


| Basic Information | |
|---|---|
| Family ID | F028596 |
| Family Type | Metagenome |
| Number of Sequences | 191 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 191 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.76 % |
| % of genes near scaffold ends (potentially truncated) | 91.62 % |
| % of genes from short scaffolds (< 2000 bps) | 93.19 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.335 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (12.565 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.220 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (36.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.03% β-sheet: 0.00% Coil/Unstructured: 61.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 191 Family Scaffolds |
|---|---|---|
| PF04909 | Amidohydro_2 | 23.04 |
| PF03401 | TctC | 8.90 |
| PF08309 | LVIVD | 7.85 |
| PF13379 | NMT1_2 | 7.33 |
| PF09084 | NMT1 | 3.66 |
| PF00903 | Glyoxalase | 3.14 |
| PF00892 | EamA | 3.14 |
| PF01872 | RibD_C | 2.09 |
| PF02239 | Cytochrom_D1 | 1.57 |
| PF09826 | Beta_propel | 1.05 |
| PF00441 | Acyl-CoA_dh_1 | 1.05 |
| PF03450 | CO_deh_flav_C | 1.05 |
| PF10543 | ORF6N | 0.52 |
| PF00501 | AMP-binding | 0.52 |
| PF00994 | MoCF_biosynth | 0.52 |
| PF13432 | TPR_16 | 0.52 |
| PF00583 | Acetyltransf_1 | 0.52 |
| PF01738 | DLH | 0.52 |
| PF01494 | FAD_binding_3 | 0.52 |
| PF02668 | TauD | 0.52 |
| PF00355 | Rieske | 0.52 |
| PF00144 | Beta-lactamase | 0.52 |
| PF02784 | Orn_Arg_deC_N | 0.52 |
| PF02896 | PEP-utilizers_C | 0.52 |
| PF13469 | Sulfotransfer_3 | 0.52 |
| PF00753 | Lactamase_B | 0.52 |
| PF01839 | FG-GAP | 0.52 |
| PF00462 | Glutaredoxin | 0.52 |
| PF13417 | GST_N_3 | 0.52 |
| PF13531 | SBP_bac_11 | 0.52 |
| PF03972 | MmgE_PrpD | 0.52 |
| PF01977 | UbiD | 0.52 |
| PF07399 | Na_H_antiport_3 | 0.52 |
| PF10417 | 1-cysPrx_C | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 191 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 8.90 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 7.85 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.66 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 3.66 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 2.09 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 2.09 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.05 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.05 |
| COG0019 | Diaminopimelate decarboxylase | Amino acid transport and metabolism [E] | 0.52 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.52 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.52 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.52 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.52 |
| COG1166 | Arginine decarboxylase (spermidine biosynthesis) | Amino acid transport and metabolism [E] | 0.52 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.52 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.52 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.34 % |
| Unclassified | root | N/A | 3.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101131401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 545 | Open in IMG/M |
| 3300000955|JGI1027J12803_104693841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 519 | Open in IMG/M |
| 3300000955|JGI1027J12803_109455230 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
| 3300000956|JGI10216J12902_102392689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300000956|JGI10216J12902_104480060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300000956|JGI10216J12902_109843319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
| 3300000956|JGI10216J12902_115188956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
| 3300002886|JGI25612J43240_1075738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300002906|JGI25614J43888_10055956 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1168 | Open in IMG/M |
| 3300003152|Ga0052254_1110961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 523 | Open in IMG/M |
| 3300003319|soilL2_10008915 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1945 | Open in IMG/M |
| 3300003319|soilL2_10034129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1305 | Open in IMG/M |
| 3300004081|Ga0063454_101050112 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300004082|Ga0062384_101421603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300004114|Ga0062593_101702685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300004157|Ga0062590_101595793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
| 3300004463|Ga0063356_101977224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300005093|Ga0062594_102953334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 530 | Open in IMG/M |
| 3300005169|Ga0066810_10076301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 703 | Open in IMG/M |
| 3300005176|Ga0066679_10170317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
| 3300005181|Ga0066678_10461576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 844 | Open in IMG/M |
| 3300005332|Ga0066388_108747080 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300005345|Ga0070692_11145662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 551 | Open in IMG/M |
| 3300005439|Ga0070711_101217169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300005440|Ga0070705_100659640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 817 | Open in IMG/M |
| 3300005446|Ga0066686_10188628 | Not Available | 1377 | Open in IMG/M |
| 3300005456|Ga0070678_101558164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 620 | Open in IMG/M |
| 3300005468|Ga0070707_100374120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1384 | Open in IMG/M |
| 3300005526|Ga0073909_10268156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax | 765 | Open in IMG/M |
| 3300005526|Ga0073909_10666041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300005543|Ga0070672_101995210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
| 3300005544|Ga0070686_101669375 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005545|Ga0070695_100330093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 1137 | Open in IMG/M |
| 3300005552|Ga0066701_10871202 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300005566|Ga0066693_10246312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 707 | Open in IMG/M |
| 3300005576|Ga0066708_10050151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2332 | Open in IMG/M |
| 3300005598|Ga0066706_11335999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus basilensis | 541 | Open in IMG/M |
| 3300005764|Ga0066903_100689420 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1797 | Open in IMG/M |
| 3300005764|Ga0066903_101102225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1464 | Open in IMG/M |
| 3300005843|Ga0068860_102548951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300005844|Ga0068862_101160280 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 770 | Open in IMG/M |
| 3300006050|Ga0075028_100698128 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 611 | Open in IMG/M |
| 3300006173|Ga0070716_100924198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 685 | Open in IMG/M |
| 3300006640|Ga0075527_10266334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 503 | Open in IMG/M |
| 3300006794|Ga0066658_10691410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 563 | Open in IMG/M |
| 3300006797|Ga0066659_11609024 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300006845|Ga0075421_100068969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4466 | Open in IMG/M |
| 3300006847|Ga0075431_100127944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2621 | Open in IMG/M |
| 3300006847|Ga0075431_101204716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 720 | Open in IMG/M |
| 3300006853|Ga0075420_100191508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1787 | Open in IMG/M |
| 3300006871|Ga0075434_101343101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300006880|Ga0075429_100190787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1795 | Open in IMG/M |
| 3300006954|Ga0079219_11412964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
| 3300009012|Ga0066710_101408804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1080 | Open in IMG/M |
| 3300009088|Ga0099830_10746955 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 806 | Open in IMG/M |
| 3300009147|Ga0114129_10946522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1088 | Open in IMG/M |
| 3300009156|Ga0111538_14012018 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300009162|Ga0075423_12008322 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300009167|Ga0113563_12713694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 599 | Open in IMG/M |
| 3300009177|Ga0105248_10721923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1124 | Open in IMG/M |
| 3300009660|Ga0105854_1391591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300009805|Ga0105079_1040743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 526 | Open in IMG/M |
| 3300010045|Ga0126311_11733013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 528 | Open in IMG/M |
| 3300010047|Ga0126382_11199133 | Not Available | 680 | Open in IMG/M |
| 3300010337|Ga0134062_10333998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 726 | Open in IMG/M |
| 3300010373|Ga0134128_12494083 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300010400|Ga0134122_11229739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 752 | Open in IMG/M |
| 3300010401|Ga0134121_11573311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 676 | Open in IMG/M |
| 3300010401|Ga0134121_13159539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 509 | Open in IMG/M |
| 3300011398|Ga0137348_1041146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 771 | Open in IMG/M |
| 3300011405|Ga0137340_1013168 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1496 | Open in IMG/M |
| 3300011405|Ga0137340_1095677 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300011421|Ga0137462_1004389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2415 | Open in IMG/M |
| 3300011436|Ga0137458_1248861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 541 | Open in IMG/M |
| 3300011438|Ga0137451_1039934 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1369 | Open in IMG/M |
| 3300011442|Ga0137437_1198810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300011442|Ga0137437_1344401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 504 | Open in IMG/M |
| 3300011443|Ga0137457_1316738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 532 | Open in IMG/M |
| 3300011444|Ga0137463_1157395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300012041|Ga0137430_1057506 | Not Available | 1061 | Open in IMG/M |
| 3300012041|Ga0137430_1164727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 640 | Open in IMG/M |
| 3300012129|Ga0137345_1024241 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012140|Ga0137351_1053404 | Not Available | 574 | Open in IMG/M |
| 3300012143|Ga0137354_1070975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 554 | Open in IMG/M |
| 3300012161|Ga0137336_1011847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1515 | Open in IMG/M |
| 3300012168|Ga0137357_1088624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 637 | Open in IMG/M |
| 3300012173|Ga0137327_1015868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1517 | Open in IMG/M |
| 3300012202|Ga0137363_10992456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300012207|Ga0137381_11090290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300012212|Ga0150985_122716063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2372 | Open in IMG/M |
| 3300012231|Ga0137465_1064553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1088 | Open in IMG/M |
| 3300012285|Ga0137370_10732649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300012361|Ga0137360_11445248 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300012510|Ga0157316_1073924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300012519|Ga0157352_1095483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300012897|Ga0157285_10217459 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300012917|Ga0137395_10101431 | All Organisms → cellular organisms → Bacteria | 1912 | Open in IMG/M |
| 3300012925|Ga0137419_11219873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300012925|Ga0137419_11440254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 582 | Open in IMG/M |
| 3300012925|Ga0137419_11462106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
| 3300012929|Ga0137404_10956067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 783 | Open in IMG/M |
| 3300012930|Ga0137407_10233065 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1663 | Open in IMG/M |
| 3300012930|Ga0137407_11560361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 628 | Open in IMG/M |
| 3300012944|Ga0137410_10178044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1636 | Open in IMG/M |
| 3300012957|Ga0164303_10510593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 772 | Open in IMG/M |
| 3300012964|Ga0153916_10133545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2400 | Open in IMG/M |
| 3300012964|Ga0153916_11116308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 868 | Open in IMG/M |
| 3300012971|Ga0126369_12902966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300012984|Ga0164309_10466643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300014166|Ga0134079_10369751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 658 | Open in IMG/M |
| 3300014745|Ga0157377_11101369 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 608 | Open in IMG/M |
| 3300014745|Ga0157377_11226185 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300014862|Ga0180096_1008949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 762 | Open in IMG/M |
| 3300014878|Ga0180065_1116483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 613 | Open in IMG/M |
| 3300014880|Ga0180082_1069352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 768 | Open in IMG/M |
| 3300015052|Ga0137411_1322839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1364 | Open in IMG/M |
| 3300015052|Ga0137411_1375505 | All Organisms → cellular organisms → Bacteria | 5177 | Open in IMG/M |
| 3300015053|Ga0137405_1144244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1871 | Open in IMG/M |
| 3300015054|Ga0137420_1204766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1405 | Open in IMG/M |
| 3300015201|Ga0173478_10337378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 698 | Open in IMG/M |
| 3300015245|Ga0137409_10324050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1349 | Open in IMG/M |
| 3300017654|Ga0134069_1018669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2065 | Open in IMG/M |
| 3300017965|Ga0190266_10054526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1434 | Open in IMG/M |
| 3300017965|Ga0190266_11303142 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018083|Ga0184628_10324136 | Not Available | 809 | Open in IMG/M |
| 3300018083|Ga0184628_10579185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 570 | Open in IMG/M |
| 3300018431|Ga0066655_10999197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 578 | Open in IMG/M |
| 3300018469|Ga0190270_10925976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 891 | Open in IMG/M |
| 3300018469|Ga0190270_11429203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 739 | Open in IMG/M |
| 3300018481|Ga0190271_11508640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 789 | Open in IMG/M |
| 3300018481|Ga0190271_13618913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
| 3300020022|Ga0193733_1040314 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1318 | Open in IMG/M |
| 3300020215|Ga0196963_10040977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1940 | Open in IMG/M |
| 3300021063|Ga0206227_1089277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 599 | Open in IMG/M |
| 3300021081|Ga0210379_10444787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 574 | Open in IMG/M |
| 3300021602|Ga0194060_10430449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 629 | Open in IMG/M |
| 3300021602|Ga0194060_10506148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300024177|Ga0247686_1014358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 864 | Open in IMG/M |
| 3300024325|Ga0247678_1066999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300025888|Ga0209540_10221387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1111 | Open in IMG/M |
| 3300025905|Ga0207685_10782970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300025907|Ga0207645_10095054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1919 | Open in IMG/M |
| 3300025910|Ga0207684_11698458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300025916|Ga0207663_11018439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300025916|Ga0207663_11211523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 608 | Open in IMG/M |
| 3300025917|Ga0207660_10791188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 774 | Open in IMG/M |
| 3300025933|Ga0207706_11284224 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300025934|Ga0207686_10458315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 982 | Open in IMG/M |
| 3300025935|Ga0207709_11657770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 531 | Open in IMG/M |
| 3300025945|Ga0207679_11786760 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025962|Ga0210070_1018206 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 807 | Open in IMG/M |
| 3300026048|Ga0208915_1002244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1375 | Open in IMG/M |
| 3300026118|Ga0207675_102158233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300026313|Ga0209761_1143821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1132 | Open in IMG/M |
| 3300026325|Ga0209152_10344302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 568 | Open in IMG/M |
| 3300026326|Ga0209801_1185151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 851 | Open in IMG/M |
| 3300026326|Ga0209801_1298055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300026328|Ga0209802_1284793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 550 | Open in IMG/M |
| 3300026333|Ga0209158_1296543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 556 | Open in IMG/M |
| 3300026342|Ga0209057_1114065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1037 | Open in IMG/M |
| 3300026524|Ga0209690_1264112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
| 3300026548|Ga0209161_10000484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 32308 | Open in IMG/M |
| 3300026551|Ga0209648_10118287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2143 | Open in IMG/M |
| 3300027011|Ga0207740_1038517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300027330|Ga0207777_1096760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300027573|Ga0208454_1030004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1275 | Open in IMG/M |
| 3300027682|Ga0209971_1031797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300027821|Ga0209811_10298633 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300027882|Ga0209590_10155764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1420 | Open in IMG/M |
| 3300027907|Ga0207428_10872037 | Not Available | 637 | Open in IMG/M |
| 3300028589|Ga0247818_10556696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 786 | Open in IMG/M |
| 3300028804|Ga0268298_10198720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 1094 | Open in IMG/M |
| 3300028812|Ga0247825_11276370 | Not Available | 537 | Open in IMG/M |
| 3300031198|Ga0307500_10133547 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300031366|Ga0307506_10403456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 560 | Open in IMG/M |
| 3300031562|Ga0310886_10804799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 592 | Open in IMG/M |
| 3300031720|Ga0307469_12297255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 526 | Open in IMG/M |
| 3300031912|Ga0306921_10422270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1556 | Open in IMG/M |
| 3300032002|Ga0307416_103465521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 528 | Open in IMG/M |
| 3300032157|Ga0315912_10062656 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2930 | Open in IMG/M |
| 3300032180|Ga0307471_103658204 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300032180|Ga0307471_104338817 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300032205|Ga0307472_101539864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → unclassified Cupriavidus → Cupriavidus sp. UYMMa02A | 651 | Open in IMG/M |
| 3300032205|Ga0307472_102526158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
| 3300032770|Ga0335085_10451526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1479 | Open in IMG/M |
| 3300032892|Ga0335081_10198159 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300033480|Ga0316620_10063889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2601 | Open in IMG/M |
| 3300034149|Ga0364929_0050938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1256 | Open in IMG/M |
| 3300034149|Ga0364929_0193378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 671 | Open in IMG/M |
| 3300034151|Ga0364935_0232189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 599 | Open in IMG/M |
| 3300034354|Ga0364943_0177162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae | 777 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.57% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 12.04% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.33% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.24% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.24% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.14% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.62% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.09% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.09% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.05% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.05% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.05% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.05% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.05% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.05% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.52% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.52% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.52% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.52% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009660 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011398 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2 | Environmental | Open in IMG/M |
| 3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012041 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2 | Environmental | Open in IMG/M |
| 3300012129 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2 | Environmental | Open in IMG/M |
| 3300012140 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT690_2 | Environmental | Open in IMG/M |
| 3300012143 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2 | Environmental | Open in IMG/M |
| 3300012161 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2 | Environmental | Open in IMG/M |
| 3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
| 3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014862 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300024177 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK27 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026048 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1011314011 | 3300000364 | Soil | KSMGVDIMEMSQPEFASYVRADFDKWRKVAKEGNIAVE* |
| JGI1027J12803_1046938412 | 3300000955 | Soil | MGVDIMEMSQPEFASYVRADFDKWRKVAKEGNIAVE* |
| JGI1027J12803_1094552302 | 3300000955 | Soil | SGSLRKAMSGEAVRERYRSMGVDVMDMGQADFATFVRADYEKWRRVAREGNIVVE* |
| JGI10216J12902_1023926892 | 3300000956 | Soil | VEVMDMNQSDFAAYVRADYEKWRKVAREGNIVVE* |
| JGI10216J12902_1044800602 | 3300000956 | Soil | SLRKALTNAAVRERFGGMGVEIMDMPQAEFAAYVRTDYDKWQKVAREGNIVIE* |
| JGI10216J12902_1098433191 | 3300000956 | Soil | FGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE* |
| JGI10216J12902_1151889562 | 3300000956 | Soil | ERYRQMGVELIEMSQPEFAAYVREDLAKWQRVAREGNIVVE* |
| JGI25612J43240_10757382 | 3300002886 | Grasslands Soil | VPAAAADRLTAALRRALSNQTVRERYRSMGVDVMDMSRAEFTAYVRADFEKWRTIAREGNIVVE* |
| JGI25614J43888_100559562 | 3300002906 | Grasslands Soil | LRRALSNETVRERYRSMGVDVMDMSRAEFIAYVRADFEKWRTIAREGNIVVE* |
| Ga0052254_11109613 | 3300003152 | Sediment | LHKAMSRDDVRERYRTMGVDVMDMTQPQFAAYVRADYQKWQKVARDGNISVE* |
| soilL2_100089152 | 3300003319 | Sugarcane Root And Bulk Soil | VRERYRGMGVEIIEASQADFDVYVRADFEKWRRVAREGNIVVE* |
| soilL2_100341291 | 3300003319 | Sugarcane Root And Bulk Soil | SVRERYQAMGVEVMDMGQPEFAAYVRADYQKRQKVAREGNISVE* |
| Ga0063454_1010501121 | 3300004081 | Soil | NQTVRTRFHTMGVEVMDMSRAEFAAYVRADYEKWLKLAREANIVIE* |
| Ga0062384_1014216032 | 3300004082 | Bog Forest Soil | EIVRDRFRSMGVDLMDMSQPEFAAYVRADFEKWRQIAREGNISIE* |
| Ga0062593_1017026853 | 3300004114 | Soil | VRERYRSMGVEVMDMGQADFAAFVRADYEKWQRVAREGNIVVE* |
| Ga0062590_1015957931 | 3300004157 | Soil | EKARADEKLRSRYRTLGVEMMDMSRAQFAAYVRDDYEKWVKVAREANISLE* |
| Ga0063356_1019772241 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NQLNGALRKALATQAVRERYRQMGVDIMDMSQPQFDAYVRADYRKWQKVARDGHISVD* |
| Ga0062594_1029533342 | 3300005093 | Soil | VRERYRSMGVEIMDLSQAEFSAYVKTDFEKWRQIARERNIVVE* |
| Ga0066810_100763012 | 3300005169 | Soil | ALQVESVRERYRQMGVDLIEMSQPEFAAFVRDDYEKWRRVAREGNIVVE* |
| Ga0066679_101703173 | 3300005176 | Soil | ANPTVRGRFRTMGVEVMDMSRAEFAAYVRADYDKWLKLAREANIVLE* |
| Ga0066678_104615762 | 3300005181 | Soil | VRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE* |
| Ga0066388_1087470801 | 3300005332 | Tropical Forest Soil | ARTNEAVRERYRSMGVELMDLSTADFNAFVRADFEKWRQVARDGNIVVE* |
| Ga0070692_111456621 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | YRSMGVEVMDMNQSDFGSYVRADYEKWRRVAREGNIVVE* |
| Ga0070711_1012171692 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ERYKSMGVDIMDMSQPDFAAYVRADYDKWRKVAKEGNISVE* |
| Ga0070705_1006596401 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VRERYRGMGVDVMDMGQADFAAFVRADYEKWRRVAREGNIVVE* |
| Ga0066686_101886281 | 3300005446 | Soil | RKALANESIRESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE* |
| Ga0070678_1015581642 | 3300005456 | Miscanthus Rhizosphere | HPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE* |
| Ga0070707_1003741201 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | KKALAVDAVRERYRSMGVEVMDMGQPEFAAYVKTDYEKWRKVAREANIVVE* |
| Ga0073909_102681561 | 3300005526 | Surface Soil | VRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE* |
| Ga0073909_106660411 | 3300005526 | Surface Soil | ALRRALSGETVRERYRSMGAELMDMSRAEFAAYVRADFEKWRTIAREGNIVVE* |
| Ga0070672_1019952101 | 3300005543 | Miscanthus Rhizosphere | ALTHPTVRERFGGMGVEIMDLGQAEFAAYVRADYDKWRRVAREGNIVVE* |
| Ga0070686_1016693752 | 3300005544 | Switchgrass Rhizosphere | KALASDSVRARYRAIGVEVMEMSRAEFSDYVRADVEKWRKVAREANIVVE* |
| Ga0070695_1003300932 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AAALHKAMSRDDVRGRYRAMGVDVMDMAQGEFSKYVRADYDKWLKVAREGNISVE* |
| Ga0066701_108712022 | 3300005552 | Soil | PTVRGRFRTMGVEVMDMSRAEFAAYVRADYDKWLKLAREANIVLE* |
| Ga0066693_102463121 | 3300005566 | Soil | MGVELMDMSQAQFAAYVRADYQKWQKVAREGNISVE* |
| Ga0066708_100501511 | 3300005576 | Soil | IDKLSAALRKALAVESVRERYRGMGVDVMDMGQAEFAAYVRADYEKWQRVAREGNIVVE* |
| Ga0066706_113359991 | 3300005598 | Soil | ALRKALAVESVRERYRGMGVDVMDMGQAEFVAYVRADYEKWQRVAREGNIVIE* |
| Ga0066903_1006894201 | 3300005764 | Tropical Forest Soil | AVADKLTGALHRALSNETVRERYRSMGVDILDMSRAEFSAYVRADYEKWRTIAREGRIEVE* |
| Ga0066903_1011022251 | 3300005764 | Tropical Forest Soil | MGVELMDLSTADFNAYVRADFEKWRQVARDGNIVIE* |
| Ga0068860_1025489512 | 3300005843 | Switchgrass Rhizosphere | ERYRGMGVEIMDSSQAEFAAFVRADLDKWRRVAREGNIVVE* |
| Ga0068862_1011602801 | 3300005844 | Switchgrass Rhizosphere | GVEVLDMGQADFATFVRADYEKWRRVAREGNIVVE* |
| Ga0075028_1006981282 | 3300006050 | Watersheds | DETVRKHYLSMGVEIMDMSRAEFSAYVRADYEKWRTIAREGNIVVE* |
| Ga0070716_1009241981 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | HRALSNETVRERYRSMGVEIMDMDQAEFAAYVRADLEKWRRVAREGNIVVE* |
| Ga0075527_102663341 | 3300006640 | Arctic Peat Soil | YHSMGVEIMDMTQAEFAAYVHTDFEKWRQVARDANIVVE* |
| Ga0066658_106914102 | 3300006794 | Soil | MAIDTVRERFRTMGVEVIDMSREQFAAYVRADYEKWRTVAREANIVIE* |
| Ga0066659_116090242 | 3300006797 | Soil | RERYRAMGVDVMDMSQAQFAALVREDYAKWLKVARDGNIVID* |
| Ga0075421_1000689697 | 3300006845 | Populus Rhizosphere | SLRKAMSGEAVRERYRSMGVEVMDMSQAEFAAYVRSDYEKWRRVAREGNIVVE* |
| Ga0075431_1001279441 | 3300006847 | Populus Rhizosphere | VRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGHIVVE* |
| Ga0075431_1012047161 | 3300006847 | Populus Rhizosphere | YRGMGVEIIDMTQAEFASYVRADFEKWRRVAREGNIVVE* |
| Ga0075420_1001915083 | 3300006853 | Populus Rhizosphere | TVRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGHIVVE* |
| Ga0075434_1013431012 | 3300006871 | Populus Rhizosphere | KAMSLEPVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE* |
| Ga0075429_1001907873 | 3300006880 | Populus Rhizosphere | MGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE* |
| Ga0079219_114129642 | 3300006954 | Agricultural Soil | AALRKAMTRDDVRERYRAMGVDVMEMGQPEFAAYVRTDYEKWRKVARDGNIVVE* |
| Ga0066710_1014088043 | 3300009012 | Grasslands Soil | YRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0099830_107469551 | 3300009088 | Vadose Zone Soil | YRSMGVDIMDMSRTEFAAYVRADYQKWRTIAREGNIVVE* |
| Ga0114129_109465222 | 3300009147 | Populus Rhizosphere | VRERYRAMGVEVMDMGQAQFAAYVRADYQKWLKVAREGNIVVE* |
| Ga0111538_140120181 | 3300009156 | Populus Rhizosphere | VRERYRSMGVEVMDMNQSDFAAYVRADYEKWRRVAREGNIVVE* |
| Ga0075423_120083222 | 3300009162 | Populus Rhizosphere | ALLNPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE* |
| Ga0113563_127136942 | 3300009167 | Freshwater Wetlands | GVEVMDMSQPEFAAYVKTDFEKWKKIARERNIVVQ* |
| Ga0105248_107219233 | 3300009177 | Switchgrass Rhizosphere | MGVEIIDSSQAEFAAFVRADLEKWRRVAREGNIVVD* |
| Ga0105854_13915912 | 3300009660 | Permafrost Soil | VEIMDMTQAEFAAYVRTDFDKWRQVAREANIVVE* |
| Ga0105079_10407432 | 3300009805 | Groundwater Sand | MGVEVMDLSQPAFAAYVKTDYEKWRSVAREGNIVVE* |
| Ga0126311_117330131 | 3300010045 | Serpentine Soil | NPQVRERYQGMGVEVMDMSQPQFDAYVRADWDKWRKVARDGNIAVE* |
| Ga0126382_111991332 | 3300010047 | Tropical Forest Soil | LANDGVRERFRSMGVDVADMSQAEFAAYVRADFEKWRTVAREARIVVE* |
| Ga0134062_103339982 | 3300010337 | Grasslands Soil | ERYRAMGVELMDMSQPEFAAYVRADFQKWQKVARDGNISVE* |
| Ga0134128_124940831 | 3300010373 | Terrestrial Soil | KALATESVRARYRAIGVEVMDMNRADFSDYVRADVEKWRKVAREANIVVE* |
| Ga0134122_112297391 | 3300010400 | Terrestrial Soil | VEIMDMGQAEFAAYVRADYDKWQRVAREGNIVVE* |
| Ga0134121_115733112 | 3300010401 | Terrestrial Soil | RYRGMGVEVMDMPQPEFAAYVRQDFEKWKKVARDSNIVVD* |
| Ga0134121_131595391 | 3300010401 | Terrestrial Soil | KALHAAMARDDVRERYRTMGVEVMDLSQSDFAAFVRTDYQKWQKVAREGNISVE* |
| Ga0137348_10411461 | 3300011398 | Soil | LRKALANDGVRERFRSMGVDIAELSQAEFAAYVRADFEKWRTVAREAGIVVE* |
| Ga0137340_10131684 | 3300011405 | Soil | VRERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE* |
| Ga0137340_10956772 | 3300011405 | Soil | VRERFRGMGVEIIDMSPAQFAAYVRADFEKWRRVAREGNITVE* |
| Ga0137462_10043893 | 3300011421 | Soil | MSNESVRERYRAAGSDVLDMTQVEFAAYVRADFEKWKRVAREGNIVIE* |
| Ga0137458_12488612 | 3300011436 | Soil | LAVESVRERYRAMGVEVMDMSQPEFAAYVKTDFEKWRQVARERNIVVE* |
| Ga0137451_10399343 | 3300011438 | Soil | LSSALRKAMSNESVRERYRAAGSDVLDMTQVEFSAYVRADFEKWKRVAREGNIVIE* |
| Ga0137437_11988101 | 3300011442 | Soil | LKKALANDTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE* |
| Ga0137437_13444012 | 3300011442 | Soil | MDIMDMGQAEFTAHVRADYEKWRRVAREGNVLLE* |
| Ga0137457_13167382 | 3300011443 | Soil | ERYKSMGVDVMDMSQPEFAAYVRTDFDKWRKVAKEGNIAVE* |
| Ga0137463_11573952 | 3300011444 | Soil | YRSMGVEVMDLSRADFAAYVRVDYEKWKRIAREGNIVVE* |
| Ga0137430_10575061 | 3300012041 | Soil | SVREKYRGMGVEVMDMSQPDFAAYVKTDFEKWRKVARDANIVVE* |
| Ga0137430_11647272 | 3300012041 | Soil | LSSSLRKALLNDAVRERYRQMGVELIETSQAEFAAYVRDDFDKWRRVAREGNIVVE* |
| Ga0137345_10242412 | 3300012129 | Soil | LANETVRERYRGMGVEIIDASQAEFAAYVRTDFEKWRRVAREGNITVE* |
| Ga0137351_10534042 | 3300012140 | Soil | FRGMGVEIIDMGQAEFAAYVRADYEKWLKVAREGNIVVE* |
| Ga0137354_10709752 | 3300012143 | Soil | QVDAVREKYRSMGVEIMDLSQAGFAAYVKTDYEKWRLVAREANIVVE* |
| Ga0137336_10118471 | 3300012161 | Soil | DKLYVALRRALSSETVRERYRSMGVDVMDMNRVEFAAYVRADFEKWRAIAREGNIVVD* |
| Ga0137357_10886242 | 3300012168 | Soil | VRERYRSMGVEVMDMSQPEFAAYVKTDFEKWRKVAREANIVVE* |
| Ga0137327_10158682 | 3300012173 | Soil | MGVEIIELAQPEFAAYVRADYEKWLKVAREGNIVVE* |
| Ga0137363_109924562 | 3300012202 | Vadose Zone Soil | VEVMDMTRAEFAAYVRADFEKWLKLAREGNIVIE* |
| Ga0137381_110902902 | 3300012207 | Vadose Zone Soil | RYRSMGVDVMDMGRAEFAAYVRADFEKWRIIAREGNIVVE* |
| Ga0150985_1227160631 | 3300012212 | Avena Fatua Rhizosphere | ALANDTVRERYRGMAVEIVDSSEAEFAAFVRADLEKWRRVAREGNIVVE* |
| Ga0137465_10645531 | 3300012231 | Soil | RYRAMGVEIMDMGQAEFAAYVRADFEKWKRVAREGNIVIE* |
| Ga0137370_107326492 | 3300012285 | Vadose Zone Soil | SAALRKALAVESVRARYRGMGVDVMDMGRAEFVAYVRADYEKWLKVAREGNIVVE* |
| Ga0137360_114452482 | 3300012361 | Vadose Zone Soil | GALRRALSDETVRERYRSMGVELMDMSRAEFAAYVRADYEKWRTIARESNIVVE* |
| Ga0157316_10739241 | 3300012510 | Arabidopsis Rhizosphere | MGVEIIDSSQVEFDAFVRADYEKWRRVAREGNIVVE* |
| Ga0157352_10954832 | 3300012519 | Unplanted Soil | SSSLKRALANETVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE* |
| Ga0157285_102174591 | 3300012897 | Soil | RQMGVELIEMSQPEFAAYVRDDFDKWRRVAREGNIVVE* |
| Ga0137395_101014311 | 3300012917 | Vadose Zone Soil | TVRERYRSMGVDVMDLSRAEFAAYVRADFEKWRTIAREGNIVVE* |
| Ga0137419_112198731 | 3300012925 | Vadose Zone Soil | ETVRERYRSMGVDIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE* |
| Ga0137419_114402542 | 3300012925 | Vadose Zone Soil | RVGGDVIDMGQAEFASYVRADYEKLQRVAREGNIVVE* |
| Ga0137419_114621061 | 3300012925 | Vadose Zone Soil | SNQTVRERYRSMGVDVMDMSRAEFTAYVRADFEKWRSIARDGNIVVE* |
| Ga0137404_109560673 | 3300012929 | Vadose Zone Soil | ESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREANIVVE* |
| Ga0137407_102330651 | 3300012930 | Vadose Zone Soil | TGALRRALSDETVRKHYLSMGVEIMDMSRAEFSAYVRADYEKWRTIAREGNIVVE* |
| Ga0137407_115603611 | 3300012930 | Vadose Zone Soil | KALGNEQVKERYRSMGVEIMDMGQPEFAAYVRTDLEKWRKVAREGNIVVE* |
| Ga0137410_101780441 | 3300012944 | Vadose Zone Soil | ERYRSMGVDIMDMSRTEFSAYVRADYEKWRIIAREGDIVVE* |
| Ga0164303_105105932 | 3300012957 | Soil | ASSLKKALANDTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE* |
| Ga0153916_101335454 | 3300012964 | Freshwater Wetlands | VRERYRKMGVDVMDMSASDFAAYVREDYEKWRHIAREANIVIE* |
| Ga0153916_111163082 | 3300012964 | Freshwater Wetlands | RERYRKMGVDVMDMNASDFAAYVRADYEKWRGVARAENIVIE* |
| Ga0126369_129029661 | 3300012971 | Tropical Forest Soil | MGVDVMDMSRDEFTEYVRADYEKWRNIARDGNIVVE* |
| Ga0164309_104666431 | 3300012984 | Soil | RYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE* |
| Ga0134079_103697512 | 3300014166 | Grasslands Soil | PDVRERYRIMGVDVMDMSQPEFAAFVRTDFQKWQKVARDGNISVE* |
| Ga0157377_111013691 | 3300014745 | Miscanthus Rhizosphere | GAALRKAMAGEAVRERYRSMGVEVMDMNQSDFGSYVRADYEKWRRVAREGNIVVE* |
| Ga0157377_112261851 | 3300014745 | Miscanthus Rhizosphere | AALRKGLTNATVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQRVAREGNIVVE* |
| Ga0180096_10089492 | 3300014862 | Soil | AALKNAMSNEGVRERYRAMGVEIMDMGQAEFAAYVRADLEKWKRVAREGNIVIE* |
| Ga0180065_11164831 | 3300014878 | Soil | ERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE* |
| Ga0180082_10693522 | 3300014880 | Soil | ALATDAVRERYKSMGVDVMDMSQPEFAAYVRTDFDKWRKVAKEGNIAVE* |
| Ga0137411_13228393 | 3300015052 | Vadose Zone Soil | VRERYRSMGVDIMDMSRTEFSAYVRADYEKWRIIARQGDIVVE* |
| Ga0137411_13755058 | 3300015052 | Vadose Zone Soil | MGVEVIDMSQPEFAAYVRTDFRKWQKVARDGNISVE* |
| Ga0137405_11442441 | 3300015053 | Vadose Zone Soil | PWAWTSMDMSQPQFAAYVRADFQKWQKVARDGNISVE* |
| Ga0137420_12047661 | 3300015054 | Vadose Zone Soil | VGGDVIDMGRAEFVAYVRADYEKWQRVAREGNIVVE* |
| Ga0173478_103373781 | 3300015201 | Soil | GEAVRERYRSMGVDVMDMAQADFAAFVRADYEKWRRVAREGNIVVE* |
| Ga0137409_103240501 | 3300015245 | Vadose Zone Soil | AADKLYVALRRALSNETVRERYRSMGVEVMDMNRAEFAAYVRADFEKWRTIAREGNIVVE |
| Ga0134069_10186695 | 3300017654 | Grasslands Soil | VGGDEIDMGQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0190266_100545263 | 3300017965 | Soil | AVESVREKYRAMGVEVMEMSQPEFTAYVKTDYEKWRKVARDGNIVVE |
| Ga0190266_113031421 | 3300017965 | Soil | LSASLRKAMSGEAVRERYRSMGVEVMDMGQGDFAAFVRADYEKWQRVAREGNIVVE |
| Ga0184628_103241363 | 3300018083 | Groundwater Sediment | GVDIMEMSQPEFASYVRLDYDKWRRVAKEGNIAVE |
| Ga0184628_105791852 | 3300018083 | Groundwater Sediment | AMAVEAVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE |
| Ga0066655_109991971 | 3300018431 | Grasslands Soil | AALRKALAVESVRERYRGMGVDVMDMGRAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0190270_109259761 | 3300018469 | Soil | FGGMGVEIMDMPQPQFAAYVRTDYDKWQKVAREGNIVIE |
| Ga0190270_114292031 | 3300018469 | Soil | HGALRQALTHEAVRTRYRDMGVEIMDIGRTEFADYVRADYDKWLKVAREGNIVVD |
| Ga0190271_115086401 | 3300018481 | Soil | AVRERFRGMGVELMDMSQPEFTAFVRADFEKWKRVAREGNIVVE |
| Ga0190271_136189133 | 3300018481 | Soil | GVEVMDMAQPEFSAYVRADHEKWRRVAREGNIVVE |
| Ga0193733_10403141 | 3300020022 | Soil | KLYAALRRALSNETVRERYRSMGVDIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE |
| Ga0196963_100409771 | 3300020215 | Soil | ALAAASVKERFQGMGVEIIEMGQAEFASYVRTDFDKWRKVAREGNIVVE |
| Ga0206227_10892772 | 3300021063 | Deep Subsurface Sediment | AVREKYRGMGVEVMDMGQAEFAAFVKTDFEKWRQVAREANIVVE |
| Ga0210379_104447871 | 3300021081 | Groundwater Sediment | RAMGVEIMDMGQAEFAAYVRADFEKWKRVAREGNIVIE |
| Ga0194060_104304491 | 3300021602 | Anoxic Zone Freshwater | ESVRERYRGMGVEIMDMTQSDFAAYVRTDYEKWRSVARDANIVVE |
| Ga0194060_105061482 | 3300021602 | Anoxic Zone Freshwater | SIRERYRSLGVEMMDMSGAEFAAFVRTDAERWRKVAREANIVVE |
| Ga0247686_10143581 | 3300024177 | Soil | ERYRGMGVEIMDSSQAEFAAFVRADLDKWRRVAREGNIVVE |
| Ga0247678_10669992 | 3300024325 | Soil | RERYRSMGVEIIDSSQAEFAAFVRADYEKWRRVAREGNIVVE |
| Ga0209540_102213871 | 3300025888 | Arctic Peat Soil | VRARYHTMGVEIMDMTQAEFAAYVHTDFEKWRQVARDANIVVE |
| Ga0207685_107829702 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | EAVRERYRSMGVDIMDMSRTEFSVYVRADYEKWRIIARQGDIVVE |
| Ga0207645_100950543 | 3300025907 | Miscanthus Rhizosphere | LEKLSVSLGEALTHPTVRERFGGMGVEIMDMGQSEFAAYVRADFDKWRKVAREGNIVVE |
| Ga0207684_116984581 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GGDVIDMGQAEFAAYVRADYEKWQRVAREGSIVVE |
| Ga0207663_110184392 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RERYKSMGVDIMDMSQPDFAAYVRADYDKWRKVAKEGNISVE |
| Ga0207663_112115232 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | ERYRSMGVEIIDSSQAEFAAFVRADLEKWRRVAREGNIVVD |
| Ga0207660_107911881 | 3300025917 | Corn Rhizosphere | AMSSEAVRERYRSMGVEVMDMTQPEFAAYVRADHDKWRRVAREGNIVVE |
| Ga0207706_112842242 | 3300025933 | Corn Rhizosphere | MSSEAVRERYRSMGVEVMDMTQPEFAAYVRADHDKWRRVAREGNIVVE |
| Ga0207686_104583152 | 3300025934 | Miscanthus Rhizosphere | TVRERFGGMGVEIMDMGQSEFAAYVRADFDKWRKVAREGNIVVE |
| Ga0207709_116577702 | 3300025935 | Miscanthus Rhizosphere | ADEGTRGRYLTLGVEMMDMSRAQFAAFVRADYEKWVKVAREANISLE |
| Ga0207679_117867602 | 3300025945 | Corn Rhizosphere | YRQMGVDIMDMSQPQFDAYVRADYRKWQKVARDGHISVD |
| Ga0210070_10182061 | 3300025962 | Natural And Restored Wetlands | ANNTVRERFRSMGVEVMDMSQAEFSAYVLADLQKWRQIAREGNIVIE |
| Ga0208915_10022441 | 3300026048 | Natural And Restored Wetlands | LAMGVQVMDMSQAEFAAYVRADYEKWLKVAREGNIVVE |
| Ga0207675_1021582332 | 3300026118 | Switchgrass Rhizosphere | EAVRERYRGMGVQVMEMTQAEFAAYVRADYDKWLKVARDGNIVVE |
| Ga0209761_11438211 | 3300026313 | Grasslands Soil | LRKALANESIRESYRRVGGDVIDMGQAEFVAYVRADYEKWQRVAREGNIVVE |
| Ga0209152_103443021 | 3300026325 | Soil | RRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0209801_11851513 | 3300026326 | Soil | ALRKALAVESVRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0209801_12980551 | 3300026326 | Soil | RYRAMGVEVIDLGQQEFASYVRADYQKWLKVARESNIVIE |
| Ga0209802_12847933 | 3300026328 | Soil | GSVRESYRRVGGDVIDMGQAEFAAYVRADYEKWQRVAREGNIIVE |
| Ga0209158_12965432 | 3300026333 | Soil | YRSMGVDILDMSRAEFTAYVRADFEKWRTIAREGNIVVE |
| Ga0209057_11140653 | 3300026342 | Soil | LAVESVRERYRGMGVDVMDMSQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0209690_12641122 | 3300026524 | Soil | GVEVMDLGQAQFAAYVRADYEKWLKVAREGNIVIE |
| Ga0209161_100004841 | 3300026548 | Soil | LRKALAVESVRERYRGMGVDVMDMGQAEFAAYVRADYEKWQRVAREGNIVVE |
| Ga0209648_101182873 | 3300026551 | Grasslands Soil | MGVDIMDMSRAEFTAYVRADFEKWRTIAREGNIVVE |
| Ga0207740_10385171 | 3300027011 | Tropical Forest Soil | GVELRDMTQQEFAAYVRADYGKWRTVARDGNITID |
| Ga0207777_10967602 | 3300027330 | Tropical Forest Soil | QAVKKALADRLVRERYLAMGVELRDMTQQEFAAYVRADYGKWRTVARDGNITID |
| Ga0208454_10300043 | 3300027573 | Soil | LQVESVRERYRQMGVELIEMSQPEFAAYVRDDLAKWQRVAREGNIVVE |
| Ga0209971_10317974 | 3300027682 | Arabidopsis Thaliana Rhizosphere | RLSASLRKAMSGEAVRERYRSMGVEVMDMAQAEFAAYVRADYEKWRRVAREGNIVVD |
| Ga0209811_102986331 | 3300027821 | Surface Soil | YRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE |
| Ga0209590_101557641 | 3300027882 | Vadose Zone Soil | DRYRSMGVDVMDMSQAEFAAYVRADFEKWRSIAREGNIVVD |
| Ga0207428_108720371 | 3300027907 | Populus Rhizosphere | GGMGVEIMDMGQAEFAAYVRADYDKWQKVAREGNIVVE |
| Ga0247818_105566962 | 3300028589 | Soil | RKGLTNATVRERFGGMGVEIMDMGQAEFAAYVRADYDKWLKVAREGNIVVE |
| Ga0268298_101987202 | 3300028804 | Activated Sludge | AVREKYAGMGVEVMDMAQPVFADYVRADYEKWRQVAKDAGIVVE |
| Ga0247825_112763701 | 3300028812 | Soil | GVEIMDMGQSEFAAYVHADFEKWRKVAREGGIVVE |
| Ga0307500_101335471 | 3300031198 | Soil | SVSLRKALVNPTVRERFGGMGVEIMDMGQAEFAAYVRADYDKWQRVAHEGNIVVE |
| Ga0307506_104034562 | 3300031366 | Soil | DVRSRYRAMGVDVMQMSQPQFAAYVRTDYQKWQKVARDGNISVE |
| Ga0310886_108047992 | 3300031562 | Soil | EAVREKYRSMGVEVMDMSQADFAAYVKTDFEKWRLVAKERNIVVE |
| Ga0307469_122972552 | 3300031720 | Hardwood Forest Soil | ERDRAMGAEISDMGQAEFDAYVRADLDKWRRVAREANIVIE |
| Ga0306921_104222701 | 3300031912 | Soil | GVDIMDMGRAEFSAYVRADYEKWRTIAREGHIEVE |
| Ga0307416_1034655211 | 3300032002 | Rhizosphere | MDSVRERYRSMGVDILEMSQPDFAAYVRNDYEKWRKVAREGNIVVE |
| Ga0315912_100626561 | 3300032157 | Soil | RAMGVEIMDMGQAQFAAYVHTDFEKWQRVARQGNIVIE |
| Ga0307471_1036582042 | 3300032180 | Hardwood Forest Soil | RYRSMGVEIMDMSRAEFAAYVRADFEKWRTIAREGNIVVE |
| Ga0307471_1043388171 | 3300032180 | Hardwood Forest Soil | EPVRERYRSMGVEVMDMSQSDFAAYVRTDYEKWRRVARDGNIVVE |
| Ga0307472_1015398641 | 3300032205 | Hardwood Forest Soil | ERYRGMGVQVMDMTQAAFAAYVRTDYDKWLKVARDGNIVVE |
| Ga0307472_1025261582 | 3300032205 | Hardwood Forest Soil | KLTGALRRALSEETVRERYRSMGVELMDMSRAEFAAYVRADYEKWRTIAREGNIVVE |
| Ga0335085_104515261 | 3300032770 | Soil | KALQDHTVRERYQAMGVELIETSQPEFAAYVRADYEKWKRVAREGNIVVD |
| Ga0335081_101981591 | 3300032892 | Soil | GVEEMDMNPSEFAAFVRADYEKWRAIARDGNIVVD |
| Ga0316620_100638893 | 3300033480 | Soil | MGVEVMDMNQAEFAAFVRADFEKWRRVARDANIVIE |
| Ga0364929_0050938_3_140 | 3300034149 | Sediment | DTVRERYRSMGVEIIDSSQAEFAAFVRADFEKWRRVAREGNIVVE |
| Ga0364929_0193378_40_186 | 3300034149 | Sediment | MAIEAVRERYRGMGVQVMDMTQAEFAAYVRADYDKWLKVARDGNIVVE |
| Ga0364935_0232189_14_145 | 3300034151 | Sediment | VRERYRAAGSDVLDMTQMEFAAYVRADFEKWKRVAREGNIVIE |
| Ga0364943_0177162_628_774 | 3300034354 | Sediment | LQVESVRERYRQMGVELIEMSQPEFAAYVRDDLEKWRRVAREGNIVVE |
| ⦗Top⦘ |