGRITQSSGPLDYALVEGMNVRDSRFANRPPGWNGA |
| Ga0306926_112656751 | 3300031954 | Soil | MCGRVIQSSGPLRYSIVDGLNVRDSRAHNYPARWNAAPSQELLIIR |
| Ga0306926_119723812 | 3300031954 | Soil | MCGRVIQSSSPLNYEVVKGMNVRDSRVHNYPPRWNAAPSQEL |
| Ga0306926_121412102 | 3300031954 | Soil | MPIMCGRVIQSSGPLRYGIVAGMDMRDSRVHNYPPRWNAAPS |
| Ga0318532_100919811 | 3300032051 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRMHNYPPRWNGAPSEDLLV |
| Ga0318533_101541121 | 3300032059 | Soil | MCGRVIQSSGPLRYAIVDGLNVRDSRVHNYPPRWNAPPSQ |
| Ga0318504_106377141 | 3300032063 | Soil | MCGRVIQSSSPLNYEVVKGMNVRDSRVHNYPPRWNAAPS |
| Ga0318524_104595672 | 3300032067 | Soil | MCGRIIQSSAPLRYAIVDGMNVRDSRLHNHPPRWNAAP |
| Ga0311301_124195681 | 3300032160 | Peatlands Soil | MCGRVIQSSGPVRYAIVDGMNVRDSRLHNYPPRWNA |
| Ga0311301_124955082 | 3300032160 | Peatlands Soil | VWEVIQSSGPLSYAILDGMNVPDSRVHNCPPGWNAAPSQDLLVIRRNHET |
| Ga0306920_1025075671 | 3300032261 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRFHNYPPRWNGAPS |
| Ga0306920_1028634133 | 3300032261 | Soil | MCGRVIQSSGPLRYAIVDGMSVRDSRVHNYPPRWNTAPSQQLPVIR |
| Ga0310914_106200111 | 3300033289 | Soil | MCGRVIQSSGPLRYAIVDGMNVRDSRVHNYPPRWNAAPSQELLLIRRN |
| Ga0310914_107575222 | 3300033289 | Soil | MCGRIIQSSGPIRYGIVDGMNVRDSRVHNYPPRWNA |
| Ga0310914_110349012 | 3300033289 | Soil | MCGRVIQSSGPLRYGIVEGMDVSDGRAHNYPPRWNAAPSQDLL |
| Ga0314864_0058605_3_116 | 3300033805 | Peatland | MCGRVIQSSGPLRYGIVAGMDMRDSRVHNYPPRWNGTP |
| ⦗Top⦘ |