


| Basic Information | |
|---|---|
| Family ID | F028189 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 192 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKN |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 60.94 % |
| % of genes near scaffold ends (potentially truncated) | 20.31 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (41.667 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (30.208 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.271 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.625 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.82% β-sheet: 0.00% Coil/Unstructured: 64.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF08291 | Peptidase_M15_3 | 14.06 |
| PF00149 | Metallophos | 2.08 |
| PF00589 | Phage_integrase | 2.08 |
| PF04404 | ERF | 1.56 |
| PF01726 | LexA_DNA_bind | 1.56 |
| PF11171 | DUF2958 | 0.52 |
| PF08401 | ArdcN | 0.52 |
| PF16778 | Phage_tail_APC | 0.52 |
| PF01381 | HTH_3 | 0.52 |
| PF13884 | Peptidase_S74 | 0.52 |
| PF13392 | HNH_3 | 0.52 |
| PF11651 | P22_CoatProtein | 0.52 |
| PF00476 | DNA_pol_A | 0.52 |
| PF11351 | GTA_holin_3TM | 0.52 |
| PF00507 | Oxidored_q4 | 0.52 |
| PF01510 | Amidase_2 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG0749 | DNA polymerase I, 3'-5' exonuclease and polymerase domains | Replication, recombination and repair [L] | 0.52 |
| COG0838 | NADH:ubiquinone oxidoreductase subunit 3 (chain A) | Energy production and conversion [C] | 0.52 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 63.54 % |
| Unclassified | root | N/A | 36.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10003299 | Not Available | 9225 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10051073 | All Organisms → Viruses → Predicted Viral | 1810 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10154598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 781 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10029716 | All Organisms → cellular organisms → Bacteria | 2684 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10098009 | Not Available | 1083 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10141349 | Not Available | 808 | Open in IMG/M |
| 3300001354|JGI20155J14468_10053892 | Not Available | 1679 | Open in IMG/M |
| 3300001355|JGI20158J14315_10029718 | All Organisms → Viruses → Predicted Viral | 2599 | Open in IMG/M |
| 3300001450|JGI24006J15134_10059722 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300001460|JGI24003J15210_10017133 | Not Available | 2815 | Open in IMG/M |
| 3300001460|JGI24003J15210_10022545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2379 | Open in IMG/M |
| 3300001472|JGI24004J15324_10116253 | Not Available | 662 | Open in IMG/M |
| 3300001943|GOS2226_1022796 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1825 | Open in IMG/M |
| 3300001952|GOS2224_1027834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1425 | Open in IMG/M |
| 3300006025|Ga0075474_10024682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 2152 | Open in IMG/M |
| 3300006025|Ga0075474_10074249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1121 | Open in IMG/M |
| 3300006026|Ga0075478_10003703 | All Organisms → cellular organisms → Bacteria | 5478 | Open in IMG/M |
| 3300006026|Ga0075478_10018292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2370 | Open in IMG/M |
| 3300006026|Ga0075478_10037502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1606 | Open in IMG/M |
| 3300006026|Ga0075478_10206423 | Not Available | 599 | Open in IMG/M |
| 3300006026|Ga0075478_10250787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 530 | Open in IMG/M |
| 3300006027|Ga0075462_10008181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 3395 | Open in IMG/M |
| 3300006357|Ga0075502_1602845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 721 | Open in IMG/M |
| 3300006404|Ga0075515_10856022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 847 | Open in IMG/M |
| 3300006404|Ga0075515_10957602 | Not Available | 508 | Open in IMG/M |
| 3300006735|Ga0098038_1022368 | Not Available | 2398 | Open in IMG/M |
| 3300006735|Ga0098038_1202728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 641 | Open in IMG/M |
| 3300006737|Ga0098037_1011745 | All Organisms → Viruses → Predicted Viral | 3382 | Open in IMG/M |
| 3300006737|Ga0098037_1203398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 647 | Open in IMG/M |
| 3300006749|Ga0098042_1044043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1227 | Open in IMG/M |
| 3300006749|Ga0098042_1100640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 733 | Open in IMG/M |
| 3300006802|Ga0070749_10181488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1212 | Open in IMG/M |
| 3300006802|Ga0070749_10408214 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 749 | Open in IMG/M |
| 3300006802|Ga0070749_10632998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 575 | Open in IMG/M |
| 3300006810|Ga0070754_10019172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 4042 | Open in IMG/M |
| 3300006810|Ga0070754_10028079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 3180 | Open in IMG/M |
| 3300006810|Ga0070754_10080606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1642 | Open in IMG/M |
| 3300006810|Ga0070754_10179366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 997 | Open in IMG/M |
| 3300006810|Ga0070754_10506978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 519 | Open in IMG/M |
| 3300006868|Ga0075481_10050904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 1585 | Open in IMG/M |
| 3300006870|Ga0075479_10357437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 568 | Open in IMG/M |
| 3300006916|Ga0070750_10000250 | Not Available | 29586 | Open in IMG/M |
| 3300006916|Ga0070750_10085970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 1471 | Open in IMG/M |
| 3300006919|Ga0070746_10085902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1586 | Open in IMG/M |
| 3300006919|Ga0070746_10091887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1523 | Open in IMG/M |
| 3300006919|Ga0070746_10179329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Pelagibacter phage HTVC010P | 1018 | Open in IMG/M |
| 3300006928|Ga0098041_1287641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 523 | Open in IMG/M |
| 3300007236|Ga0075463_10010222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 3129 | Open in IMG/M |
| 3300007344|Ga0070745_1188725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 766 | Open in IMG/M |
| 3300007538|Ga0099851_1094243 | Not Available | 1144 | Open in IMG/M |
| 3300007539|Ga0099849_1068144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1456 | Open in IMG/M |
| 3300007540|Ga0099847_1028371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1802 | Open in IMG/M |
| 3300007541|Ga0099848_1013320 | All Organisms → Viruses → Predicted Viral | 3598 | Open in IMG/M |
| 3300007541|Ga0099848_1022598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 2672 | Open in IMG/M |
| 3300008012|Ga0075480_10136923 | Not Available | 1341 | Open in IMG/M |
| 3300009000|Ga0102960_1068445 | Not Available | 1302 | Open in IMG/M |
| 3300009000|Ga0102960_1073756 | All Organisms → Viruses → Predicted Viral | 1250 | Open in IMG/M |
| 3300009000|Ga0102960_1249046 | Not Available | 629 | Open in IMG/M |
| 3300009001|Ga0102963_1036506 | All Organisms → Viruses → Predicted Viral | 2047 | Open in IMG/M |
| 3300009001|Ga0102963_1101583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 1172 | Open in IMG/M |
| 3300009027|Ga0102957_1009283 | Not Available | 3353 | Open in IMG/M |
| 3300009071|Ga0115566_10066800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 2386 | Open in IMG/M |
| 3300009071|Ga0115566_10194963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 1240 | Open in IMG/M |
| 3300009193|Ga0115551_1526907 | Not Available | 502 | Open in IMG/M |
| 3300009420|Ga0114994_10566476 | Not Available | 746 | Open in IMG/M |
| 3300009433|Ga0115545_1299514 | Not Available | 534 | Open in IMG/M |
| 3300009449|Ga0115558_1277257 | Not Available | 672 | Open in IMG/M |
| 3300009472|Ga0115554_1320086 | Not Available | 612 | Open in IMG/M |
| 3300009508|Ga0115567_10134916 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300010296|Ga0129348_1114050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 947 | Open in IMG/M |
| 3300010296|Ga0129348_1285322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 552 | Open in IMG/M |
| 3300010297|Ga0129345_1129817 | Not Available | 918 | Open in IMG/M |
| 3300010299|Ga0129342_1136915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 900 | Open in IMG/M |
| 3300010316|Ga0136655_1211338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 577 | Open in IMG/M |
| 3300012920|Ga0160423_10020113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 5027 | Open in IMG/M |
| 3300012920|Ga0160423_10095818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Fussvirus → Fussvirus S30C28 | 2102 | Open in IMG/M |
| 3300017697|Ga0180120_10009827 | All Organisms → cellular organisms → Bacteria | 4616 | Open in IMG/M |
| 3300017697|Ga0180120_10185509 | Not Available | 868 | Open in IMG/M |
| 3300017697|Ga0180120_10454015 | Not Available | 500 | Open in IMG/M |
| 3300017717|Ga0181404_1061653 | Not Available | 937 | Open in IMG/M |
| 3300017719|Ga0181390_1028432 | Not Available | 1768 | Open in IMG/M |
| 3300017719|Ga0181390_1058435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1113 | Open in IMG/M |
| 3300017720|Ga0181383_1155831 | Not Available | 613 | Open in IMG/M |
| 3300017738|Ga0181428_1151400 | Not Available | 542 | Open in IMG/M |
| 3300017739|Ga0181433_1064016 | Not Available | 922 | Open in IMG/M |
| 3300017743|Ga0181402_1122202 | Not Available | 666 | Open in IMG/M |
| 3300017746|Ga0181389_1057219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1126 | Open in IMG/M |
| 3300017746|Ga0181389_1127133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 688 | Open in IMG/M |
| 3300017763|Ga0181410_1157581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 636 | Open in IMG/M |
| 3300017765|Ga0181413_1072179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 1059 | Open in IMG/M |
| 3300017772|Ga0181430_1222137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 536 | Open in IMG/M |
| 3300017773|Ga0181386_1220782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 565 | Open in IMG/M |
| 3300017818|Ga0181565_10200991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1370 | Open in IMG/M |
| 3300017824|Ga0181552_10017117 | All Organisms → Viruses → Predicted Viral | 4598 | Open in IMG/M |
| 3300017824|Ga0181552_10101243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1596 | Open in IMG/M |
| 3300017824|Ga0181552_10233107 | Not Available | 934 | Open in IMG/M |
| 3300017824|Ga0181552_10322637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 756 | Open in IMG/M |
| 3300017949|Ga0181584_10493504 | Not Available | 754 | Open in IMG/M |
| 3300017950|Ga0181607_10128958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1559 | Open in IMG/M |
| 3300017950|Ga0181607_10358115 | Not Available | 805 | Open in IMG/M |
| 3300017967|Ga0181590_11057183 | Not Available | 527 | Open in IMG/M |
| 3300017968|Ga0181587_10819272 | Not Available | 580 | Open in IMG/M |
| 3300017986|Ga0181569_10659778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 695 | Open in IMG/M |
| 3300018036|Ga0181600_10152878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1281 | Open in IMG/M |
| 3300018036|Ga0181600_10428178 | Not Available | 638 | Open in IMG/M |
| 3300018048|Ga0181606_10083834 | Not Available | 2048 | Open in IMG/M |
| 3300018048|Ga0181606_10199453 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300018048|Ga0181606_10215797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter giovannonii | 1105 | Open in IMG/M |
| 3300018049|Ga0181572_10373908 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 894 | Open in IMG/M |
| 3300018049|Ga0181572_10908151 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 521 | Open in IMG/M |
| 3300018410|Ga0181561_10193027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1005 | Open in IMG/M |
| 3300018416|Ga0181553_10032316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 3683 | Open in IMG/M |
| 3300018417|Ga0181558_10171745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1267 | Open in IMG/M |
| 3300018876|Ga0181564_10145866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Pelagivirus → Pelagibacter virus HTVC019P → Pelagibacter phage HTVC019P | 1423 | Open in IMG/M |
| 3300019751|Ga0194029_1019719 | Not Available | 1024 | Open in IMG/M |
| 3300019756|Ga0194023_1103014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 577 | Open in IMG/M |
| 3300019765|Ga0194024_1028390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1210 | Open in IMG/M |
| 3300020053|Ga0181595_10125915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1212 | Open in IMG/M |
| 3300020173|Ga0181602_10158556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1039 | Open in IMG/M |
| 3300020175|Ga0206124_10274132 | Not Available | 649 | Open in IMG/M |
| 3300020191|Ga0181604_10093900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1624 | Open in IMG/M |
| 3300020240|Ga0211494_1062366 | Not Available | 741 | Open in IMG/M |
| 3300021335|Ga0213867_1019319 | All Organisms → Viruses | 2799 | Open in IMG/M |
| 3300021335|Ga0213867_1046411 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300021347|Ga0213862_10001098 | Not Available | 11355 | Open in IMG/M |
| 3300021389|Ga0213868_10119937 | Not Available | 1667 | Open in IMG/M |
| 3300021957|Ga0222717_10044393 | Not Available | 2898 | Open in IMG/M |
| 3300021957|Ga0222717_10049261 | Not Available | 2737 | Open in IMG/M |
| 3300021957|Ga0222717_10272968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 975 | Open in IMG/M |
| 3300021958|Ga0222718_10031239 | All Organisms → Viruses → Predicted Viral | 3561 | Open in IMG/M |
| 3300021958|Ga0222718_10070005 | All Organisms → Viruses → Predicted Viral | 2149 | Open in IMG/M |
| 3300021958|Ga0222718_10101345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 1696 | Open in IMG/M |
| 3300021958|Ga0222718_10125927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1475 | Open in IMG/M |
| 3300021958|Ga0222718_10255144 | Not Available | 929 | Open in IMG/M |
| 3300021958|Ga0222718_10299754 | Not Available | 835 | Open in IMG/M |
| 3300021959|Ga0222716_10022988 | Not Available | 4613 | Open in IMG/M |
| 3300021960|Ga0222715_10512506 | Not Available | 635 | Open in IMG/M |
| 3300021964|Ga0222719_10063028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2792 | Open in IMG/M |
| 3300022057|Ga0212025_1060257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 656 | Open in IMG/M |
| 3300022176|Ga0212031_1018699 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1063 | Open in IMG/M |
| 3300022187|Ga0196899_1194301 | Not Available | 540 | Open in IMG/M |
| 3300022921|Ga0255765_1289004 | Not Available | 659 | Open in IMG/M |
| (restricted) 3300022933|Ga0233427_10348219 | Not Available | 609 | Open in IMG/M |
| 3300023176|Ga0255772_10445258 | Not Available | 640 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10046808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 2239 | Open in IMG/M |
| 3300025083|Ga0208791_1036406 | Not Available | 907 | Open in IMG/M |
| 3300025086|Ga0208157_1034408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1443 | Open in IMG/M |
| 3300025098|Ga0208434_1090845 | All Organisms → Viruses | 609 | Open in IMG/M |
| 3300025120|Ga0209535_1001246 | Not Available | 17461 | Open in IMG/M |
| 3300025120|Ga0209535_1019670 | All Organisms → cellular organisms → Bacteria | 3457 | Open in IMG/M |
| 3300025137|Ga0209336_10148950 | Not Available | 620 | Open in IMG/M |
| 3300025137|Ga0209336_10167678 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 567 | Open in IMG/M |
| 3300025137|Ga0209336_10171573 | All Organisms → Viruses | 556 | Open in IMG/M |
| 3300025138|Ga0209634_1074513 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300025508|Ga0208148_1006271 | All Organisms → cellular organisms → Bacteria | 3843 | Open in IMG/M |
| 3300025610|Ga0208149_1011979 | Not Available | 2615 | Open in IMG/M |
| 3300025610|Ga0208149_1074068 | Not Available | 846 | Open in IMG/M |
| 3300025610|Ga0208149_1152308 | Not Available | 527 | Open in IMG/M |
| 3300025636|Ga0209136_1129540 | Not Available | 688 | Open in IMG/M |
| 3300025652|Ga0208134_1027407 | All Organisms → Viruses | 2045 | Open in IMG/M |
| 3300025652|Ga0208134_1158593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 562 | Open in IMG/M |
| 3300025653|Ga0208428_1205531 | Not Available | 502 | Open in IMG/M |
| 3300025671|Ga0208898_1017893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 3236 | Open in IMG/M |
| 3300025671|Ga0208898_1045625 | All Organisms → Viruses → Predicted Viral | 1637 | Open in IMG/M |
| 3300025671|Ga0208898_1177947 | All Organisms → Viruses | 540 | Open in IMG/M |
| 3300025674|Ga0208162_1144085 | Not Available | 659 | Open in IMG/M |
| 3300025695|Ga0209653_1001324 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae | 20162 | Open in IMG/M |
| 3300025751|Ga0208150_1057977 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 1310 | Open in IMG/M |
| 3300025759|Ga0208899_1045972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1905 | Open in IMG/M |
| 3300025767|Ga0209137_1000592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P | 37790 | Open in IMG/M |
| 3300025769|Ga0208767_1027842 | All Organisms → Viruses | 2978 | Open in IMG/M |
| 3300025769|Ga0208767_1233356 | All Organisms → Viruses | 589 | Open in IMG/M |
| 3300025769|Ga0208767_1261124 | All Organisms → Viruses | 533 | Open in IMG/M |
| 3300025771|Ga0208427_1053008 | All Organisms → Viruses → Predicted Viral | 1490 | Open in IMG/M |
| 3300025810|Ga0208543_1002902 | Not Available | 4593 | Open in IMG/M |
| 3300025840|Ga0208917_1226839 | Not Available | 610 | Open in IMG/M |
| 3300025853|Ga0208645_1060083 | All Organisms → Viruses → Predicted Viral | 1759 | Open in IMG/M |
| 3300025869|Ga0209308_10134556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 1153 | Open in IMG/M |
| 3300025869|Ga0209308_10282274 | Not Available | 700 | Open in IMG/M |
| 3300025879|Ga0209555_10294964 | Not Available | 622 | Open in IMG/M |
| 3300025886|Ga0209632_10533002 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 529 | Open in IMG/M |
| 3300025889|Ga0208644_1340449 | All Organisms → Viruses | 577 | Open in IMG/M |
| 3300025890|Ga0209631_10030052 | Not Available | 3979 | Open in IMG/M |
| 3300025890|Ga0209631_10413666 | Not Available | 622 | Open in IMG/M |
| 3300026138|Ga0209951_1042656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 982 | Open in IMG/M |
| 3300026183|Ga0209932_1079871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Stopavirus → Pelagibacter virus HTVC011P → Pelagibacter phage HTVC011P | 746 | Open in IMG/M |
| 3300026187|Ga0209929_1004121 | Not Available | 5055 | Open in IMG/M |
| 3300026187|Ga0209929_1057311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 1089 | Open in IMG/M |
| 3300026187|Ga0209929_1130452 | Not Available | 628 | Open in IMG/M |
| 3300029319|Ga0183748_1008009 | Not Available | 4649 | Open in IMG/M |
| 3300032257|Ga0316205_10176894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C582 | 814 | Open in IMG/M |
| 3300032277|Ga0316202_10119499 | Not Available | 1222 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 30.21% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.06% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 10.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.77% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.25% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 5.73% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.17% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.12% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.12% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.60% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.08% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.56% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.04% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.04% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.04% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.04% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
| 3300001952 | Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006357 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006404 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018410 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020240 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982) | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
| 3300022921 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG | Environmental | Open in IMG/M |
| 3300022933 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300026138 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300032257 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrite | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_1000329911 | 3300000116 | Marine | MIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKRNKKK* |
| DelMOSpr2010_100510735 | 3300000116 | Marine | MIDKLIYKFLNFLDNSFAKVEEVLTFDFPNCKKKKKKK* |
| DelMOSpr2010_101545982 | 3300000116 | Marine | MIDRFIYKFFAWIDDCFKKVDDVLTFDWPNCKKRNKKK* |
| DelMOWin2010_100297164 | 3300000117 | Marine | MIDKIIYKFLAWIDDCFKKVDDVLTFDWPNCKKKKKTKKK* |
| DelMOWin2010_100980093 | 3300000117 | Marine | MIDRLIYKFFAWIDDCFQKVDDVLTFDWPNCKKRKKKK* |
| DelMOWin2010_101413494 | 3300000117 | Marine | MIDKLIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK* |
| JGI20155J14468_100538923 | 3300001354 | Pelagic Marine | VIDKFIYKFLGFIDDAFARVDKVMTFDFPNCKKKKIKKDERH* |
| JGI20158J14315_100297184 | 3300001355 | Pelagic Marine | MIDKLIYKFLKFLDKFFAKVEEILTFDFPNCKKKKKKK* |
| JGI24006J15134_100597225 | 3300001450 | Marine | VIDKFIYKFLGIIDDAFARVDEVMTFDFPNCKKKKKDDEQKN* |
| JGI24003J15210_100171336 | 3300001460 | Marine | MIDKFIYKFLGFIDDAFAKVDEVMTFDFPNCKNKKNEKK* |
| JGI24003J15210_100225453 | 3300001460 | Marine | VIDKFIYKFLSIIDDAFARVDEVMTFDFPNCKKKKKDDEQKN* |
| JGI24004J15324_101162533 | 3300001472 | Marine | VIDKFIYKFLGFIDDAFAKVDDVMTFDFPNCKKKKKDDEQKN* |
| GOS2226_10227965 | 3300001943 | Marine | MIDKIFYKLFSSIDKMFMKVEEVLTFNWPNCKKKKKK* |
| GOS2224_10278345 | 3300001952 | Marine | FFGFIDEAFAKVDEVMTFDFPNCKKKKKEDEQKNK* |
| Ga0075474_100246824 | 3300006025 | Aqueous | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVTKNERHKDIGKI* |
| Ga0075474_100742492 | 3300006025 | Aqueous | MIDRLIYKFFSWIDDCFKKVDDVLTFDWPNCKKRKKKK* |
| Ga0075478_1000370315 | 3300006026 | Aqueous | VIDKFIYKFLGFIDDAFARVEEVMTFDFPNCKNKKKDDEQKN* |
| Ga0075478_100182924 | 3300006026 | Aqueous | MIDKYIYKFFGFIDEAFAKVDEVMTFDFPNCKKKKKEDEQKNK* |
| Ga0075478_100375025 | 3300006026 | Aqueous | VIDKFIYKFLGFIDDAFARVDEVMTFDFPNCKKKKDDEQKNK* |
| Ga0075478_102064232 | 3300006026 | Aqueous | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKNIR* |
| Ga0075478_102507872 | 3300006026 | Aqueous | MIDKYIYKFFGFIDEAFKKVDEVMTFDFPNCKKKKKDDEQKNK* |
| Ga0075462_100081816 | 3300006027 | Aqueous | MIDRFFYKLFSSIDNMFMKVEEVLTFNWPNCKKKKKK* |
| Ga0075502_16028453 | 3300006357 | Aqueous | MIDKYLYKFFGFVDSIFEKVDEVLTFDFPKSKKKKK* |
| Ga0075515_108560224 | 3300006404 | Aqueous | MIDKYIYKFFGLVDDLFEMVDEVLTFDFPNCKKNKKKDERH* |
| Ga0075515_109576022 | 3300006404 | Aqueous | MIDKYLYKFFGFVDSIFERVDEVLTFNFPNCKKKKKK* |
| Ga0098038_10223686 | 3300006735 | Marine | VIDKFIYKFLGFIDDAFAKVEEVMTFDFPNCKKKKIKKDERH* |
| Ga0098038_12027283 | 3300006735 | Marine | MIDKYIYKFLSFIDGAFAKVDEVMTFDFPNCKKKKKDDEQKNK* |
| Ga0098037_10117457 | 3300006737 | Marine | MIDKFCYKIFGFLDKMLAKVDEVLTFDFPNCKKKKKK* |
| Ga0098037_12033983 | 3300006737 | Marine | VIDKFIYKFLSFIDDAFARVDEVMTFDFPNCKKEKVKKNERHKDIR* |
| Ga0098042_10440431 | 3300006749 | Marine | MIDKFVYWFFSKIDDLSHKLDDVLTFDFPNCKKKKR |
| Ga0098042_11006401 | 3300006749 | Marine | RNKNMIDKICYKLFGFLDKMLAKVDEVLTFDFPNCKKKKKK* |
| Ga0070749_101814883 | 3300006802 | Aqueous | MIDKYLYKFFGFIDDLFEKVDEVLTFDFPNCKKKKKKNERR* |
| Ga0070749_104082144 | 3300006802 | Aqueous | MMDKYLYKFFGFIDDLFAKVDEVLTFDFPNCKKKKKKNERR* |
| Ga0070749_106329981 | 3300006802 | Aqueous | EMIDRLIYSFFGRIDKLFSKVDEVLTFDFPNCKKKKRK* |
| Ga0070754_100191727 | 3300006810 | Aqueous | MIDKLIYKFLNFLDNSFAKVEKVLTFDFPNCKKKKKKK* |
| Ga0070754_100280794 | 3300006810 | Aqueous | MIDRFFYKLFSSIDSMFMKVEEVLTFNWPNCKKKKKK* |
| Ga0070754_100806063 | 3300006810 | Aqueous | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKNERHKDIR* |
| Ga0070754_101793664 | 3300006810 | Aqueous | MIDKYLYKFFGLVDSIFERVDEVLTFDFPNCKKKKKKK* |
| Ga0070754_105069781 | 3300006810 | Aqueous | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVTKNERHKDIRKI* |
| Ga0075481_100509045 | 3300006868 | Aqueous | MIDKYLYKFFSFVDSIFEKVDEVLTFNFPNCKKKKKK* |
| Ga0075479_103574373 | 3300006870 | Aqueous | MIDKYIYKFFGFIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKNIR* |
| Ga0070750_100002505 | 3300006916 | Aqueous | MIDKFFYKFFSSIDKLFMKVEEILTFDFPNCKKKKKK* |
| Ga0070750_100859701 | 3300006916 | Aqueous | KLNMIDRFFYKLFSSIDNMFMKVEEVLTFNWPNCKKKKKK* |
| Ga0070746_100859027 | 3300006919 | Aqueous | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVT |
| Ga0070746_100918874 | 3300006919 | Aqueous | MIDKYLYKFFGFIDDLFAKVDEVLTFDFPNCKKKKKKNERR* |
| Ga0070746_101793291 | 3300006919 | Aqueous | MIDRWIYKFFESIDKLFMKVEEVLTFDWPNCKKKKKKK* |
| Ga0098041_12876412 | 3300006928 | Marine | MIDKICYKLFGFLDKMLAKVDEVLTFDFPNCKKKKKK* |
| Ga0075463_100102222 | 3300007236 | Aqueous | MIDRFFYKLFSSIDNMFMKVEEVLSFNWPNCKKKKKK* |
| Ga0070745_11887252 | 3300007344 | Aqueous | FLGFIDDAFARVEEVMTFDFPNCKNKKKDDEQKN* |
| Ga0099851_10942434 | 3300007538 | Aqueous | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVT |
| Ga0099849_10681446 | 3300007539 | Aqueous | MMDKYLYKFFGFIDDMFAKVDEVLTFDFPNCKKKKKKNERR* |
| Ga0099847_10283717 | 3300007540 | Aqueous | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKKKNERR* |
| Ga0099848_10133204 | 3300007541 | Aqueous | MIDKLFYKFFSFVDSIFEKIDEVLTFNFPNCKKKKKK* |
| Ga0099848_10225981 | 3300007541 | Aqueous | MDKYLYKFFGFIDDMFAKVDEVLTFDFPKNKKKKKK* |
| Ga0075480_101369234 | 3300008012 | Aqueous | VIDKFIYKFLGFIDDAFARVDEVMTFDFPNYKKKKKEDEQKN* |
| Ga0102960_10684455 | 3300009000 | Pond Water | MIDRLIYKFFAWIDDCFQKVDDVLTFDWPNCKKKKKKK* |
| Ga0102960_10737565 | 3300009000 | Pond Water | MIDKIIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK* |
| Ga0102960_12490463 | 3300009000 | Pond Water | MIDRYLYKFFGFIDSIFEKVDEVLTFNFPKDKKRKKK* |
| Ga0102963_10365065 | 3300009001 | Pond Water | MIDKFLYKFFGFVDSIFEKVDEVLTFNFPNCKKKKKK* |
| Ga0102963_11015834 | 3300009001 | Pond Water | MIDRYLYKFFGFIDSIFERVDEVLTFNFPKDKKRKKK* |
| Ga0102957_10092838 | 3300009027 | Pond Water | MIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKKKKKK* |
| Ga0115566_100668004 | 3300009071 | Pelagic Marine | MIDSWIYKFFESIDKLFMKVEEVLTFDWPNCKKKKKKK* |
| Ga0115566_101949634 | 3300009071 | Pelagic Marine | MIDRWIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK* |
| Ga0115551_15269073 | 3300009193 | Pelagic Marine | MIDRWIYKFFESIDKLFMKVEEVLTFDWPNCKKKKK |
| Ga0114994_105664761 | 3300009420 | Marine | MIDKFFYKLFSFIDDAFAKVDEVFTFDFPNCKKKKKDDEQKN* |
| Ga0115545_12995143 | 3300009433 | Pelagic Marine | VIDKFIYKFLGFIDDAFARVDEVMTFDFPNCKKKKIKKDERH* |
| Ga0115558_12772574 | 3300009449 | Pelagic Marine | MIDRFFYKLFSSIDNMFMKVEEVLTFNWPNCKKKKK |
| Ga0115554_13200864 | 3300009472 | Pelagic Marine | MIDRWIYKFFENIDKLFMKVEEVLTFDWPNCKKKKKKK* |
| Ga0115567_101349164 | 3300009508 | Pelagic Marine | MIDRWLYKFFEGLDNIFLKVEEVLTFDWPNCKKKKKKK* |
| Ga0129348_11140501 | 3300010296 | Freshwater To Marine Saline Gradient | RSSMIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKRNKKK* |
| Ga0129348_12853223 | 3300010296 | Freshwater To Marine Saline Gradient | MMDKYLYKFFGFIDDMFAKVDEVLTFDFPNCKKKKKKNE |
| Ga0129345_11298174 | 3300010297 | Freshwater To Marine Saline Gradient | MIDKYLYKFFGFIDDLFEKVDEVLTFDFPNCKKKKKKNE |
| Ga0129342_11369153 | 3300010299 | Freshwater To Marine Saline Gradient | MIDKYLYKFFGFVDSIFERVDEVLTFNFPKDKKRKKK* |
| Ga0136655_12113383 | 3300010316 | Freshwater To Marine Saline Gradient | MIDKYLYKFFGFIDDLFEKVDEVLTFDFPNCKKKKVTKNERHKDIGKI* |
| Ga0160423_100201133 | 3300012920 | Surface Seawater | MIDRWIYKFCDFIDRFFEKVEEVFTFDWPNCKKKKKNKK* |
| Ga0160423_100958182 | 3300012920 | Surface Seawater | MIDKFFYKLFGSIDRLFMKVEQALTLDFPNCKKKKKK* |
| Ga0180120_100098273 | 3300017697 | Freshwater To Marine Saline Gradient | MIDRLIYKFFAWIDDCFQKVDDVLTFDWPNCKKRKKKK |
| Ga0180120_101855094 | 3300017697 | Freshwater To Marine Saline Gradient | WNTNIMIDKLIYKFLNFLDNSFAKVEEVLTFDFPNCKKKKVTKNERHKDIGKI |
| Ga0180120_104540153 | 3300017697 | Freshwater To Marine Saline Gradient | MIDKLIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK |
| Ga0181404_10616532 | 3300017717 | Seawater | MIDKICYKLFGFLDKMLAKVDEVLTFDFPNCKKKKRK |
| Ga0181390_10284323 | 3300017719 | Seawater | MIDKFIYKFFGFIDDAFTKVDEVLTFDFPNCKKKKIKKDERH |
| Ga0181390_10584353 | 3300017719 | Seawater | MIDKFIYKFLGFIDDTFARVDEVMTFDFPNCKKKVNKNERHKDIR |
| Ga0181383_11558311 | 3300017720 | Seawater | KFIYKFLGFIDDAFAKVDEVMTFDFPNCKKKKIKKDERH |
| Ga0181428_11514003 | 3300017738 | Seawater | VIDKFIYKFLGIIDDAFARVDEVMTFDFPNCKKKKIKKDERH |
| Ga0181433_10640164 | 3300017739 | Seawater | IDKFIYKFLGFIDDAFAKVDEVMTFDFPNCKKKKIKKDERH |
| Ga0181402_11222021 | 3300017743 | Seawater | FIYKFLGIIDDAFARVDEVMTFDFPNCKKKKKDDEQKN |
| Ga0181389_10572192 | 3300017746 | Seawater | MIDRFFYKLFSSIDKLFMKVEEVLTFDWPNCKKKKKKK |
| Ga0181389_11271333 | 3300017746 | Seawater | MIDKFIYKFFGFIDDAFTKVDEVLTFDFPNCKKKKKDDEQKN |
| Ga0181410_11575813 | 3300017763 | Seawater | RFFYKLFSSIDKLFMKVEEVLTFDWPNCKKKKKKK |
| Ga0181413_10721793 | 3300017765 | Seawater | MIDKFFYKFFSSIDKLFMKVEEVLTFDWPNCKKKKKKK |
| Ga0181430_12221373 | 3300017772 | Seawater | VIDKFIYKFLGFIDDTFARVDEVMTFDFPNCKKKKVN |
| Ga0181386_12207821 | 3300017773 | Seawater | MIDKFIYKFFGFIDDAFTKVDEVLTFDFPNCKKKVNKNERHKDIR |
| Ga0181565_102009915 | 3300017818 | Salt Marsh | MIDKLIYKFLSFIDKLFMKVEEVLTFNFPNCKKKKKK |
| Ga0181552_100171173 | 3300017824 | Salt Marsh | MIDKIFYKLFSSIDKMFMKVEEVLTFNWPNCKKKKKK |
| Ga0181552_101012433 | 3300017824 | Salt Marsh | MIDRLIYSFFGRIDKLFSKVDEVLTFDFPNCKKKKRK |
| Ga0181552_102331072 | 3300017824 | Salt Marsh | MIDKYLYKFFGFVDSIFERVDEVLTFNFPNCKKKKKK |
| Ga0181552_103226373 | 3300017824 | Salt Marsh | MIDKYISKFFGLVDDLFEMVDEVLTFDFPNCKKKKKKDERH |
| Ga0181584_104935044 | 3300017949 | Salt Marsh | MIDKFLYKFFGFVDSIFERVDEVLTFNFPNCKKKKKK |
| Ga0181607_101289583 | 3300017950 | Salt Marsh | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKNERHKDIR |
| Ga0181607_103581151 | 3300017950 | Salt Marsh | ENMIDKYLYKFFGFIDDMFAKVDEVLTFNFPKNKKKQKKDERH |
| Ga0181590_110571832 | 3300017967 | Salt Marsh | MIDKYISKFFGLVDDLFEMVDEVLTFDFPNCKKNKKNKKKDERH |
| Ga0181587_108192723 | 3300017968 | Salt Marsh | MIDKFLYKFFGFVDSIFERVDEVLTFNFPNSKKKKKK |
| Ga0181569_106597781 | 3300017986 | Salt Marsh | MIDKYIYKFFGFIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKDIR |
| Ga0181600_101528783 | 3300018036 | Salt Marsh | MIDKYIYKFFGLVDDLFEMVDEVLTFDFPNCKKKKKKDERH |
| Ga0181600_104281782 | 3300018036 | Salt Marsh | MIDKIFYKLFSSIDKMFMKVEEVLTFNFPNCKKKKKK |
| Ga0181606_100838341 | 3300018048 | Salt Marsh | MIDKYIYKFFGLIDDAFAKGDEVLTFDFPNCKKKKVTKK |
| Ga0181606_101994531 | 3300018048 | Salt Marsh | MIDKYLYKFFGFVDSIFERVDEVLTFNFPNSKKKKKK |
| Ga0181606_102157974 | 3300018048 | Salt Marsh | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVTKK |
| Ga0181572_103739083 | 3300018049 | Salt Marsh | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKV |
| Ga0181572_109081512 | 3300018049 | Salt Marsh | MIDKYLYKFFGFIDDLFEKVDEVLTFDFPNCKKKKKKNERR |
| Ga0181561_101930274 | 3300018410 | Salt Marsh | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKDIR |
| Ga0181553_100323162 | 3300018416 | Salt Marsh | MIDKIFYKLFSSIDKMFMKVEEVLTFNWPNYKKKKKK |
| Ga0181558_101717451 | 3300018417 | Salt Marsh | KLNMIDKIFYKLFSSIDKMFMKVEEVLTFNWPNCKKKKKK |
| Ga0181564_101458662 | 3300018876 | Salt Marsh | MMDKLIYSFFGWIDSLFEKLDEVLTFDFPNSNKKKKKKK |
| Ga0194029_10197192 | 3300019751 | Freshwater | MIDKYIYKFFGFIDEAFAKVDEVMTFDFPNCKKKKKEDEQKNK |
| Ga0194023_11030143 | 3300019756 | Freshwater | MIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKKKKXNQL |
| Ga0194024_10283903 | 3300019765 | Freshwater | MIDKYIYKFFGLVDDLFEMVDEVLTFDFPNCKKKKVTKNERHKDIGKI |
| Ga0181595_101259153 | 3300020053 | Salt Marsh | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKK |
| Ga0181602_101585563 | 3300020173 | Salt Marsh | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKKXETQRY |
| Ga0206124_102741321 | 3300020175 | Seawater | MIDRWIYKFFESIDNMFLKLDEVLTFDFPNCKKKRKKK |
| Ga0181604_100939003 | 3300020191 | Salt Marsh | MIDKYIYKFFGFIDEAFAKVDEVLTFDFPNCKKKKVTKK |
| Ga0211494_10623663 | 3300020240 | Marine | MIDKYIYKFLSFIDDAFKKVDEVMTFDFPNCKKKKNKKDERH |
| Ga0213867_10193194 | 3300021335 | Seawater | MIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKRNKKK |
| Ga0213867_10464114 | 3300021335 | Seawater | MIDKLIYKFLNFLDNSFAKVEEVLTFDFPNCKKKKKKK |
| Ga0213862_1000109819 | 3300021347 | Seawater | MIDKYIYKFFGFIDDAFAKVDEVLTFDFPNCKKKNKKDERH |
| Ga0213868_101199372 | 3300021389 | Seawater | MIDKIIYKFLAWIDDCFEKVDDVLTFDWPNCKKKKKTKKK |
| Ga0222717_100443932 | 3300021957 | Estuarine Water | MIDRLIYKFFAWIDDCFEKVDDVLTFDWPNCKKKKKTKKK |
| Ga0222717_100492612 | 3300021957 | Estuarine Water | MIDRLIYKFFAWIDDCFAKVDDVLTFDWPNCKKKKKKK |
| Ga0222717_102729684 | 3300021957 | Estuarine Water | MIDRFFYKLFSSIDKLFMKVEEVLTFDFPNCKKKKKK |
| Ga0222718_100312396 | 3300021958 | Estuarine Water | MIDRWIYKFFEGLDNIFLKVEEVLTFDWPNCKKKKKKK |
| Ga0222718_100700054 | 3300021958 | Estuarine Water | MIDKFLYKFFGFVDSIFEKVDEVLTFNFPNCKKKKKK |
| Ga0222718_101013454 | 3300021958 | Estuarine Water | MIDRYLYKFFGFIDSIFEKVDEVLTFNFPKDKKRKKK |
| Ga0222718_101259274 | 3300021958 | Estuarine Water | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVTKNERHKDIGKI |
| Ga0222718_102551444 | 3300021958 | Estuarine Water | MIDKIIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK |
| Ga0222718_102997545 | 3300021958 | Estuarine Water | MIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKN |
| Ga0222716_100229881 | 3300021959 | Estuarine Water | MIDKFFYKLFSLIDNAFQKVDDVLTFDWPNCKKKKKTKKK |
| Ga0222715_105125062 | 3300021960 | Estuarine Water | MIDKFFYKFFSSIDKLFMKVEEVLTFDFPNCKKKKKK |
| Ga0222719_100630287 | 3300021964 | Estuarine Water | MIDKYLYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVTKNERHKDIGKI |
| Ga0212025_10602571 | 3300022057 | Aqueous | MIDKYIYKFFGLVDDLFEKVDEVLTFDFPNCKKKKVTKNERH |
| Ga0212031_10186993 | 3300022176 | Aqueous | MMDKYLYKFFGFIDDMFAKVDEVLTFDFPNCKKKKKKNERR |
| Ga0196899_11943012 | 3300022187 | Aqueous | KFFGFIDEAFAKVDEVMTFDFPNCKKKKKEDEQKNK |
| Ga0255765_12890044 | 3300022921 | Salt Marsh | RWQMIDKYIYKFFGLIDDAFAKVDEVLTFDFPNCKKKKVTKNERHKDIR |
| (restricted) Ga0233427_103482192 | 3300022933 | Seawater | MIDKFFYKFFGSIDKLFMKVEEVLTFDFPNCKKKKKK |
| Ga0255772_104452584 | 3300023176 | Salt Marsh | MIDKFLYKFFGFVDSIFERVDEVLTFNFPNCKKKKK |
| (restricted) Ga0233438_100468084 | 3300024255 | Seawater | MIDKLIYKFLKFLDKFFAKVEEILTFDFPNCKKKKKKK |
| Ga0208791_10364063 | 3300025083 | Marine | VIDKFIYKFLGFIDDAFAKVEEVMTFDFPNCKKKKIKKDERH |
| Ga0208157_10344083 | 3300025086 | Marine | MIDKFCYKIFGFLDKMLAKVDEVLTFDFPNCKKKKKK |
| Ga0208434_10908451 | 3300025098 | Marine | IQRRWQVIDKFIYKFLGFIDDAFARVDKVMTFDFPNCKKKKVNKNERHKDIR |
| Ga0209535_10012469 | 3300025120 | Marine | VIDKFIYKFLGFIDDAFAKVDEVMTFDFPNCKNKKNEKK |
| Ga0209535_10196705 | 3300025120 | Marine | VIDKFIYKFLSIIDDAFARVDEVMTFDFPNCKKKKKDDEQKN |
| Ga0209336_101489503 | 3300025137 | Marine | VIDKFIYKFLGIIDDAFARVDEVMTFDFPNCKKKKKKDEQKN |
| Ga0209336_101676781 | 3300025137 | Marine | MIDKFFYKIFGFLDNMLARVDEVFTFNFPKSKKSK |
| Ga0209336_101715732 | 3300025137 | Marine | MIDKFIYKFLGFIDDAFAKVDEVMTFDFPNCKNKKNEKK |
| Ga0209634_10745136 | 3300025138 | Marine | VIDKFIYKFLGIIDDAFARVDEVMTFDFPNCKKKKKDDEQKN |
| Ga0208148_10062714 | 3300025508 | Aqueous | VIDKFIYKFLGFIDDAFARVEEVMTFDFPNCKNKKKDDEQKN |
| Ga0208149_10119792 | 3300025610 | Aqueous | MIDRLIYKFFSWIDDCFKKVDDVLTFDWPNCKKRKKKK |
| Ga0208149_10740682 | 3300025610 | Aqueous | MIDKYIYKFFGFIDEAFKKVDEVMTFDFPNCKKKKKDDEQKNK |
| Ga0208149_11523081 | 3300025610 | Aqueous | RRWQMIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKNIR |
| Ga0209136_11295403 | 3300025636 | Marine | MIDRWIYKFFESIDNLFVKVEEVLTFDWPNCKKKKKKK |
| Ga0208134_10274077 | 3300025652 | Aqueous | VIDKFIYKFLGFIDDAFARVDEVMTFDFPNCKKKKDDEQKNK |
| Ga0208134_11585931 | 3300025652 | Aqueous | ARSSMIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKRNKKK |
| Ga0208428_12055312 | 3300025653 | Aqueous | MIDKYLYKFFGFVDSIFERVDEVLTFDFPNCKKKKKKK |
| Ga0208898_10178934 | 3300025671 | Aqueous | MIDRFFYKLFSSIDNMFMKVEEVLTFNWPNCKKKKKK |
| Ga0208898_10456253 | 3300025671 | Aqueous | MIDKYLYKFFSFVDSIFEKVDEVLTFNFPNCKKKKKK |
| Ga0208898_11779473 | 3300025671 | Aqueous | MIDKYLYKFFGFIDDLFEKVDEVLTFDFPNCKKKK |
| Ga0208162_11440853 | 3300025674 | Aqueous | MIDKFFYKFFSSIDKLFMKVEEILTFDFPNCKKKKKK |
| Ga0209653_10013247 | 3300025695 | Marine | MIDKFFYKFFGFVDSIFERVDEVLTFNFPNCKKKKKK |
| Ga0208150_10579775 | 3300025751 | Aqueous | MIDKYIYKFFGLVDNLFEKVDEVLTFDFPNCKKKKVTKNERHKDIGKI |
| Ga0208899_10459724 | 3300025759 | Aqueous | MIDKYIYKFFGFIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKNIR |
| Ga0209137_100059230 | 3300025767 | Marine | MIDRYLYKFFGFIDSIFERVDEVLTFNFPKDKKRKKK |
| Ga0208767_10278424 | 3300025769 | Aqueous | MIDKYIYKFFGLIDEAFAKVDEVLTFDFPNCKKKKVTKNERHKNIR |
| Ga0208767_12333561 | 3300025769 | Aqueous | MIDKYIYKFFGLVDDLFEMVDEVLTFDFPNCKKNKKKDERH |
| Ga0208767_12611241 | 3300025769 | Aqueous | TKLIMIDKFFYKLFSSIDNLFMKVEEVLTFNWPNCKKKKKKK |
| Ga0208427_10530085 | 3300025771 | Aqueous | MIDKYLYKFFGLVDSIFERVDEVLTFDFPNCKKKKKKK |
| Ga0208543_10029023 | 3300025810 | Aqueous | MIDRLIYKFFAWIDDCFQKVDDVLTFDWPNCKKRNKKK |
| Ga0208917_12268391 | 3300025840 | Aqueous | RRWQMIDKYIYKFFGLVDDLFEMVDEVLTFDFPNCKKNKKKDERH |
| Ga0208645_10600831 | 3300025853 | Aqueous | MIDKLIYKFLNFLDNSFAKVEKVLTFDFPNCKKKKKKK |
| Ga0209308_101345564 | 3300025869 | Pelagic Marine | MIDSWIYKFFESIDKLFMKVEEVLTFDWPNCKKKKKKK |
| Ga0209308_102822742 | 3300025869 | Pelagic Marine | MIDRWIYKFFESIDNMFLKLDEVLTFDFPNCKKKKKKK |
| Ga0209555_102949643 | 3300025879 | Marine | MIDKFLYKFFGFIDSIFERVDEVLTFNFPNCKKKKKK |
| Ga0209632_105330023 | 3300025886 | Pelagic Marine | MIDRYIYKFLGLIDDMFEKVDDVLTFDFPNCKKKKVRKNERHKDIR |
| Ga0208644_13404494 | 3300025889 | Aqueous | EMIDRLIYSFFGRIDKLFSKVDEVLTFDFPNCKKKKRK |
| Ga0209631_100300528 | 3300025890 | Pelagic Marine | MIDRWIYKFFESIDKLFMKVEEVLTFDWPNCKKKKKKK |
| Ga0209631_104136663 | 3300025890 | Pelagic Marine | VIDKFIYKFLGFIDDAFAKVDEVMTFDFPNCKKKKIKKDERH |
| Ga0209951_10426563 | 3300026138 | Pond Water | MIDRLIYKFFAWIDDCFKKVDDVLTFDWPNCKKKKKKK |
| Ga0209932_10798713 | 3300026183 | Pond Water | MIDRYLYKFFGFIDSIFEKVDEVLTFNFPKDKKRKKKXTLNGI |
| Ga0209929_10041218 | 3300026187 | Pond Water | MIDKFLYKFFGFVDSIFEKVDEVLTFNFPNCKKKKKKXILNMI |
| Ga0209929_10573113 | 3300026187 | Pond Water | MIDRLIYKFFAWIDDCFQKVDDVLTFDWPNCKKKKKKK |
| Ga0209929_11304522 | 3300026187 | Pond Water | MIDRYLYKFFGFIDSIFERVDEVLTFNFPKDKKRKKKXTLNGI |
| Ga0183748_10080097 | 3300029319 | Marine | MIDKFVYWFFSKIDDLSNKVDIVLTFDFPNCKKKKRK |
| Ga0316205_101768941 | 3300032257 | Microbial Mat | DRLIYKFFSWIDDCFKKVDDVLTFDWPNCKKKKKKK |
| Ga0316202_101194994 | 3300032277 | Microbial Mat | VIDKFIYKFLGIIDDAFARVDEVMTFDFPNCKKKKKEDEQKN |
| ⦗Top⦘ |