


| Basic Information | |
|---|---|
| Family ID | F028255 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTDDRYLALLLWTICVLTFACSVVALTEHPEWFGA |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.61 % |
| % of genes near scaffold ends (potentially truncated) | 8.85 % |
| % of genes from short scaffolds (< 2000 bps) | 71.88 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.917 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.479 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (66.667 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 14.58 |
| PF00596 | Aldolase_II | 11.46 |
| PF03401 | TctC | 3.65 |
| PF02826 | 2-Hacid_dh_C | 3.65 |
| PF00248 | Aldo_ket_red | 2.60 |
| PF01494 | FAD_binding_3 | 2.08 |
| PF13450 | NAD_binding_8 | 2.08 |
| PF13561 | adh_short_C2 | 1.56 |
| PF04392 | ABC_sub_bind | 1.56 |
| PF13414 | TPR_11 | 1.56 |
| PF08240 | ADH_N | 1.56 |
| PF00441 | Acyl-CoA_dh_1 | 1.56 |
| PF01019 | G_glu_transpept | 1.04 |
| PF03480 | DctP | 1.04 |
| PF03150 | CCP_MauG | 1.04 |
| PF00890 | FAD_binding_2 | 1.04 |
| PF04715 | Anth_synt_I_N | 1.04 |
| PF08352 | oligo_HPY | 1.04 |
| PF00815 | Histidinol_dh | 1.04 |
| PF01266 | DAO | 1.04 |
| PF01425 | Amidase | 1.04 |
| PF00072 | Response_reg | 0.52 |
| PF13191 | AAA_16 | 0.52 |
| PF12975 | DUF3859 | 0.52 |
| PF08028 | Acyl-CoA_dh_2 | 0.52 |
| PF01469 | Pentapeptide_2 | 0.52 |
| PF12071 | DUF3551 | 0.52 |
| PF14833 | NAD_binding_11 | 0.52 |
| PF00232 | Glyco_hydro_1 | 0.52 |
| PF02775 | TPP_enzyme_C | 0.52 |
| PF11937 | DUF3455 | 0.52 |
| PF15887 | Peptidase_Mx | 0.52 |
| PF01738 | DLH | 0.52 |
| PF16868 | NMT1_3 | 0.52 |
| PF12698 | ABC2_membrane_3 | 0.52 |
| PF00135 | COesterase | 0.52 |
| PF14559 | TPR_19 | 0.52 |
| PF02129 | Peptidase_S15 | 0.52 |
| PF14681 | UPRTase | 0.52 |
| PF00005 | ABC_tran | 0.52 |
| PF13614 | AAA_31 | 0.52 |
| PF04909 | Amidohydro_2 | 0.52 |
| PF00763 | THF_DHG_CYH | 0.52 |
| PF16980 | CitMHS_2 | 0.52 |
| PF02738 | MoCoBD_1 | 0.52 |
| PF08241 | Methyltransf_11 | 0.52 |
| PF13374 | TPR_10 | 0.52 |
| PF07883 | Cupin_2 | 0.52 |
| PF00881 | Nitroreductase | 0.52 |
| PF14026 | DUF4242 | 0.52 |
| PF12974 | Phosphonate-bd | 0.52 |
| PF13442 | Cytochrome_CBB3 | 0.52 |
| PF01544 | CorA | 0.52 |
| PF08530 | PepX_C | 0.52 |
| PF03450 | CO_deh_flav_C | 0.52 |
| PF02882 | THF_DHG_CYH_C | 0.52 |
| PF02653 | BPD_transp_2 | 0.52 |
| PF13924 | Lipocalin_5 | 0.52 |
| PF04143 | Sulf_transp | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 4.17 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.65 |
| COG0147 | Anthranilate/para-aminobenzoate synthases component I | Amino acid transport and metabolism [E] | 2.08 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.08 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 2.08 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 2.08 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.08 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.56 |
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 1.04 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.04 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 1.04 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 1.04 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 1.04 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.52 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.52 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.52 |
| COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.52 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.52 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.52 |
| COG5651 | PPE-repeat protein | Function unknown [S] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.92 % |
| Unclassified | root | N/A | 27.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10001678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 16287 | Open in IMG/M |
| 3300000567|JGI12270J11330_10136199 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101407361 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300004080|Ga0062385_10038525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1980 | Open in IMG/M |
| 3300004080|Ga0062385_10492687 | Not Available | 754 | Open in IMG/M |
| 3300004635|Ga0062388_100905322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300005531|Ga0070738_10000167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 200531 | Open in IMG/M |
| 3300005538|Ga0070731_10000123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 142793 | Open in IMG/M |
| 3300005538|Ga0070731_10050462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2774 | Open in IMG/M |
| 3300005541|Ga0070733_10277158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1106 | Open in IMG/M |
| 3300005591|Ga0070761_11008462 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 528 | Open in IMG/M |
| 3300005602|Ga0070762_10045913 | All Organisms → cellular organisms → Bacteria | 2395 | Open in IMG/M |
| 3300005602|Ga0070762_10294618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300005712|Ga0070764_10888971 | Not Available | 557 | Open in IMG/M |
| 3300005764|Ga0066903_102896326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300005921|Ga0070766_10251964 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300005921|Ga0070766_10280262 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300005921|Ga0070766_10555816 | Not Available | 767 | Open in IMG/M |
| 3300005921|Ga0070766_10761743 | Not Available | 658 | Open in IMG/M |
| 3300006050|Ga0075028_100186398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1114 | Open in IMG/M |
| 3300006059|Ga0075017_101422617 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300006086|Ga0075019_10309309 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300006162|Ga0075030_100495317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 972 | Open in IMG/M |
| 3300006174|Ga0075014_100372159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 772 | Open in IMG/M |
| 3300006176|Ga0070765_100233708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1680 | Open in IMG/M |
| 3300006176|Ga0070765_101540096 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300006176|Ga0070765_102212637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 513 | Open in IMG/M |
| 3300006638|Ga0075522_10074180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1898 | Open in IMG/M |
| 3300006893|Ga0073928_10056099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3512 | Open in IMG/M |
| 3300006893|Ga0073928_10100380 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300006893|Ga0073928_10177562 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300006893|Ga0073928_11091503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
| 3300007982|Ga0102924_1018673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5178 | Open in IMG/M |
| 3300007982|Ga0102924_1242466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300009520|Ga0116214_1455738 | Not Available | 500 | Open in IMG/M |
| 3300009521|Ga0116222_1041705 | Not Available | 2009 | Open in IMG/M |
| 3300009635|Ga0116117_1070922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 861 | Open in IMG/M |
| 3300010048|Ga0126373_12054862 | Not Available | 633 | Open in IMG/M |
| 3300010048|Ga0126373_12567224 | Not Available | 568 | Open in IMG/M |
| 3300010376|Ga0126381_104806607 | Not Available | 519 | Open in IMG/M |
| 3300010379|Ga0136449_100023448 | All Organisms → cellular organisms → Bacteria | 15504 | Open in IMG/M |
| 3300010379|Ga0136449_100206285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3727 | Open in IMG/M |
| 3300010379|Ga0136449_100502103 | Not Available | 2106 | Open in IMG/M |
| 3300010379|Ga0136449_100732089 | All Organisms → cellular organisms → Bacteria | 1651 | Open in IMG/M |
| 3300010379|Ga0136449_102581919 | Not Available | 725 | Open in IMG/M |
| 3300011120|Ga0150983_11976032 | Not Available | 541 | Open in IMG/M |
| 3300011404|Ga0153951_1040569 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300012088|Ga0153944_1084638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 612 | Open in IMG/M |
| 3300012181|Ga0153922_1031182 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300014151|Ga0181539_1001320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 27674 | Open in IMG/M |
| 3300014156|Ga0181518_10579652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 524 | Open in IMG/M |
| 3300014164|Ga0181532_10130519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1532 | Open in IMG/M |
| 3300014169|Ga0181531_10140851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1456 | Open in IMG/M |
| 3300014169|Ga0181531_10269279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1040 | Open in IMG/M |
| 3300014199|Ga0181535_10726271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 564 | Open in IMG/M |
| 3300014200|Ga0181526_10981848 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300014489|Ga0182018_10000080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 113006 | Open in IMG/M |
| 3300014489|Ga0182018_10034616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3183 | Open in IMG/M |
| 3300014489|Ga0182018_10241759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 996 | Open in IMG/M |
| 3300014492|Ga0182013_10000051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 127220 | Open in IMG/M |
| 3300014495|Ga0182015_10080857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2284 | Open in IMG/M |
| 3300014495|Ga0182015_10287496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1078 | Open in IMG/M |
| 3300014495|Ga0182015_10535885 | Not Available | 746 | Open in IMG/M |
| 3300014501|Ga0182024_10256599 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2340 | Open in IMG/M |
| 3300014501|Ga0182024_10552106 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300014501|Ga0182024_10804121 | Not Available | 1145 | Open in IMG/M |
| 3300014501|Ga0182024_10872251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1088 | Open in IMG/M |
| 3300014501|Ga0182024_11814626 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
| 3300014501|Ga0182024_12056541 | Not Available | 630 | Open in IMG/M |
| 3300014501|Ga0182024_12639207 | Not Available | 538 | Open in IMG/M |
| 3300014501|Ga0182024_12941004 | Not Available | 503 | Open in IMG/M |
| 3300015206|Ga0167644_1001746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14595 | Open in IMG/M |
| 3300016422|Ga0182039_10750432 | Not Available | 863 | Open in IMG/M |
| 3300017946|Ga0187879_10210157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1090 | Open in IMG/M |
| 3300017959|Ga0187779_10217461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1200 | Open in IMG/M |
| 3300017961|Ga0187778_10178010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1349 | Open in IMG/M |
| 3300017972|Ga0187781_10489173 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
| 3300017972|Ga0187781_11290076 | Not Available | 538 | Open in IMG/M |
| 3300017973|Ga0187780_10935463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300017974|Ga0187777_10190604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1380 | Open in IMG/M |
| 3300018017|Ga0187872_10317835 | Not Available | 676 | Open in IMG/M |
| 3300018042|Ga0187871_10362201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 801 | Open in IMG/M |
| 3300018042|Ga0187871_10442290 | Not Available | 718 | Open in IMG/M |
| 3300018043|Ga0187887_10916138 | Not Available | 519 | Open in IMG/M |
| 3300018086|Ga0187769_10472594 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300019881|Ga0193707_1148100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300019888|Ga0193751_1059394 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300020580|Ga0210403_10386939 | Not Available | 1143 | Open in IMG/M |
| 3300020580|Ga0210403_10812206 | Not Available | 743 | Open in IMG/M |
| 3300020581|Ga0210399_10037266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3891 | Open in IMG/M |
| 3300020581|Ga0210399_10824700 | Not Available | 756 | Open in IMG/M |
| 3300020582|Ga0210395_10002306 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 14839 | Open in IMG/M |
| 3300020582|Ga0210395_10884966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 664 | Open in IMG/M |
| 3300020582|Ga0210395_11059003 | Not Available | 599 | Open in IMG/M |
| 3300021088|Ga0210404_10135181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1279 | Open in IMG/M |
| 3300021168|Ga0210406_11228552 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
| 3300021170|Ga0210400_10857276 | Not Available | 743 | Open in IMG/M |
| 3300021171|Ga0210405_11236610 | Not Available | 551 | Open in IMG/M |
| 3300021180|Ga0210396_10000034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 316532 | Open in IMG/M |
| 3300021180|Ga0210396_10585616 | Not Available | 971 | Open in IMG/M |
| 3300021401|Ga0210393_10114115 | All Organisms → cellular organisms → Bacteria | 2156 | Open in IMG/M |
| 3300021402|Ga0210385_10434655 | Not Available | 989 | Open in IMG/M |
| 3300021402|Ga0210385_11476637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300021405|Ga0210387_10718552 | Not Available | 885 | Open in IMG/M |
| 3300021420|Ga0210394_10005695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 13870 | Open in IMG/M |
| 3300021420|Ga0210394_10166900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1915 | Open in IMG/M |
| 3300021420|Ga0210394_10927211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 757 | Open in IMG/M |
| 3300021420|Ga0210394_11005456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 722 | Open in IMG/M |
| 3300021433|Ga0210391_10266822 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300021474|Ga0210390_10290276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1385 | Open in IMG/M |
| 3300021474|Ga0210390_11035578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300021477|Ga0210398_11465078 | Not Available | 532 | Open in IMG/M |
| 3300021560|Ga0126371_13365843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 540 | Open in IMG/M |
| 3300021860|Ga0213851_1481930 | Not Available | 506 | Open in IMG/M |
| 3300022523|Ga0242663_1123607 | Not Available | 536 | Open in IMG/M |
| 3300022557|Ga0212123_10244499 | Not Available | 1293 | Open in IMG/M |
| 3300022557|Ga0212123_10792725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 571 | Open in IMG/M |
| 3300022714|Ga0242671_1124881 | Not Available | 511 | Open in IMG/M |
| 3300022716|Ga0242673_1116589 | Not Available | 532 | Open in IMG/M |
| 3300022718|Ga0242675_1119441 | Not Available | 526 | Open in IMG/M |
| 3300022722|Ga0242657_1232365 | Not Available | 522 | Open in IMG/M |
| 3300025134|Ga0207416_1203841 | Not Available | 618 | Open in IMG/M |
| 3300025320|Ga0209171_10094792 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300025320|Ga0209171_10305494 | Not Available | 847 | Open in IMG/M |
| 3300025588|Ga0208586_1081226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 711 | Open in IMG/M |
| 3300025862|Ga0209483_1149361 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300027104|Ga0208095_1011568 | Not Available | 621 | Open in IMG/M |
| 3300027158|Ga0208725_1002218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3413 | Open in IMG/M |
| 3300027370|Ga0209010_1006997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2202 | Open in IMG/M |
| 3300027568|Ga0208042_1016176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1932 | Open in IMG/M |
| 3300027570|Ga0208043_1090102 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300027619|Ga0209330_1146153 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027629|Ga0209422_1002838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4193 | Open in IMG/M |
| 3300027706|Ga0209581_1000170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 200758 | Open in IMG/M |
| 3300027745|Ga0209908_10036678 | Not Available | 1026 | Open in IMG/M |
| 3300027767|Ga0209655_10081069 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300027783|Ga0209448_10000370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15440 | Open in IMG/M |
| 3300027854|Ga0209517_10053799 | Not Available | 3007 | Open in IMG/M |
| 3300027867|Ga0209167_10297502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
| 3300027869|Ga0209579_10000141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 114075 | Open in IMG/M |
| 3300027869|Ga0209579_10126074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1361 | Open in IMG/M |
| 3300027879|Ga0209169_10046428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2265 | Open in IMG/M |
| 3300027889|Ga0209380_10027160 | All Organisms → cellular organisms → Bacteria | 3228 | Open in IMG/M |
| 3300027895|Ga0209624_10067139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2311 | Open in IMG/M |
| 3300027895|Ga0209624_10404511 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 910 | Open in IMG/M |
| 3300027905|Ga0209415_10151185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2333 | Open in IMG/M |
| 3300027908|Ga0209006_10967013 | Not Available | 679 | Open in IMG/M |
| 3300027911|Ga0209698_10395700 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300028906|Ga0308309_10252657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1476 | Open in IMG/M |
| 3300028906|Ga0308309_10405395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1170 | Open in IMG/M |
| 3300028906|Ga0308309_11290741 | Not Available | 628 | Open in IMG/M |
| 3300028906|Ga0308309_11513093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 573 | Open in IMG/M |
| 3300028906|Ga0308309_11885073 | Not Available | 504 | Open in IMG/M |
| 3300029944|Ga0311352_11334041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300029999|Ga0311339_11844179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 524 | Open in IMG/M |
| 3300030007|Ga0311338_11358478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 664 | Open in IMG/M |
| 3300030872|Ga0265723_1010636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300031090|Ga0265760_10360752 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 521 | Open in IMG/M |
| 3300031234|Ga0302325_10718188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1434 | Open in IMG/M |
| 3300031545|Ga0318541_10049636 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
| 3300031708|Ga0310686_105017789 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031708|Ga0310686_108288110 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300031708|Ga0310686_112814076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1317 | Open in IMG/M |
| 3300031708|Ga0310686_114773553 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2094 | Open in IMG/M |
| 3300031708|Ga0310686_114877261 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3676 | Open in IMG/M |
| 3300031941|Ga0310912_10352500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1143 | Open in IMG/M |
| 3300032160|Ga0311301_10055252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 8898 | Open in IMG/M |
| 3300032160|Ga0311301_10276935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2722 | Open in IMG/M |
| 3300032160|Ga0311301_10419927 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
| 3300032160|Ga0311301_10554815 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300032515|Ga0348332_11488983 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1112 | Open in IMG/M |
| 3300032770|Ga0335085_10849987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 999 | Open in IMG/M |
| 3300032783|Ga0335079_10024796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6870 | Open in IMG/M |
| 3300032783|Ga0335079_10025936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6718 | Open in IMG/M |
| 3300032783|Ga0335079_10105877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3183 | Open in IMG/M |
| 3300032783|Ga0335079_10342391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1623 | Open in IMG/M |
| 3300032783|Ga0335079_10524982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1259 | Open in IMG/M |
| 3300032805|Ga0335078_10028157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8336 | Open in IMG/M |
| 3300032805|Ga0335078_10035824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7367 | Open in IMG/M |
| 3300032805|Ga0335078_10237720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 2496 | Open in IMG/M |
| 3300032805|Ga0335078_10951527 | Not Available | 1024 | Open in IMG/M |
| 3300032805|Ga0335078_11051409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 958 | Open in IMG/M |
| 3300032828|Ga0335080_10125027 | All Organisms → cellular organisms → Bacteria | 2854 | Open in IMG/M |
| 3300032892|Ga0335081_10016948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11803 | Open in IMG/M |
| 3300032892|Ga0335081_11298335 | Not Available | 821 | Open in IMG/M |
| 3300032893|Ga0335069_12793482 | Not Available | 500 | Open in IMG/M |
| 3300032895|Ga0335074_10051230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5681 | Open in IMG/M |
| 3300032895|Ga0335074_10247758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2101 | Open in IMG/M |
| 3300032898|Ga0335072_10000899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 51979 | Open in IMG/M |
| 3300033822|Ga0334828_019597 | All Organisms → cellular organisms → Bacteria | 2146 | Open in IMG/M |
| 3300034124|Ga0370483_0259826 | Not Available | 596 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 9.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.85% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 5.73% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.17% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 4.17% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.65% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.12% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 3.12% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.08% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.08% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.56% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.04% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.52% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.52% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.52% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011404 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ035 MetaG | Host-Associated | Open in IMG/M |
| 3300012088 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ028 MetaG | Host-Associated | Open in IMG/M |
| 3300012181 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG | Host-Associated | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022716 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022718 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025134 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025588 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100016784 | 3300000567 | Peatlands Soil | MSDDSYLALLLWTICVLTFACSIVALTEHPEWFGA* |
| JGI12270J11330_101361992 | 3300000567 | Peatlands Soil | MTDENYFAMLVWTICVLMFACSVVALTQHPDWFGA* |
| JGIcombinedJ26739_1014073612 | 3300002245 | Forest Soil | MTDDRYLALLLWTICVLTFACSVVAXTEHPEWFGA* |
| Ga0062385_100385251 | 3300004080 | Bog Forest Soil | MSIALQKAMSDEHYTALLLWTICVLTFACGVVALTEHPEWFGA* |
| Ga0062385_104926872 | 3300004080 | Bog Forest Soil | IAWLSGMNDERYIPLLLWTICVLTFACGIMAITQHPEWFGA* |
| Ga0062388_1009053222 | 3300004635 | Bog Forest Soil | MNDEHYFSLLLWTICVLTFACSVVALTQHPEWFGADETDRAGP |
| Ga0070738_1000016792 | 3300005531 | Surface Soil | VIAAWLAMTDENYTALLLWTICMLVLACGVVALTQHPDWFGA* |
| Ga0070731_10000123116 | 3300005538 | Surface Soil | MTDDLYVTLLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0070731_100504622 | 3300005538 | Surface Soil | MSDESYVSLLVWTICMLLFACGVVALTQHPEWFGA* |
| Ga0070733_102771582 | 3300005541 | Surface Soil | MTDEKYFSLLLWTICLLMFACGVVALTQYPDWFGA* |
| Ga0070761_110084621 | 3300005591 | Soil | MTDEKYVALLVWTICVLMFACGVVALGQHPEWFGA* |
| Ga0070762_100459133 | 3300005602 | Soil | MSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0070762_102946182 | 3300005602 | Soil | MTDDRYLALLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0070764_108889711 | 3300005712 | Soil | MTDDRYLALLLWTICVLTFACSIVALTQHPEWFGA* |
| Ga0066903_1028963262 | 3300005764 | Tropical Forest Soil | MTDDRYFALLIWAICVLSFACGIVALTEHPEWFGA* |
| Ga0070766_102519642 | 3300005921 | Soil | ITIVMSDDRYVALLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0070766_102802622 | 3300005921 | Soil | MSDDRYVALLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0070766_105558162 | 3300005921 | Soil | LHCKKAMSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0070766_107617432 | 3300005921 | Soil | MSDERYLALLLWTICVLLFACSVVVLTEHPEWFGA* |
| Ga0075028_1001863982 | 3300006050 | Watersheds | MTDDRYVTLLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0075017_1014226172 | 3300006059 | Watersheds | MRIAWLSVMNDERYIPLLLWTICVLTFACGIMAITQHPEWFGA* |
| Ga0075019_103093092 | 3300006086 | Watersheds | MSYDRYLTLLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0075030_1004953171 | 3300006162 | Watersheds | MSDDRYLTLLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0075014_1003721592 | 3300006174 | Watersheds | LLRHKVMTDDYYFTILLWTICVLVFACGVTAITEHPEWFGA* |
| Ga0070765_1002337082 | 3300006176 | Soil | MSDDRYLALLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0070765_1015400962 | 3300006176 | Soil | MTDDRYLALLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0070765_1022126371 | 3300006176 | Soil | MNDERYIPILLWTICVLTFACGIMAITQHPEWFGA* |
| Ga0075522_100741802 | 3300006638 | Arctic Peat Soil | MTDDRYLSLLLWTINVLMFACGVVALTQHPEWFGA* |
| Ga0073928_100560993 | 3300006893 | Iron-Sulfur Acid Spring | MRLMTDENYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0073928_101003802 | 3300006893 | Iron-Sulfur Acid Spring | MTDDKYLALLLWTICVLMFACSVVALTEHPEWFGA* |
| Ga0073928_101775622 | 3300006893 | Iron-Sulfur Acid Spring | MSDDNYLTLLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0073928_110915032 | 3300006893 | Iron-Sulfur Acid Spring | MTSEKHLVLLLWTICVLMFACGVVAVTQHPEWFGA* |
| Ga0102924_10186737 | 3300007982 | Iron-Sulfur Acid Spring | MTNENYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0102924_12424661 | 3300007982 | Iron-Sulfur Acid Spring | MTDDHYLSLPLWTISVLMFACGVVALTRHPEWFGA* |
| Ga0116214_14557382 | 3300009520 | Peatlands Soil | MTDENYFAMLVWTICVLMFACGVVALTQQPDWFGA* |
| Ga0116222_10417052 | 3300009521 | Peatlands Soil | MTDENYFAMLVWTICVLMFACGVVALTQHPDWFGA* |
| Ga0116117_10709222 | 3300009635 | Peatland | MTDDNYFAMLVWTICVLMFACGVVALSEHPEWFGA* |
| Ga0126373_120548622 | 3300010048 | Tropical Forest Soil | MSIASPLAMTDENYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0126373_125672242 | 3300010048 | Tropical Forest Soil | MSIASMRLMTDENYTALLLWTICVLTFACGVVALTQHPEWFGA* |
| Ga0126381_1048066072 | 3300010376 | Tropical Forest Soil | MTDERYLTLLLWTICVLLFACSVVAVTEHPEWFGA* |
| Ga0136449_10002344819 | 3300010379 | Peatlands Soil | MSDENYLSLLVWTICVLMFACSVMAITEHPEWFGA* |
| Ga0136449_1002062853 | 3300010379 | Peatlands Soil | MSDERYLTLLLWTIYVLTFACSVVAITEHPEWFGA* |
| Ga0136449_1005021034 | 3300010379 | Peatlands Soil | MSDDRYLTLLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0136449_1007320892 | 3300010379 | Peatlands Soil | MTDDRYVALLLWTICVLTFACSVVAITEHPEWFGA* |
| Ga0136449_1025819192 | 3300010379 | Peatlands Soil | MSDERYVTLLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0150983_119760322 | 3300011120 | Forest Soil | SIALQKAMSDEHYTALLLWTICVLTFACGVVALTEHPEWFGA* |
| Ga0153951_10405692 | 3300011404 | Attine Ant Fungus Gardens | MSEERYLTLLLWTICVLLFACSVVALTEHPEWFGA* |
| Ga0153944_10846382 | 3300012088 | Attine Ant Fungus Gardens | MTDESYFALLVWTICVLMFACGVTALTQHPEWFGA* |
| Ga0153922_10311822 | 3300012181 | Attine Ant Fungus Gardens | CFAGAMSDERYVTLLLWTICMLLFACSIVALTEHPEWFGA* |
| Ga0181539_10013205 | 3300014151 | Bog | MNDDRYVSLLLWTICVLTFACGVMAITQHPDWFGA* |
| Ga0181518_105796522 | 3300014156 | Bog | MTDESYTALLLGTICVLAFACGMVALVQHPEWFGS* |
| Ga0181532_101305192 | 3300014164 | Bog | MNDENYLSLLLWTICVLMFACSVVALTQHPEWFGA* |
| Ga0181531_101408513 | 3300014169 | Bog | MTDDNYFAVLVWTICMLMFACGVVALSEHPEWFGA* |
| Ga0181531_102692792 | 3300014169 | Bog | MNDESYTSLLLWTICVLTFACGVMAVTQHPEWFGA* |
| Ga0181535_107262711 | 3300014199 | Bog | MTDERYLVLLLWTICVLMFACSVVAVTQHPEWFGA* |
| Ga0181526_109818481 | 3300014200 | Bog | MNDDRYVTLLLWTICVLTFACGVMAITQHPDWFGA* |
| Ga0182018_1000008067 | 3300014489 | Palsa | MTDERYLALLLWTICVLVFACSVVALTQHPDWFGA* |
| Ga0182018_100346163 | 3300014489 | Palsa | MSNDRYLPLLLWAICVLMFACSIMAITQHPEWFGA* |
| Ga0182018_102417592 | 3300014489 | Palsa | MTDDRYFTLLLWTICVLAFACSVVALTQHPEWFGA* |
| Ga0182013_1000005154 | 3300014492 | Bog | MKDDHYFFALVWTICVLTFACGVMAITQHPEWFGA* |
| Ga0182015_100808574 | 3300014495 | Palsa | MTDDKYVTLLVWTICVLMFACGVVAISQHPEWFGA* |
| Ga0182015_102874963 | 3300014495 | Palsa | MTDDRYLSLLLWTISVLMFACGVVALTQHPEWFGA* |
| Ga0182015_105358851 | 3300014495 | Palsa | MADDHYFSLLLWTTAVLMFACSVMALTQHPEWFGA* |
| Ga0182024_102565992 | 3300014501 | Permafrost | MTDERYFAMLIWTISVLMFACSVVALTQHPDWFGA* |
| Ga0182024_105521061 | 3300014501 | Permafrost | MSDESYFAVLIWTISVLMFACSVVALTQHPDWFGA* |
| Ga0182024_108041213 | 3300014501 | Permafrost | MTDQRYFSLLLWTISVLMFACGVVALTQHPEWFGA* |
| Ga0182024_108722512 | 3300014501 | Permafrost | MNDEHYTSLLLWMICLLMFACGVMAITQHPEWSGT* |
| Ga0182024_118146262 | 3300014501 | Permafrost | MTDENYFAVLIWTICMLVFACSVVALTQHPDWFGA* |
| Ga0182024_120565412 | 3300014501 | Permafrost | MNDERHFTLLLWTICVLTFACGIVALTQHPDWFGA* |
| Ga0182024_126392072 | 3300014501 | Permafrost | MTEEHYFSLLLWTISVLTFACGVVALTQHPEWFGT* |
| Ga0182024_129410041 | 3300014501 | Permafrost | VLIMTDEHYFSLLLWTICVLTFACSVVALTQHPEWFGA* |
| Ga0167644_10017464 | 3300015206 | Glacier Forefield Soil | MTDEHYFSLLLWTICVLTFACSVVALTEHPEWFGA* |
| Ga0182039_107504322 | 3300016422 | Soil | SVMTDNNYLVLLVWAICVLVFLCGVVALTEHSQWFNA |
| Ga0187879_102101572 | 3300017946 | Peatland | MKDDHYFLALVWTICVLTFACGVMAITQHPEWFGA |
| Ga0187779_102174612 | 3300017959 | Tropical Peatland | MTDDRYFALLIWTICVLSFACGIVALTEHPEWFGA |
| Ga0187778_101780103 | 3300017961 | Tropical Peatland | MTDDRYLALLLWTICVLSFACGIVALTEHPEWFGA |
| Ga0187781_104891733 | 3300017972 | Tropical Peatland | MSDERYLTLLLWTICVLSFACGVAAITQHPEWFGA |
| Ga0187781_112900761 | 3300017972 | Tropical Peatland | MSDEGYLTLLLWTICVLTFACGVAAITQHPEWFGA |
| Ga0187780_109354632 | 3300017973 | Tropical Peatland | MNCSAAGMNEDRELLLLLWMICVLVFACGVVALTQHPEWFGA |
| Ga0187777_101906042 | 3300017974 | Tropical Peatland | MTDDRYFALLIWSICVLSFACGIVALTEHPEWFGA |
| Ga0187872_103178352 | 3300018017 | Peatland | MTEEHYFSLLLWTISVLTFACGVVALTQHPEWFGT |
| Ga0187871_103622011 | 3300018042 | Peatland | MSDDRYLPLLLWAICVLMFACSIMAITQHPEWFGA |
| Ga0187871_104422902 | 3300018042 | Peatland | MADEKYVALLVWTICVLMFACGVVAIAQHPEWFGA |
| Ga0187887_109161382 | 3300018043 | Peatland | MTDESYTALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0187769_104725942 | 3300018086 | Tropical Peatland | MARGLHWSSVMTDDRYLALLLWTICVLAFACSVVALTEHPEWFGA |
| Ga0193707_11481002 | 3300019881 | Soil | MTDERYVTLLLWTICVLLFACSVVALTEHPEWFGA |
| Ga0193751_10593943 | 3300019888 | Soil | MTDDRYLALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0210403_103869393 | 3300020580 | Soil | MSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0210403_108122061 | 3300020580 | Soil | MTDDRYLALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210399_100372663 | 3300020581 | Soil | MTDEHYLSLLLWTISVLMFACSVVALTQHPEWFGAWA |
| Ga0210399_108247002 | 3300020581 | Soil | MSIALQKAMSDEHYTALLLWTICVLTFACGVVALTEHPEWFGA |
| Ga0210395_1000230611 | 3300020582 | Soil | MTDDSYLALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210395_108849662 | 3300020582 | Soil | MADDKYLALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0210395_110590032 | 3300020582 | Soil | MTDDRYLALLLWTICLLTFACSVVALTEHPEWFGA |
| Ga0210404_101351812 | 3300021088 | Soil | MTDDRYFALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210406_112285521 | 3300021168 | Soil | MSDDRYLALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210400_108572761 | 3300021170 | Soil | MSIASRPAMTDEHYTVLLLWTICVLTFACGVVALTEHPEWFGA |
| Ga0210405_112366102 | 3300021171 | Soil | AMTDDRYLALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210396_1000003481 | 3300021180 | Soil | MTDDRYLALLLWTICVLTFACSIVALTEHPEWFGA |
| Ga0210396_105856161 | 3300021180 | Soil | MRLMSDENYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0210393_101141152 | 3300021401 | Soil | MTDEHYLSLLLWTISVLMFACSVVALTQHPEWFGA |
| Ga0210385_104346552 | 3300021402 | Soil | MTDENYVSLLLWTICVLTFACGVVAITQHPEWFGA |
| Ga0210385_114766372 | 3300021402 | Soil | MTDERYMALLLWTICVLMFACSVVAITQHPEWFGA |
| Ga0210387_107185522 | 3300021405 | Soil | MSDENYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0210394_1000569515 | 3300021420 | Soil | MSDENYLSLLVWTICVLMFACSVMAITEHPEWFGA |
| Ga0210394_101669002 | 3300021420 | Soil | MSDDKYLTLLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210394_109272112 | 3300021420 | Soil | MTDESYFALLVWTICVLMFACGVTALTQHPEWFGA |
| Ga0210394_110054562 | 3300021420 | Soil | MTDERYVTLLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0210391_102668221 | 3300021433 | Soil | MTDDRYLALLLWTICVLTFACGVVALTEHPEWFGA |
| Ga0210390_102902762 | 3300021474 | Soil | MAMSDDRYLTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0210390_110355782 | 3300021474 | Soil | VDCIAAGMTEERYMALLLWTICVLMFACSVVAITQHPEWFGA |
| Ga0210398_114650781 | 3300021477 | Soil | MTDESYLALLLGAICLLAFACGMVALTQHPEWFGT |
| Ga0126371_133658432 | 3300021560 | Tropical Forest Soil | MTDERYLTLLLWTICVLLFACSVVAVTEHPEWFGA |
| Ga0213851_14819301 | 3300021860 | Watersheds | MSDERYVTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0242663_11236072 | 3300022523 | Soil | RLHCKKTMSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0212123_102444992 | 3300022557 | Iron-Sulfur Acid Spring | MSDDNYLTLLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0212123_107927252 | 3300022557 | Iron-Sulfur Acid Spring | MTSEKHLVLLLWTICVLMFACGVVAVTQHPEWFGA |
| Ga0242671_11248812 | 3300022714 | Soil | SIALQKAMSDEHYTALLLWTICVLSFACGVVALTEHPEWFGA |
| Ga0242673_11165891 | 3300022716 | Soil | RLHCKKAMSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0242675_11194411 | 3300022718 | Soil | CIAKKAMSDEHYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0242657_12323652 | 3300022722 | Soil | QKAMSDEHYTALLLWTICVLTFACGVVALTEHPEWFGA |
| Ga0207416_12038412 | 3300025134 | Iron-Sulfur Acid Spring | MTDESYTSMLLAAICVLAFACGMLALVQHPEWFGS |
| Ga0209171_100947921 | 3300025320 | Iron-Sulfur Acid Spring | MRLMTDENYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0209171_103054942 | 3300025320 | Iron-Sulfur Acid Spring | MTDDKYLALLLWTICVLMFACSVVALTEHPEWFGA |
| Ga0208586_10812262 | 3300025588 | Arctic Peat Soil | MTDDRYLSLLLWTISVLMFACGVVALTQHPEWFGA |
| Ga0209483_11493612 | 3300025862 | Arctic Peat Soil | MTDDRYLSLLLWTINVLMFACGVVALTQHPEWFGA |
| Ga0208095_10115681 | 3300027104 | Forest Soil | MTDERYLALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0208725_10022182 | 3300027158 | Forest Soil | MTDESYVSLLLWTICVLMFACGVMAITEHPDWFGA |
| Ga0209010_10069971 | 3300027370 | Forest Soil | MTDDSYVALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0208042_10161762 | 3300027568 | Peatlands Soil | MSDDSYLALLLWTICVLTFACSIVALTEHPEWFGA |
| Ga0208043_10901021 | 3300027570 | Peatlands Soil | MTDENYFAMLVWTICVLMFACGVVALTQHPDWFGA |
| Ga0209330_11461532 | 3300027619 | Forest Soil | MSEERYLALLLWTICVLLFACSVVALTEHPEWFGA |
| Ga0209422_10028381 | 3300027629 | Forest Soil | MADDEHFVLLLWTIFVLMFACSVVALTEHPEWFGA |
| Ga0209581_100017087 | 3300027706 | Surface Soil | VIAAWLAMTDENYTALLLWTICMLVLACGVVALTQHPDWFGA |
| Ga0209908_100366781 | 3300027745 | Thawing Permafrost | MTDERYLALLLWTICVLVFACSVVALTQHPDWFGA |
| Ga0209655_100810691 | 3300027767 | Bog Forest Soil | VVMTDEHYLSLLLWTISVLMFACSVVALTQHPEWFGA |
| Ga0209448_100003702 | 3300027783 | Bog Forest Soil | MTDENYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0209517_100537993 | 3300027854 | Peatlands Soil | MTDENYFAMLVWTICVLMFACSVVALTQHPDWFGA |
| Ga0209167_102975022 | 3300027867 | Surface Soil | MTDEKYFSLLLWTICLLMFACGVVALTQYPDWFGA |
| Ga0209579_1000014122 | 3300027869 | Surface Soil | MTDDLYVTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0209579_101260742 | 3300027869 | Surface Soil | MSDESYVSLLVWTICMLLFACGVVALTQHPEWFGA |
| Ga0209169_100464284 | 3300027879 | Soil | MTDERYVTLLLWTICVLLFACSIVALTEHPEWFGA |
| Ga0209380_100271604 | 3300027889 | Soil | MSDDRYVALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0209624_100671394 | 3300027895 | Forest Soil | MNDDRYLPLLLWAICVLMFACSVMAITQHPEWFGA |
| Ga0209624_104045111 | 3300027895 | Forest Soil | MNDDRYLPLLLWAICVLMFACSIMAITQHPEWFGA |
| Ga0209415_101511852 | 3300027905 | Peatlands Soil | MTDENYFAMLIWTICVLMFACGVVALTQHPDWFGA |
| Ga0209006_109670132 | 3300027908 | Forest Soil | MTDDLYVTLLLWTVCVLTFACSVVAITEHPEWFGA |
| Ga0209698_103957002 | 3300027911 | Watersheds | MSDDRYLTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0308309_102526572 | 3300028906 | Soil | MDCIERYMTDDERHLVLLIWTICVLMFACGVVAITEHPEWFGA |
| Ga0308309_104053952 | 3300028906 | Soil | MTDDRYFPLLLWTICVLMFACGVMAITQHPEWFGA |
| Ga0308309_112907411 | 3300028906 | Soil | MTDDRYFTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0308309_115130932 | 3300028906 | Soil | MSDDRYFALLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0308309_118850732 | 3300028906 | Soil | MSDDRYLALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0311352_113340412 | 3300029944 | Palsa | MNDDHYFSLLLWTICVLTFACSVVALTQHPEWFGA |
| Ga0311339_118441792 | 3300029999 | Palsa | MNDERYTSLLLWTICVLMFACGVMAVTQHPEWFGA |
| Ga0311338_113584782 | 3300030007 | Palsa | MNDDSYFAVLVWTICVLMFACGVVALTEHPEWFGA |
| Ga0265723_10106361 | 3300030872 | Soil | MTDDRYLALLLWTICVLTFACSVVAIAEHPEWFGA |
| Ga0265760_103607521 | 3300031090 | Soil | MTDEKYVALLVWTICVLMLACGVVALGQHPEWFGA |
| Ga0302325_107181883 | 3300031234 | Palsa | VTCFITGMNDDRYLPLLLWAICVLMFACSIMAITQHPEWFGA |
| Ga0318541_100496363 | 3300031545 | Soil | MTDDRYFALLIWAICVLSFACGIVALTEHPEWFGA |
| Ga0310686_1050177891 | 3300031708 | Soil | MTDDRYFTLLLWTICVLMFACSVVALTEHPEWFGA |
| Ga0310686_1082881102 | 3300031708 | Soil | MSDDRYVTLLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0310686_1128140763 | 3300031708 | Soil | MTDENYVAALIWTICMLMFACSVVALTQHPDWFGA |
| Ga0310686_1147735534 | 3300031708 | Soil | MTDDSYLALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0310686_1148772613 | 3300031708 | Soil | MTDENYVSLLLWTICVLMFACGVMAIMEHPDWFGA |
| Ga0306925_118654931 | 3300031890 | Soil | ALAVMTDENYLLLLVWTICTLMFACSVVAFTQHPGWFGA |
| Ga0310912_103525002 | 3300031941 | Soil | MTDDRYFALLIWAICVLSFACGIAALTEHPEWFGA |
| Ga0311301_100552526 | 3300032160 | Peatlands Soil | MSDDRYLTLLLWTICVLTFACSVVALTEHPEWFGA |
| Ga0311301_102769353 | 3300032160 | Peatlands Soil | MSDERYLTLLLWTIYVLTFACSVVAITEHPEWFGA |
| Ga0311301_104199272 | 3300032160 | Peatlands Soil | MSDDRYVALLMWTICVLTFACSVVALTEHPEWFGA |
| Ga0311301_105548152 | 3300032160 | Peatlands Soil | MTDDRYVALLLWTICVLTFACSVVAITEHPEWFGA |
| Ga0348332_114889831 | 3300032515 | Plant Litter | MTDDRYLALLLWTICVLMFACSVVALTEHPEWFGA |
| Ga0335085_108499872 | 3300032770 | Soil | MTDDRYFALLIWTICVLSFACSVLALTEHPEWFGA |
| Ga0335079_100247962 | 3300032783 | Soil | MEAAMSDETYVTLLLWTICTLTFACGVVALTEHPEWFGS |
| Ga0335079_100259365 | 3300032783 | Soil | MNCKIAGMSEDHEFSLLLWTICILVFACGVVALTQHPEWFGA |
| Ga0335079_101058774 | 3300032783 | Soil | MRAMTDENYVSLLLWTICVLMFACGVVAITEHPSWFGA |
| Ga0335079_103423912 | 3300032783 | Soil | MTDDRYFALLIWTICVLTFACSVLALTEHPEWFGA |
| Ga0335079_105249822 | 3300032783 | Soil | MTDDAYVTLLLWTICVLMFACGVVALTEHPGWFGA |
| Ga0335078_1002815710 | 3300032805 | Soil | MPVMTDENYFTLLVWTICVLMFACGVVALTEHPEWFGT |
| Ga0335078_100358244 | 3300032805 | Soil | MTDDRYVSLLVWTICVLMFACGVVAITQHPEWFGT |
| Ga0335078_102377202 | 3300032805 | Soil | MTDENYLSILLVWTICVLLFACGVVALTEHPEWFGGS |
| Ga0335078_109515271 | 3300032805 | Soil | FTRAMTDENYLSILLVWTICVLLFACGVVALTEHPEWFGGS |
| Ga0335078_110514092 | 3300032805 | Soil | MSIALLLVMTDESYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0335080_101250273 | 3300032828 | Soil | MTDDRYFALLLWTICVLTFACSVLALTEHPEWFGA |
| Ga0335081_1001694811 | 3300032892 | Soil | MTDDRYLALLIWTICVLSFACSVLALTEHPEWFGA |
| Ga0335081_112983352 | 3300032892 | Soil | MTDDRYFALLIWTICVLSFACSVLVLTEHPEWFGA |
| Ga0335069_127934822 | 3300032893 | Soil | MDDDSYVAVLLWTICVLVFACGVVALTQHPDWFGA |
| Ga0335074_100512302 | 3300032895 | Soil | MTDERYVTLLLWTICVLMFACGVVALTEHPQWFGA |
| Ga0335074_102477582 | 3300032895 | Soil | MTDDRYLSLLVWTICVLMFACGVVAITQHPEWFGA |
| Ga0335072_1000089944 | 3300032898 | Soil | MSIALQLVMTDESYTALLLWTICVLTFACGVVALTQHPEWFGA |
| Ga0334828_019597_322_429 | 3300033822 | Soil | MKDDHYFFALVWTICVLTFACGVMAITQHPEWFGA |
| Ga0370483_0259826_464_571 | 3300034124 | Untreated Peat Soil | MTDDKYVTLLVWTICVLMFACGVVAISQHPEWFGA |
| ⦗Top⦘ |