


| Basic Information | |
|---|---|
| Family ID | F028607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 191 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LHCYILALAAERVSRDTDIWLEPPTLANIFDEEREVRGRRRAAEGP |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 1.05 % |
| % of genes near scaffold ends (potentially truncated) | 94.24 % |
| % of genes from short scaffolds (< 2000 bps) | 94.24 % |
| Associated GOLD sequencing projects | 102 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.021 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (25.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.319 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.644 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.95% β-sheet: 0.00% Coil/Unstructured: 54.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF10134 | RPA | 4.19 |
| PF04909 | Amidohydro_2 | 2.62 |
| PF13359 | DDE_Tnp_4 | 2.09 |
| PF01656 | CbiA | 2.09 |
| PF07929 | PRiA4_ORF3 | 2.09 |
| PF01436 | NHL | 1.57 |
| PF00847 | AP2 | 1.57 |
| PF10431 | ClpB_D2-small | 1.57 |
| PF12759 | HTH_Tnp_IS1 | 1.57 |
| PF00072 | Response_reg | 1.05 |
| PF13614 | AAA_31 | 1.05 |
| PF06689 | zf-C4_ClpX | 1.05 |
| PF00216 | Bac_DNA_binding | 1.05 |
| PF13276 | HTH_21 | 0.52 |
| PF04075 | F420H2_quin_red | 0.52 |
| PF05598 | DUF772 | 0.52 |
| PF00440 | TetR_N | 0.52 |
| PF02922 | CBM_48 | 0.52 |
| PF14319 | Zn_Tnp_IS91 | 0.52 |
| PF13565 | HTH_32 | 0.52 |
| PF04986 | Y2_Tnp | 0.52 |
| PF02371 | Transposase_20 | 0.52 |
| PF00012 | HSP70 | 0.52 |
| PF07724 | AAA_2 | 0.52 |
| PF01909 | NTP_transf_2 | 0.52 |
| PF00872 | Transposase_mut | 0.52 |
| PF08031 | BBE | 0.52 |
| PF03328 | HpcH_HpaI | 0.52 |
| PF13613 | HTH_Tnp_4 | 0.52 |
| PF13546 | DDE_5 | 0.52 |
| PF13424 | TPR_12 | 0.52 |
| PF12904 | Collagen_bind_2 | 0.52 |
| PF03357 | Snf7 | 0.52 |
| PF13340 | DUF4096 | 0.52 |
| PF03400 | DDE_Tnp_IS1 | 0.52 |
| PF00561 | Abhydrolase_1 | 0.52 |
| PF04255 | DUF433 | 0.52 |
| PF00496 | SBP_bac_5 | 0.52 |
| PF01724 | DUF29 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 1.05 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.52 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.52 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.52 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.52 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.52 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.52 |
| COG5491 | Archaeal cell division protein CdvB, Snf7/Vps24/ESCRT-III family | Cell cycle control, cell division, chromosome partitioning [D] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.02 % |
| All Organisms | root | All Organisms | 43.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_112332408 | Not Available | 635 | Open in IMG/M |
| 3300004633|Ga0066395_10773648 | Not Available | 575 | Open in IMG/M |
| 3300005171|Ga0066677_10033803 | All Organisms → cellular organisms → Bacteria | 2468 | Open in IMG/M |
| 3300005175|Ga0066673_10856173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 518 | Open in IMG/M |
| 3300005187|Ga0066675_10033094 | All Organisms → cellular organisms → Bacteria | 3052 | Open in IMG/M |
| 3300005332|Ga0066388_100687074 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1632 | Open in IMG/M |
| 3300005337|Ga0070682_101880416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 524 | Open in IMG/M |
| 3300005471|Ga0070698_101715389 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 581 | Open in IMG/M |
| 3300005554|Ga0066661_10511824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 724 | Open in IMG/M |
| 3300005576|Ga0066708_10262145 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005713|Ga0066905_100182457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1550 | Open in IMG/M |
| 3300005764|Ga0066903_103128947 | Not Available | 896 | Open in IMG/M |
| 3300005764|Ga0066903_108042366 | Not Available | 541 | Open in IMG/M |
| 3300005937|Ga0081455_10369523 | Not Available | 1006 | Open in IMG/M |
| 3300005985|Ga0081539_10436129 | Not Available | 543 | Open in IMG/M |
| 3300006049|Ga0075417_10513953 | Not Available | 603 | Open in IMG/M |
| 3300006173|Ga0070716_100096690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 1801 | Open in IMG/M |
| 3300006844|Ga0075428_100631914 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1142 | Open in IMG/M |
| 3300006844|Ga0075428_101737153 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 650 | Open in IMG/M |
| 3300006844|Ga0075428_101775351 | Not Available | 642 | Open in IMG/M |
| 3300006845|Ga0075421_100250063 | Not Available | 2173 | Open in IMG/M |
| 3300006845|Ga0075421_102080649 | Not Available | 602 | Open in IMG/M |
| 3300006846|Ga0075430_101084685 | Not Available | 659 | Open in IMG/M |
| 3300006846|Ga0075430_101157991 | Not Available | 637 | Open in IMG/M |
| 3300006846|Ga0075430_101270817 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006847|Ga0075431_100210680 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300006847|Ga0075431_101861143 | Not Available | 558 | Open in IMG/M |
| 3300006847|Ga0075431_101974320 | Not Available | 539 | Open in IMG/M |
| 3300006853|Ga0075420_101333578 | Not Available | 616 | Open in IMG/M |
| 3300006854|Ga0075425_100496212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 1406 | Open in IMG/M |
| 3300006854|Ga0075425_101060336 | Not Available | 924 | Open in IMG/M |
| 3300006880|Ga0075429_100301831 | Not Available | 1402 | Open in IMG/M |
| 3300006880|Ga0075429_100642647 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 929 | Open in IMG/M |
| 3300006880|Ga0075429_100665012 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006880|Ga0075429_100923537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300006880|Ga0075429_101901498 | Not Available | 516 | Open in IMG/M |
| 3300006904|Ga0075424_101810978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
| 3300006969|Ga0075419_11246527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 550 | Open in IMG/M |
| 3300007076|Ga0075435_101144220 | Not Available | 680 | Open in IMG/M |
| 3300007255|Ga0099791_10296652 | Not Available | 770 | Open in IMG/M |
| 3300009090|Ga0099827_10112917 | Not Available | 2177 | Open in IMG/M |
| 3300009090|Ga0099827_10922358 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 757 | Open in IMG/M |
| 3300009094|Ga0111539_10903548 | Not Available | 1027 | Open in IMG/M |
| 3300009094|Ga0111539_11046714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 949 | Open in IMG/M |
| 3300009100|Ga0075418_10179628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2253 | Open in IMG/M |
| 3300009137|Ga0066709_104085226 | Not Available | 531 | Open in IMG/M |
| 3300009143|Ga0099792_10652193 | Not Available | 676 | Open in IMG/M |
| 3300009147|Ga0114129_10034887 | All Organisms → cellular organisms → Bacteria | 7106 | Open in IMG/M |
| 3300009147|Ga0114129_10447066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1695 | Open in IMG/M |
| 3300009147|Ga0114129_11231204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 931 | Open in IMG/M |
| 3300009147|Ga0114129_11505485 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae | 827 | Open in IMG/M |
| 3300009147|Ga0114129_12898866 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300009147|Ga0114129_13268665 | Not Available | 525 | Open in IMG/M |
| 3300009156|Ga0111538_11687810 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300009792|Ga0126374_10995299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300009792|Ga0126374_11007855 | Not Available | 654 | Open in IMG/M |
| 3300009792|Ga0126374_11275869 | Not Available | 592 | Open in IMG/M |
| 3300009821|Ga0105064_1058062 | Not Available | 753 | Open in IMG/M |
| 3300010041|Ga0126312_11189083 | Not Available | 562 | Open in IMG/M |
| 3300010043|Ga0126380_10303329 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300010043|Ga0126380_10968554 | Not Available | 713 | Open in IMG/M |
| 3300010046|Ga0126384_10445517 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300010046|Ga0126384_10539851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1011 | Open in IMG/M |
| 3300010046|Ga0126384_10880471 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300010046|Ga0126384_11007515 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 759 | Open in IMG/M |
| 3300010046|Ga0126384_11093064 | Not Available | 731 | Open in IMG/M |
| 3300010046|Ga0126384_11430909 | Not Available | 645 | Open in IMG/M |
| 3300010046|Ga0126384_12482697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300010047|Ga0126382_10660790 | Not Available | 870 | Open in IMG/M |
| 3300010047|Ga0126382_10707453 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300010047|Ga0126382_11156270 | Not Available | 690 | Open in IMG/M |
| 3300010358|Ga0126370_10146948 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1713 | Open in IMG/M |
| 3300010358|Ga0126370_11031372 | Not Available | 753 | Open in IMG/M |
| 3300010358|Ga0126370_11123406 | Not Available | 726 | Open in IMG/M |
| 3300010358|Ga0126370_11467072 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 647 | Open in IMG/M |
| 3300010359|Ga0126376_11283583 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300010359|Ga0126376_11299548 | Not Available | 747 | Open in IMG/M |
| 3300010360|Ga0126372_10131438 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1959 | Open in IMG/M |
| 3300010360|Ga0126372_10471821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1170 | Open in IMG/M |
| 3300010360|Ga0126372_12005506 | Not Available | 625 | Open in IMG/M |
| 3300010360|Ga0126372_13173110 | Not Available | 511 | Open in IMG/M |
| 3300010362|Ga0126377_10584026 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1160 | Open in IMG/M |
| 3300010362|Ga0126377_11058605 | Not Available | 879 | Open in IMG/M |
| 3300010366|Ga0126379_10760124 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1066 | Open in IMG/M |
| 3300010366|Ga0126379_12705121 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010366|Ga0126379_13710588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 512 | Open in IMG/M |
| 3300010398|Ga0126383_10752413 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300010398|Ga0126383_11211905 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300010398|Ga0126383_12177512 | Not Available | 641 | Open in IMG/M |
| 3300010398|Ga0126383_12488242 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010398|Ga0126383_12816033 | Not Available | 568 | Open in IMG/M |
| 3300010398|Ga0126383_13520238 | Not Available | 511 | Open in IMG/M |
| 3300010398|Ga0126383_13641585 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010863|Ga0124850_1045039 | All Organisms → cellular organisms → Bacteria | 1393 | Open in IMG/M |
| 3300011269|Ga0137392_10457171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
| 3300012189|Ga0137388_10318138 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1430 | Open in IMG/M |
| 3300012189|Ga0137388_11936509 | Not Available | 519 | Open in IMG/M |
| 3300012201|Ga0137365_10174481 | All Organisms → cellular organisms → Bacteria | 1611 | Open in IMG/M |
| 3300012201|Ga0137365_10907517 | Not Available | 642 | Open in IMG/M |
| 3300012202|Ga0137363_10762805 | Not Available | 820 | Open in IMG/M |
| 3300012203|Ga0137399_10114482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300012203|Ga0137399_10605134 | Not Available | 921 | Open in IMG/M |
| 3300012206|Ga0137380_10705130 | Not Available | 876 | Open in IMG/M |
| 3300012207|Ga0137381_10621350 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 941 | Open in IMG/M |
| 3300012207|Ga0137381_11578488 | Not Available | 547 | Open in IMG/M |
| 3300012209|Ga0137379_10296360 | Not Available | 1528 | Open in IMG/M |
| 3300012209|Ga0137379_10515593 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300012354|Ga0137366_10258315 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
| 3300012354|Ga0137366_11077755 | Not Available | 554 | Open in IMG/M |
| 3300012356|Ga0137371_11370713 | Not Available | 520 | Open in IMG/M |
| 3300012357|Ga0137384_10643943 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300012359|Ga0137385_10473312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300012361|Ga0137360_10555031 | Not Available | 981 | Open in IMG/M |
| 3300012362|Ga0137361_10847821 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300012362|Ga0137361_10901506 | Not Available | 802 | Open in IMG/M |
| 3300012385|Ga0134023_1265456 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300012923|Ga0137359_10196737 | Not Available | 1800 | Open in IMG/M |
| 3300012925|Ga0137419_10661557 | Not Available | 844 | Open in IMG/M |
| 3300012925|Ga0137419_11074063 | Not Available | 670 | Open in IMG/M |
| 3300012927|Ga0137416_10570931 | Not Available | 982 | Open in IMG/M |
| 3300012930|Ga0137407_10295036 | Not Available | 1481 | Open in IMG/M |
| 3300012930|Ga0137407_11758100 | Not Available | 591 | Open in IMG/M |
| 3300012930|Ga0137407_11892514 | Not Available | 569 | Open in IMG/M |
| 3300012944|Ga0137410_11525306 | Not Available | 584 | Open in IMG/M |
| 3300012944|Ga0137410_11890219 | Not Available | 529 | Open in IMG/M |
| 3300012948|Ga0126375_10197211 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300012971|Ga0126369_10052018 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 3505 | Open in IMG/M |
| 3300012971|Ga0126369_10076427 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2955 | Open in IMG/M |
| 3300012971|Ga0126369_10185881 | Not Available | 1990 | Open in IMG/M |
| 3300012971|Ga0126369_10987172 | Not Available | 929 | Open in IMG/M |
| 3300012971|Ga0126369_11054863 | Not Available | 901 | Open in IMG/M |
| 3300012971|Ga0126369_11126969 | Not Available | 874 | Open in IMG/M |
| 3300012971|Ga0126369_11393393 | Not Available | 791 | Open in IMG/M |
| 3300012971|Ga0126369_11495937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G9 | 765 | Open in IMG/M |
| 3300012971|Ga0126369_12182995 | Not Available | 641 | Open in IMG/M |
| 3300013306|Ga0163162_13327808 | Not Available | 514 | Open in IMG/M |
| 3300014487|Ga0182000_10301468 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300014884|Ga0180104_1023963 | Not Available | 1530 | Open in IMG/M |
| 3300015264|Ga0137403_10721771 | Not Available | 856 | Open in IMG/M |
| 3300015374|Ga0132255_100024098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 7563 | Open in IMG/M |
| 3300016294|Ga0182041_10389843 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1182 | Open in IMG/M |
| 3300016294|Ga0182041_10468154 | Not Available | 1086 | Open in IMG/M |
| 3300016319|Ga0182033_10488005 | Not Available | 1057 | Open in IMG/M |
| 3300016319|Ga0182033_10876957 | Not Available | 794 | Open in IMG/M |
| 3300016341|Ga0182035_11903382 | Not Available | 540 | Open in IMG/M |
| 3300016357|Ga0182032_10110931 | Not Available | 1958 | Open in IMG/M |
| 3300016371|Ga0182034_11039831 | Not Available | 708 | Open in IMG/M |
| 3300017656|Ga0134112_10152638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 889 | Open in IMG/M |
| 3300017792|Ga0163161_10813744 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300017792|Ga0163161_11769468 | Not Available | 549 | Open in IMG/M |
| 3300017792|Ga0163161_11923156 | Not Available | 526 | Open in IMG/M |
| 3300019279|Ga0184642_1279824 | Not Available | 530 | Open in IMG/M |
| 3300021560|Ga0126371_11386943 | Not Available | 834 | Open in IMG/M |
| 3300021560|Ga0126371_12592741 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales | 614 | Open in IMG/M |
| 3300025922|Ga0207646_10391501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1255 | Open in IMG/M |
| 3300025922|Ga0207646_10623288 | Not Available | 967 | Open in IMG/M |
| 3300025961|Ga0207712_11998652 | Not Available | 519 | Open in IMG/M |
| 3300026118|Ga0207675_100553464 | Not Available | 1150 | Open in IMG/M |
| 3300026118|Ga0207675_101762456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
| 3300026301|Ga0209238_1279068 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300027655|Ga0209388_1191268 | Not Available | 569 | Open in IMG/M |
| 3300027846|Ga0209180_10185179 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1201 | Open in IMG/M |
| 3300027875|Ga0209283_10273634 | Not Available | 1117 | Open in IMG/M |
| 3300027880|Ga0209481_10347452 | Not Available | 756 | Open in IMG/M |
| 3300027882|Ga0209590_10093981 | All Organisms → cellular organisms → Bacteria | 1779 | Open in IMG/M |
| 3300027882|Ga0209590_10110742 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 1655 | Open in IMG/M |
| 3300027903|Ga0209488_10047443 | All Organisms → cellular organisms → Bacteria | 3158 | Open in IMG/M |
| 3300027909|Ga0209382_11946141 | Not Available | 566 | Open in IMG/M |
| 3300028828|Ga0307312_10837513 | Not Available | 610 | Open in IMG/M |
| 3300030783|Ga0102752_1514652 | Not Available | 523 | Open in IMG/M |
| 3300031744|Ga0306918_11184153 | Not Available | 590 | Open in IMG/M |
| 3300031744|Ga0306918_11419978 | Not Available | 532 | Open in IMG/M |
| 3300031782|Ga0318552_10462038 | Not Available | 648 | Open in IMG/M |
| 3300031879|Ga0306919_11167329 | Not Available | 586 | Open in IMG/M |
| 3300031890|Ga0306925_10730346 | Not Available | 1034 | Open in IMG/M |
| 3300031890|Ga0306925_11367025 | Not Available | 700 | Open in IMG/M |
| 3300031893|Ga0318536_10711393 | Not Available | 500 | Open in IMG/M |
| 3300031910|Ga0306923_11301238 | Not Available | 771 | Open in IMG/M |
| 3300031941|Ga0310912_11175476 | Not Available | 584 | Open in IMG/M |
| 3300031941|Ga0310912_11350307 | Not Available | 539 | Open in IMG/M |
| 3300031945|Ga0310913_10196437 | Not Available | 1408 | Open in IMG/M |
| 3300031946|Ga0310910_10297651 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300031946|Ga0310910_11268802 | Not Available | 570 | Open in IMG/M |
| 3300031946|Ga0310910_11397365 | Not Available | 539 | Open in IMG/M |
| 3300031947|Ga0310909_10893817 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Nitrospinae → unclassified Nitrospinota → Nitrospinae bacterium SCGC AAA008-D05 | 730 | Open in IMG/M |
| 3300031954|Ga0306926_11463458 | Not Available | 790 | Open in IMG/M |
| 3300032001|Ga0306922_11814442 | Not Available | 600 | Open in IMG/M |
| 3300032013|Ga0310906_10894982 | Not Available | 633 | Open in IMG/M |
| 3300032076|Ga0306924_10504726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Nitrosococcus → Nitrosococcus halophilus → Nitrosococcus halophilus Nc 4 | 1377 | Open in IMG/M |
| 3300032076|Ga0306924_10559180 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300034676|Ga0314801_150455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 25.65% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 18.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.24% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.09% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.05% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.05% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010863 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030783 | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1123324082 | 3300000956 | Soil | LHCYILALAAERVSRDTDMWLEPPTLVNLFDEKREVRGRRRAADGS* |
| Ga0066395_107736481 | 3300004633 | Tropical Forest Soil | LHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGL* |
| Ga0066677_100338035 | 3300005171 | Soil | GTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRAAEGP* |
| Ga0066673_108561731 | 3300005175 | Soil | VSTLMSHLHCYMLALAAERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0066675_100330944 | 3300005187 | Soil | LEVAVSTLMSHLHCYILALAAERVSRDTDIWVEPPTLANLFDEERAVQAKRRSAEGA* |
| Ga0066388_1006870742 | 3300005332 | Tropical Forest Soil | CYIMALAAERVSRDTDIWLEPPTLANLFDEQREVRGRRRAAEEP* |
| Ga0070682_1018804162 | 3300005337 | Corn Rhizosphere | CYILALAAERVSRGTDIWLEPPTLANLFDEEREVRGQRRAAEEP* |
| Ga0070698_1017153892 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | ILALAAERVSRDTDIWVEPPTLANLFDAEREVRGWRRFTEGP* |
| Ga0066661_105118241 | 3300005554 | Soil | MLALAAERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0066708_102621451 | 3300005576 | Soil | VSRDTDIWLEPPTLANLFDAEREVRGQRRAAEGP* |
| Ga0066905_1001824572 | 3300005713 | Tropical Forest Soil | MRHLHCYILALAAERVSRDTEIWLEPPTLANIFDGEREVRARRHAAEDS* |
| Ga0066903_1031289471 | 3300005764 | Tropical Forest Soil | HLHCYILALAAERVSRDTDMWLEPPTLANLFDEAREVRGRRRSTEGP* |
| Ga0066903_1080423662 | 3300005764 | Tropical Forest Soil | NTLMRYLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRGRRRCADGS* |
| Ga0081455_103695232 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSHLHCYILALAAERVSRGTDIWLEPPTLANIFDEEREVRGRRRAAEEP* |
| Ga0081539_104361292 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VGTLMSHLHCYILALAAERVSRDTEIWLEPPTLVNLFDEEREVRARRRAADGS* |
| Ga0075417_105139532 | 3300006049 | Populus Rhizosphere | HCYILALAAERVSRDTDIWVEPPTLTNLFDEKREVRGRRRAADGS* |
| Ga0070716_1000966901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRDTDIWLEPPTLSNLFDEEREVRARRRAVEEC* |
| Ga0075428_1006319141 | 3300006844 | Populus Rhizosphere | LMSHLHCYILALAAERVSRGTDIWLEPPTLANIFDEEREVRGRRRAAEGP* |
| Ga0075428_1017371532 | 3300006844 | Populus Rhizosphere | LMSHLHCYILALAAERVSRGTDIWLEPPTLANIFDEEREGRGRRRAAEGP* |
| Ga0075428_1017753513 | 3300006844 | Populus Rhizosphere | RVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGP* |
| Ga0075421_1002500633 | 3300006845 | Populus Rhizosphere | STLMSHLHCYILALAAERVSRDTDIWVEPPTLTNLFDEKREVRGRRRSAEGS* |
| Ga0075421_1020806491 | 3300006845 | Populus Rhizosphere | HCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRTAEGL* |
| Ga0075430_1010846851 | 3300006846 | Populus Rhizosphere | ALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGP* |
| Ga0075430_1011579912 | 3300006846 | Populus Rhizosphere | SHLHCYILALAAERVSRDTEIWLEPPTLANIFDEEREVRGQRRTAEGL* |
| Ga0075430_1012708172 | 3300006846 | Populus Rhizosphere | LMSHLHCYILALAAERVSRDTEIWLEPPTLANLFDKEREVRARRHAAEEP* |
| Ga0075431_1002106806 | 3300006847 | Populus Rhizosphere | QLDVAVGTLMSHLHCYMLALAAERVSRNTEIWVEPPTLANIFEAEREVRARRRSGEGA* |
| Ga0075431_1018611433 | 3300006847 | Populus Rhizosphere | ALAAERVSRDTEIWLEPPTLANLFDEEREVRGRRRAVEEP* |
| Ga0075431_1019743202 | 3300006847 | Populus Rhizosphere | VAVSTLMSHLHCYILALAAERVSRDTDMWLEPPTLANLFDEQREVRARRRSVEGA* |
| Ga0075420_1013335781 | 3300006853 | Populus Rhizosphere | MSHLHCYMLALAAERVSRNTEIWVEPPTLANIFEAEREVRARRRSGEGA* |
| Ga0075425_1004962123 | 3300006854 | Populus Rhizosphere | QLEVAVSTLMSHLHCYILALAAERVSRDTEIWVEPPTLANIFDEAREVRGRRRAAEGP* |
| Ga0075425_1010603361 | 3300006854 | Populus Rhizosphere | LHCYILALAAERVSRDTDIWLEPPTLANLFDEQREVRGQRRAAEGP* |
| Ga0075429_1003018311 | 3300006880 | Populus Rhizosphere | HCYILALAAERVSRDTDIWVEPPTLTNLFDEKREVRGRRRSAEGS* |
| Ga0075429_1006426473 | 3300006880 | Populus Rhizosphere | HLHCYILALAAERVSRDTDIWLEPPTLANLFDEEREVRGRRRFTEGP* |
| Ga0075429_1006650123 | 3300006880 | Populus Rhizosphere | HLHCYILALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRAAEGP* |
| Ga0075429_1009235372 | 3300006880 | Populus Rhizosphere | VSTLMSHLHCYILALAAERVSRDTEIWLEPPTLVNLFDEARAVHARRRSVEGA* |
| Ga0075429_1019014981 | 3300006880 | Populus Rhizosphere | ALAAERVSRDTEIWLEPPTLANIFDEEREVRGQRRTAEGL* |
| Ga0075424_1018109783 | 3300006904 | Populus Rhizosphere | YILALAAERVSRDTEIWLEPPTLANLFDEEREVRGRRRSTEGS* |
| Ga0075419_112465272 | 3300006969 | Populus Rhizosphere | ALAAERVSRDTEIWVEPPTLANIFDEAREVRGRRRAAEGP* |
| Ga0075435_1011442203 | 3300007076 | Populus Rhizosphere | LALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRAAEGP* |
| Ga0099791_102966521 | 3300007255 | Vadose Zone Soil | ESVSRRTDIWVEPPTLANIFDEEREVRGRRRPAEGS* |
| Ga0099827_101129171 | 3300009090 | Vadose Zone Soil | AEMEIAATTLMSHLHCSILALAAERVSRGTDIWVEPPTLATIFDEEREVRGRRRSAEGP* |
| Ga0099827_109223582 | 3300009090 | Vadose Zone Soil | LEVAASTLMSHLHCYILALSAERVSRDTDIRVEPPTLVNIFDEEREVRARRRSAEGS* |
| Ga0111539_109035481 | 3300009094 | Populus Rhizosphere | ILALAAERVSRDTDIWLEPPTLAHLFDAEREVRGQRRCTEEP* |
| Ga0111539_110467141 | 3300009094 | Populus Rhizosphere | ALAAERVSRDTDIWLEPPTLANIFDEQREVRGRRRAAEGS* |
| Ga0075418_101796284 | 3300009100 | Populus Rhizosphere | LMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0066709_1040852261 | 3300009137 | Grasslands Soil | ILALSAERVSRDTDIWVEPPALATIFDEEREVRGRRRSAEGP* |
| Ga0099792_106521932 | 3300009143 | Vadose Zone Soil | CSILALAAERVSRDTDIWVEPPTLATIFDEEREVRGRRRSAEGP* |
| Ga0114129_100348871 | 3300009147 | Populus Rhizosphere | HLHCYILALAAERVSRDTDLWLEPPTLANLFDEARAVHARRRSVDDA* |
| Ga0114129_104470661 | 3300009147 | Populus Rhizosphere | ILALAAERVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0114129_112312041 | 3300009147 | Populus Rhizosphere | LALAAERVSRDTDIWLEPPTLANLFDEARAVQARRRSMEGA* |
| Ga0114129_115054852 | 3300009147 | Populus Rhizosphere | HLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRAKRHAAEDS* |
| Ga0114129_128988662 | 3300009147 | Populus Rhizosphere | LALAAERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0114129_132686651 | 3300009147 | Populus Rhizosphere | VSTLMSHLHCYILALAAERVSRGTDIWLEPPTLANIFDEEREVRGRRRAAEGP* |
| Ga0111538_116878101 | 3300009156 | Populus Rhizosphere | LAAERVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0126374_109952991 | 3300009792 | Tropical Forest Soil | LALAAERVSRGTDIWLEPPTLANLFDEEREVRGRRRAAEGP* |
| Ga0126374_110078552 | 3300009792 | Tropical Forest Soil | HLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHSTEES* |
| Ga0126374_112758691 | 3300009792 | Tropical Forest Soil | ERVSRDTEIWLEPPTLANLFDEAREVRGRRRSTEGP* |
| Ga0105064_10580622 | 3300009821 | Groundwater Sand | SHLHCYILALSAERVSRDTDIWVEPPTLANMFDEEREVRARRRSAEGS* |
| Ga0126312_111890832 | 3300010041 | Serpentine Soil | ALAAERVSRDTDTWLEPPTLANIFDEQREVRGRRRSTEGP* |
| Ga0126380_103033291 | 3300010043 | Tropical Forest Soil | HPEQLDVAVGTLMRHLHCSIMALAAARVSRDTEIWLEPPTLANLFDAEREVRARRHAAEES* |
| Ga0126380_109685543 | 3300010043 | Tropical Forest Soil | LALAAERVSRDTDIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126384_104455173 | 3300010046 | Tropical Forest Soil | ILALAAERVSRDTDIWLEPPTLANLFDEAREVRARRHAAEES* |
| Ga0126384_105398512 | 3300010046 | Tropical Forest Soil | MRHLHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGL* |
| Ga0126384_108804712 | 3300010046 | Tropical Forest Soil | YILALAAERVSRDTEIWLEPPTLANLFDAEREVRARRHAAEES* |
| Ga0126384_110075151 | 3300010046 | Tropical Forest Soil | STLMRHLHCYILALAAERVSRDTEIWLEPLTLANLFDEEREVRGRRRVAEGP* |
| Ga0126384_110930642 | 3300010046 | Tropical Forest Soil | YILALAAERVSRDTDMWLEPPTLANLFDEAREVRGRRRSTEGP* |
| Ga0126384_114309092 | 3300010046 | Tropical Forest Soil | VSTLMSHLHCYILALAAERVSRDTAIWLEPPTLANLFDEEREVHARRRSVEGA* |
| Ga0126384_124826972 | 3300010046 | Tropical Forest Soil | ERVSRATEIWLEPPTLANLFDAEREVQARRRAAEDS* |
| Ga0126382_106607901 | 3300010047 | Tropical Forest Soil | LALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRSAEGL* |
| Ga0126382_107074533 | 3300010047 | Tropical Forest Soil | STLMRHLHCYILALAAERVSRDTALWLEPPTLANLFDEEREVQGRRRSAEES* |
| Ga0126382_111562702 | 3300010047 | Tropical Forest Soil | LEVAVSTLMSHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126370_101469481 | 3300010358 | Tropical Forest Soil | LHCYILALAAERVSRDTEFWLEPPTLANLFDEEREVRGRRRAAEGP* |
| Ga0126370_110313721 | 3300010358 | Tropical Forest Soil | MALAAERVSRDTDIWLEPPTLANLFDAEREVRGLRRSADGS* |
| Ga0126370_111234061 | 3300010358 | Tropical Forest Soil | MNHLHCYILVLAAERVSRDTDIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126370_114670721 | 3300010358 | Tropical Forest Soil | ILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSPEEP* |
| Ga0126376_112835831 | 3300010359 | Tropical Forest Soil | VAVSTLMNHLHCYILALAAERVSRDTDIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126376_112995481 | 3300010359 | Tropical Forest Soil | LHCYIVALAAERVSRDTEIWVEPPTQANILDEEREVRARRRSSEGS* |
| Ga0126372_101314382 | 3300010360 | Tropical Forest Soil | VSRDTDIWLEPPTLANLFDEEREVRGRRRAAEGP* |
| Ga0126372_104718212 | 3300010360 | Tropical Forest Soil | MSHLHCYILALAAERVSRDTDIWLEPPTLVNLFDEEREVRGQRRAAEGP* |
| Ga0126372_120055061 | 3300010360 | Tropical Forest Soil | GTLMSHLHCYSLALAAERVSRDTEIWLEPPTLANLFDEQREVRGQRRAAEEP* |
| Ga0126372_131731102 | 3300010360 | Tropical Forest Soil | ALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126377_105840261 | 3300010362 | Tropical Forest Soil | TLMSHFHCYILALAAERVSRDTDILVEPPTLANIFDEEREIRGRRRAAEGS* |
| Ga0126377_110586051 | 3300010362 | Tropical Forest Soil | HLHCYMLALAAERVSRDTDIWLEPPTLANLFDEQREVRGRRRAAEGS* |
| Ga0126379_107601242 | 3300010366 | Tropical Forest Soil | AERVSRDTDIWLEPPTLANLFDEEREVRGLRRSADGS* |
| Ga0126379_127051213 | 3300010366 | Tropical Forest Soil | AERVSRDTDIWLEPPTLANLFDEEREVRGQRRAAEGP* |
| Ga0126379_137105881 | 3300010366 | Tropical Forest Soil | VAVSTLMNHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126383_107524132 | 3300010398 | Tropical Forest Soil | ITCITLPAAERVSRDTDMWLEPPTLVNLLDEKREVRGRRRAADGS* |
| Ga0126383_112119051 | 3300010398 | Tropical Forest Soil | VGTLMSHLHCYILALAAERVSRDTDMWLEPPTLVNLFDEERKVRGRRRSAEGS* |
| Ga0126383_121775122 | 3300010398 | Tropical Forest Soil | HLHCYILALAAERVSRDTDIWVEPPTLANLFDEEREVRGRRRFTEGP* |
| Ga0126383_124882422 | 3300010398 | Tropical Forest Soil | MSHLHCYMLALAAERVSRDTEIWLEPPTLANLFDGEREVRTRRRSAEES* |
| Ga0126383_128160332 | 3300010398 | Tropical Forest Soil | VSRDTEIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126383_135202381 | 3300010398 | Tropical Forest Soil | ILALAAERVSRDTEIWLEPPTLANLFDAEREVRGWRRCTEGP* |
| Ga0126383_136415852 | 3300010398 | Tropical Forest Soil | ERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0124850_10450391 | 3300010863 | Tropical Forest Soil | PPPLLYSGHCYILALAAERVSRDTDIWLEPPTLANLFDEEREVRGQRRAAEGP* |
| Ga0137392_104571711 | 3300011269 | Vadose Zone Soil | VHLLSSTLLRSIHAYILALSAERVSRHTDIWVEPPTLENIFDEEREVRALRRSSEGS* |
| Ga0137388_103181381 | 3300012189 | Vadose Zone Soil | HPAQLEVAISTLMRHLHCYILALAAERVSRDTDIWLEPPTLANLFDGVREVRARRHAAEES* |
| Ga0137388_119365092 | 3300012189 | Vadose Zone Soil | ILALAAESVSRRTDIWVEPPTLANIFDEEREVRGRRRSTEGP* |
| Ga0137365_101744811 | 3300012201 | Vadose Zone Soil | DQLEVAVSTLMRHLHCYILALSAERVSRDTDIWVEPPTLANIFDEEREVRGRRRSAEGP* |
| Ga0137365_109075172 | 3300012201 | Vadose Zone Soil | MSHLHCYILALAAERVSRDTDIWLEPPTLANIFDGEREVRARRHAAEDS* |
| Ga0137363_107628051 | 3300012202 | Vadose Zone Soil | LALAAERVSRDTDTWLEPPTLANIFDEEREVRGRRRSTEGP* |
| Ga0137399_101144822 | 3300012203 | Vadose Zone Soil | LALAAERVSRDTDIWLEPPTLANLFDEARAVHARRRSVEGA* |
| Ga0137399_106051341 | 3300012203 | Vadose Zone Soil | MSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEARAVQARRRSVEGA* |
| Ga0137380_107051302 | 3300012206 | Vadose Zone Soil | VSTLMSHLHCYILALAAERVSRDTEIWLEPPTLANLFDEAREVRARRHAAEES* |
| Ga0137381_106213501 | 3300012207 | Vadose Zone Soil | HLHCYILALAAERVSRDTDVWIEPPTLANIFDEEREVRGRRRVAEGP* |
| Ga0137381_115784881 | 3300012207 | Vadose Zone Soil | DVAVSTLMSHLHCSILALAAERVSRDTGIWVEPPALANLFDEARAVHAKRRSVEGA* |
| Ga0137379_102963601 | 3300012209 | Vadose Zone Soil | AERVSRDTDIWVEPPTLANIFDEEREVRGRRRSAEGP* |
| Ga0137379_105155932 | 3300012209 | Vadose Zone Soil | ILALAAERVSRDTDIWVEPPTLANLFDEARAVHAKRRSVEGA* |
| Ga0137366_102583153 | 3300012354 | Vadose Zone Soil | LDVAVSTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEERAVQAKRRSAEGA* |
| Ga0137366_110777552 | 3300012354 | Vadose Zone Soil | DQLEVAVGTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0137371_113707131 | 3300012356 | Vadose Zone Soil | RVSRDTDILLEPPTLANLFDAEREVRGQRRAAEGL* |
| Ga0137384_106439431 | 3300012357 | Vadose Zone Soil | VSRDTDIWVEPPTLATIFDAEREVRGWRRFTEGP* |
| Ga0137385_104733121 | 3300012359 | Vadose Zone Soil | LHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0137360_105550311 | 3300012361 | Vadose Zone Soil | TVSTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEARAVHARRRSVEGA* |
| Ga0137361_108478213 | 3300012362 | Vadose Zone Soil | ERVSRDTDTWLESPTLANIFDEEREVRGRRRSTEGP* |
| Ga0137361_109015061 | 3300012362 | Vadose Zone Soil | RVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP* |
| Ga0134023_12654561 | 3300012385 | Grasslands Soil | LEVAVSTLMSHLHCYMLALASERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0137359_101967371 | 3300012923 | Vadose Zone Soil | TLEVAVSTLMRHLHCSILALAAERVRRDTDIWVEPPTLATMFDEEREVRDRRRSAEGP* |
| Ga0137419_106615572 | 3300012925 | Vadose Zone Soil | VSRDTDIWLEPPTLANLFDEARAVHARRRSVEGA* |
| Ga0137419_110740632 | 3300012925 | Vadose Zone Soil | MSHLHCYILALAAERVSRDTDIWVEPPTLANLFDEERAVQAKRRSAEGA* |
| Ga0137416_105709311 | 3300012927 | Vadose Zone Soil | VSTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEARAVHARRRSVEGA* |
| Ga0137407_102950361 | 3300012930 | Vadose Zone Soil | MSHMHCYILALAAERVSRDTDIWVEPPTLVNLFDEARAVQARRRSVEGA* |
| Ga0137407_117581002 | 3300012930 | Vadose Zone Soil | LMRHLHCYILALAAERVSRDTDIWVEPPTLANIFDEEREVRGRRRSAEGP* |
| Ga0137407_118925142 | 3300012930 | Vadose Zone Soil | LMSHLHCYILALAAERVSRDTDTWLEPPTLANIFDEEREVRGRRRSTEGP* |
| Ga0137410_115253061 | 3300012944 | Vadose Zone Soil | AERVSRDTDIWVEPPTLATIFDEEREVRGRRRSAEGP* |
| Ga0137410_118902191 | 3300012944 | Vadose Zone Soil | LHCYILALAAERVSRDTDTWLEPPTLANIFDEEREVRGRRRSTEGP* |
| Ga0126375_101972111 | 3300012948 | Tropical Forest Soil | MALAAERVSRDTDIWLEPPTLANLFDEQREVRGRRRGADGS |
| Ga0126369_100520188 | 3300012971 | Tropical Forest Soil | LEVAVSTLMSHLHCYMLALAAERVSRDTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0126369_100764274 | 3300012971 | Tropical Forest Soil | VSRDTDIWLEPPTLANLFDEAREVRARRHAAEES* |
| Ga0126369_101858812 | 3300012971 | Tropical Forest Soil | LDVAVSTLMNHLHCYILALAAERVSRDTEVWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126369_109871722 | 3300012971 | Tropical Forest Soil | AQLEVAVGTLMSHLHCYILALAAERVSRDTEIWLEPPTLANLFDEDREVRGRRRAAEGL* |
| Ga0126369_110548631 | 3300012971 | Tropical Forest Soil | ERVSRDTEIWLEPPTLANLFDEEREVRARRHAAEES* |
| Ga0126369_111269692 | 3300012971 | Tropical Forest Soil | LAAERVSRDTEIWLEPPTLANLFDEAREVRGRRRSTEGP* |
| Ga0126369_113933931 | 3300012971 | Tropical Forest Soil | ILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGL* |
| Ga0126369_114959371 | 3300012971 | Tropical Forest Soil | LALAAERVSRDTDIWLEPPTLANLFDEAREVRARRHAAEES* |
| Ga0126369_121829951 | 3300012971 | Tropical Forest Soil | LAAERVSRDTDIWLEPPTLANLFDEEREVRGRRRSADGS* |
| Ga0163162_133278082 | 3300013306 | Switchgrass Rhizosphere | LMRHLHCSILALAAERVSRDTDIWVEPPTLANLFDEEREVRARRRSAEGS* |
| Ga0182000_103014682 | 3300014487 | Soil | AVSTLMSHLHCYMLALAAERVSRNTEIWLEPPTLANLFDEAREVQARRRAAEDS* |
| Ga0180104_10239631 | 3300014884 | Soil | ASTLMRHMHCYILALAAERVSRDTDIWVEPPTLTNLFDAERAVRTQQRPPRLSLER* |
| Ga0137403_107217711 | 3300015264 | Vadose Zone Soil | ALAAERVSRDTDIWVEPPTLATIFDEEREVRGQRRSAEGP* |
| Ga0132255_1000240989 | 3300015374 | Arabidopsis Rhizosphere | LMSHLHGYILALAAERVSRGTDIWLEPPTLANILDEEREVRGRRRAAEGP* |
| Ga0182041_103898431 | 3300016294 | Soil | LAAERVSHDTEIWVEPPTLENLFDEEREVRARRRSAEGS |
| Ga0182041_104681542 | 3300016294 | Soil | AVSTLMNHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHAAEES |
| Ga0182033_104880052 | 3300016319 | Soil | LAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGL |
| Ga0182033_108769571 | 3300016319 | Soil | YIMALAAERVSRDTDLWLEPPTLANLFDEAREVRARRHAAEES |
| Ga0182035_119033822 | 3300016341 | Soil | LHCYILALAAERVSRDTDIWLEPPTLANLFDEEREVRARRHAAEES |
| Ga0182032_101109311 | 3300016357 | Soil | STLMNHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVQARRHAAEES |
| Ga0182034_110398311 | 3300016371 | Soil | QLEVAVSTLMNHLHCYILALAAERVSRDTDIWLEPPTLANLFDEERKVRARRHAAEDS |
| Ga0134112_101526381 | 3300017656 | Grasslands Soil | ESVSRHTDIWVEPPTLANIFDEEREVRALRRSSEGS |
| Ga0163161_108137442 | 3300017792 | Switchgrass Rhizosphere | GTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRCTEEP |
| Ga0163161_117694682 | 3300017792 | Switchgrass Rhizosphere | ALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGP |
| Ga0163161_119231561 | 3300017792 | Switchgrass Rhizosphere | HCYMLALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHSTEES |
| Ga0184642_12798241 | 3300019279 | Groundwater Sediment | QLEVAVSTLMNHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHSAEES |
| Ga0126371_113869433 | 3300021560 | Tropical Forest Soil | LDVAVSTLMSHLHCYILALAAERVSRDTEFWLEPPTLANLFDEEREVRGRRRAAEGP |
| Ga0126371_125927411 | 3300021560 | Tropical Forest Soil | RVSRDTEIWLEPPTLANLFDEQREVRGHRRAAEGS |
| Ga0207646_103915013 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LALAAESVSRRTDIWVEPPTLANIFDAEREVRARRRSVEGA |
| Ga0207646_106232882 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | LMSHMHCYILALAAERVSRDTDIWVEPPTLANILDEEREVRARRRSSEGS |
| Ga0207712_119986521 | 3300025961 | Switchgrass Rhizosphere | YILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGP |
| Ga0207675_1005534641 | 3300026118 | Switchgrass Rhizosphere | ALAAERVSRDTDIWLEPPTLANLFDAEREVRGQRRAAEGP |
| Ga0207675_1017624561 | 3300026118 | Switchgrass Rhizosphere | ALAAERVSRDTDIWLEPPTLANLFDAEREVRGRRRAAEGP |
| Ga0209238_12790682 | 3300026301 | Grasslands Soil | MSHLHCYILALAAERVSRDTDIWVEPPTLANLFDEERAVQAKRRSAEGA |
| Ga0209388_11912682 | 3300027655 | Vadose Zone Soil | CSILALAAERVSRDTDIWVEPPTLATIFDEEREVRGRRRSAEGP |
| Ga0209180_101851791 | 3300027846 | Vadose Zone Soil | MSHLHCYILALSAERVSRDTDIRVEPPTLVNIFDEEREVRARRRSAEGS |
| Ga0209283_102736341 | 3300027875 | Vadose Zone Soil | ERVSRDTDIWVEPPTLATIFDEEREVRGRRRSAEGP |
| Ga0209481_103474522 | 3300027880 | Populus Rhizosphere | YMLALAAERVSRNTEIWVEPPTLANIFEAEREVRARRRSGEGA |
| Ga0209590_100939814 | 3300027882 | Vadose Zone Soil | VAVSTLMSHLHCSILALAAERVSRDTDIWVEPPTLANIFDAEREVRGWRRFTEGP |
| Ga0209590_101107421 | 3300027882 | Vadose Zone Soil | HLHCYILALSAERVSRDTDIRVEPPTLVNIFDEEREVRARRRSAEGS |
| Ga0209488_100474431 | 3300027903 | Vadose Zone Soil | VSTLMSHLHCSILALAAERVSRDTDIWVEPPTLATIFDEEREVRGRRRSAEGP |
| Ga0209382_119461412 | 3300027909 | Populus Rhizosphere | EVAVSTLMSHLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRGRRRAVEEP |
| Ga0307312_108375132 | 3300028828 | Soil | TLMRHLHCYILALAAERVSRDTDIRVEPPTLVNIFDEEREVRARRRSAEGS |
| Ga0102752_15146521 | 3300030783 | Soil | HLHCYILALAAERVSRDTEIWLEPPTLANLFDEEREVRARRHSAEES |
| Ga0306918_111841532 | 3300031744 | Soil | MNHLHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRARRHAAEES |
| Ga0306918_114199782 | 3300031744 | Soil | GTLMSYLHCYILALAAERVSRDTDIWVEPPTLANLFDGEREVRARRRSPEEP |
| Ga0318552_104620381 | 3300031782 | Soil | LALAAERVSRDTEIWLEPPTLANLFDAEREVRARRHAAEES |
| Ga0306919_111673292 | 3300031879 | Soil | EVAVSTLMNHLHCYILALAAERVSRDTDLWLEPPTLANLFDEAREVRARRHAAEES |
| Ga0306925_107303461 | 3300031890 | Soil | ILALAAERVSRDTEIWLEPPTLANLFDEEREVQARRHAAEES |
| Ga0306925_113670252 | 3300031890 | Soil | VAVSTLMSNLHCYILALAAERGSRDTEIWLEPPTLANLLDEEREVRARRHTVEES |
| Ga0318536_107113931 | 3300031893 | Soil | PTHVEVVVSTLMSHLHCSILALAAERVSRDTAIWLAPPTLANLFDEAREVHARRRSVEGA |
| Ga0306923_113012381 | 3300031910 | Soil | MSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEQREVRGRRRSVDGS |
| Ga0310912_111754762 | 3300031941 | Soil | DQLEVVVSTLMSHLHCYILALAAERVSRDTDIWLEPPTLANLFDGEREVRARRHSAEES |
| Ga0310912_113503071 | 3300031941 | Soil | ERVSRDTEIWIEPPTLANLFDGEREVRARRRPAEES |
| Ga0310913_101964373 | 3300031945 | Soil | LHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRARRHAAEES |
| Ga0310910_102976511 | 3300031946 | Soil | EQLDVAVGTLMRYFHCYILALAAERVSRDTDIWVEPPTLANLFDEAREVRARRRTVEES |
| Ga0310910_112688022 | 3300031946 | Soil | TLMRHLHCYILALAAERVSRDTEIWLEPPTLANLFDAEREVRGQRRSAEGL |
| Ga0310910_113973651 | 3300031946 | Soil | DQLDVAVSTLLSHLHCYILALAAERVSCDTDMWLEPPTLVNLFDEKREVRGRRRAADGS |
| Ga0310909_108938171 | 3300031947 | Soil | LHCYILALAAERVSRDTDIWLEPPTLANIFDEEREVRGRRRAAEGP |
| Ga0306926_114634581 | 3300031954 | Soil | ALAAERVSRHTDLWIEPPTVANIFDEEREVRARRRSIEGA |
| Ga0306922_118144421 | 3300032001 | Soil | HLHCYIVALAAERVSCDTEIWLEPPTLANLFDAEREVRGQRRSAEGL |
| Ga0310906_108949821 | 3300032013 | Soil | MSHLHCYILALAAERGSRDTDTWLEPPTLANIFDEEREVRGRRRCTEGP |
| Ga0306924_105047261 | 3300032076 | Soil | KLEVAVSTLMSHLHCYILALSAERVSRDTDIWVEPPTLANIFDEDREVRGRRRFIEGP |
| Ga0306924_105591803 | 3300032076 | Soil | MRYFHCYILALAAERVSRDTDIWVEPPTLANLFDEAREVRARRRTVEES |
| Ga0314801_150455_396_545 | 3300034676 | Soil | MSHLHCYILALAAERVSRDTDIWLEPPTLANLFDEEREVRARRHSTEES |
| ⦗Top⦘ |