


| Basic Information | |
|---|---|
| Family ID | F028105 |
| Family Type | Metagenome |
| Number of Sequences | 192 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 192 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.50 % |
| % of genes near scaffold ends (potentially truncated) | 96.88 % |
| % of genes from short scaffolds (< 2000 bps) | 92.71 % |
| Associated GOLD sequencing projects | 116 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.833 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.542 % of family members) |
| Environment Ontology (ENVO) | Unclassified (60.417 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.042 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 192 Family Scaffolds |
|---|---|---|
| PF13936 | HTH_38 | 26.56 |
| PF04392 | ABC_sub_bind | 15.62 |
| PF00119 | ATP-synt_A | 2.60 |
| PF12802 | MarR_2 | 2.08 |
| PF00149 | Metallophos | 1.04 |
| PF13505 | OMP_b-brl | 1.04 |
| PF02771 | Acyl-CoA_dh_N | 0.52 |
| PF13582 | Reprolysin_3 | 0.52 |
| PF13302 | Acetyltransf_3 | 0.52 |
| PF01494 | FAD_binding_3 | 0.52 |
| PF00211 | Guanylate_cyc | 0.52 |
| PF06035 | Peptidase_C93 | 0.52 |
| PF09361 | Phasin_2 | 0.52 |
| PF13185 | GAF_2 | 0.52 |
| PF00313 | CSD | 0.52 |
| PF07676 | PD40 | 0.52 |
| PF07976 | Phe_hydrox_dim | 0.52 |
| PF12840 | HTH_20 | 0.52 |
| PF13844 | Glyco_transf_41 | 0.52 |
| PF03602 | Cons_hypoth95 | 0.52 |
| PF08241 | Methyltransf_11 | 0.52 |
| PF01650 | Peptidase_C13 | 0.52 |
| PF07883 | Cupin_2 | 0.52 |
| PF13557 | Phenol_MetA_deg | 0.52 |
| PF00171 | Aldedh | 0.52 |
| PF09849 | DUF2076 | 0.52 |
| PF13577 | SnoaL_4 | 0.52 |
| PF13924 | Lipocalin_5 | 0.52 |
| PF06240 | COXG | 0.52 |
| PF11695 | DUF3291 | 0.52 |
| PF00668 | Condensation | 0.52 |
| PF13411 | MerR_1 | 0.52 |
| PF00106 | adh_short | 0.52 |
| PF06441 | EHN | 0.52 |
| PF07452 | CHRD | 0.52 |
| PF12862 | ANAPC5 | 0.52 |
| PF00034 | Cytochrom_C | 0.52 |
| PF00702 | Hydrolase | 0.52 |
| PF13336 | AcetylCoA_hyd_C | 0.52 |
| PF00856 | SET | 0.52 |
| PF00571 | CBS | 0.52 |
| PF04430 | DUF498 | 0.52 |
| PF05598 | DUF772 | 0.52 |
| PF04879 | Molybdop_Fe4S4 | 0.52 |
| PF13493 | DUF4118 | 0.52 |
| PF01042 | Ribonuc_L-PSP | 0.52 |
| PF01546 | Peptidase_M20 | 0.52 |
| PF16576 | HlyD_D23 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 192 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 15.62 |
| COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 2.60 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.04 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.52 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.52 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.52 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.52 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.52 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.52 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.52 |
| COG1020 | EntF, seryl-AMP synthase component of non-ribosomal peptide synthetase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1504 | Uncharacterized conserved protein, DUF498 domain | Function unknown [S] | 0.52 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.52 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.52 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.52 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.52 |
| COG3672 | Predicted transglutaminase-like protein | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG3737 | Uncharacterized protein, contains Mth938-like domain | Function unknown [S] | 0.52 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.52 |
| COG5206 | Glycosylphosphatidylinositol transamidase (GPIT), subunit GPI8 | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.83 % |
| Unclassified | root | N/A | 29.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000660|JGI12415J11908_10135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 832 | Open in IMG/M |
| 3300004633|Ga0066395_10861504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. LNHC220B00 | 547 | Open in IMG/M |
| 3300005332|Ga0066388_100142202 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300005332|Ga0066388_100548976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1785 | Open in IMG/M |
| 3300005332|Ga0066388_101069679 | Not Available | 1361 | Open in IMG/M |
| 3300005332|Ga0066388_101909410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
| 3300005332|Ga0066388_102776329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium hipponense | 894 | Open in IMG/M |
| 3300005332|Ga0066388_103351668 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005332|Ga0066388_105438844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 645 | Open in IMG/M |
| 3300005764|Ga0066903_104766839 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300005764|Ga0066903_105901357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
| 3300005764|Ga0066903_106139031 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005764|Ga0066903_106945174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300006028|Ga0070717_12083743 | Not Available | 510 | Open in IMG/M |
| 3300006046|Ga0066652_101027955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 781 | Open in IMG/M |
| 3300006102|Ga0075015_100545899 | Not Available | 673 | Open in IMG/M |
| 3300006845|Ga0075421_102042291 | Not Available | 609 | Open in IMG/M |
| 3300006846|Ga0075430_100480978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1024 | Open in IMG/M |
| 3300006880|Ga0075429_100503400 | Not Available | 1061 | Open in IMG/M |
| 3300012957|Ga0164303_10225789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300012960|Ga0164301_10037117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2388 | Open in IMG/M |
| 3300012961|Ga0164302_11881450 | Not Available | 508 | Open in IMG/M |
| 3300014308|Ga0075354_1004800 | Not Available | 1752 | Open in IMG/M |
| 3300014324|Ga0075352_1095097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 775 | Open in IMG/M |
| 3300015371|Ga0132258_12302351 | All Organisms → cellular organisms → Bacteria | 1351 | Open in IMG/M |
| 3300016270|Ga0182036_10199394 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300016294|Ga0182041_11649035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AUGA SZCCT0177 | 593 | Open in IMG/M |
| 3300016319|Ga0182033_10966776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 756 | Open in IMG/M |
| 3300016341|Ga0182035_10148444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1797 | Open in IMG/M |
| 3300016341|Ga0182035_10294817 | Not Available | 1328 | Open in IMG/M |
| 3300016341|Ga0182035_10743158 | Not Available | 857 | Open in IMG/M |
| 3300016371|Ga0182034_10792446 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300016371|Ga0182034_11155451 | Not Available | 672 | Open in IMG/M |
| 3300016371|Ga0182034_11263855 | Not Available | 643 | Open in IMG/M |
| 3300016371|Ga0182034_11523898 | Not Available | 586 | Open in IMG/M |
| 3300016404|Ga0182037_10003767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8269 | Open in IMG/M |
| 3300016404|Ga0182037_10539731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 983 | Open in IMG/M |
| 3300016404|Ga0182037_11166959 | Not Available | 676 | Open in IMG/M |
| 3300016404|Ga0182037_11272505 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300016404|Ga0182037_11639614 | Not Available | 572 | Open in IMG/M |
| 3300016422|Ga0182039_11221234 | Not Available | 679 | Open in IMG/M |
| 3300016422|Ga0182039_11408063 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300016422|Ga0182039_12136858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. JGI PP 4-B12 | 516 | Open in IMG/M |
| 3300017822|Ga0187802_10033791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Lentzea → Lentzea atacamensis | 1826 | Open in IMG/M |
| 3300017926|Ga0187807_1194589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 656 | Open in IMG/M |
| 3300017942|Ga0187808_10548921 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300017944|Ga0187786_10642387 | Not Available | 503 | Open in IMG/M |
| 3300017955|Ga0187817_10041375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2820 | Open in IMG/M |
| 3300017974|Ga0187777_10163481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1489 | Open in IMG/M |
| 3300018001|Ga0187815_10224764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 794 | Open in IMG/M |
| 3300018029|Ga0187787_10491887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis | 502 | Open in IMG/M |
| 3300018032|Ga0187788_10045676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio alginolyticus | 1475 | Open in IMG/M |
| 3300018032|Ga0187788_10393503 | Not Available | 581 | Open in IMG/M |
| 3300018064|Ga0187773_10124510 | All Organisms → cellular organisms → Bacteria | 1301 | Open in IMG/M |
| 3300018090|Ga0187770_10233554 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300020010|Ga0193749_1043809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 863 | Open in IMG/M |
| 3300020579|Ga0210407_11218514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 565 | Open in IMG/M |
| 3300021180|Ga0210396_10377177 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300021404|Ga0210389_10802575 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 735 | Open in IMG/M |
| 3300021406|Ga0210386_10361026 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300021420|Ga0210394_10366420 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300021439|Ga0213879_10086206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 868 | Open in IMG/M |
| 3300021474|Ga0210390_10346148 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300021478|Ga0210402_11334348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 644 | Open in IMG/M |
| 3300021559|Ga0210409_10387211 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300025898|Ga0207692_10395990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 860 | Open in IMG/M |
| 3300025928|Ga0207700_10751748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 871 | Open in IMG/M |
| 3300025935|Ga0207709_10236538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1326 | Open in IMG/M |
| 3300025953|Ga0210068_1034845 | Not Available | 756 | Open in IMG/M |
| 3300026452|Ga0256821_1037142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300026645|Ga0208572_10042 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300026683|Ga0208210_100070 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300026819|Ga0207765_101364 | Not Available | 2748 | Open in IMG/M |
| 3300026830|Ga0207861_102954 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. UW-LDO-01 | 1198 | Open in IMG/M |
| 3300026847|Ga0207802_1002323 | Not Available | 1767 | Open in IMG/M |
| 3300026852|Ga0207838_103958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 867 | Open in IMG/M |
| 3300026859|Ga0207859_1002868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 1656 | Open in IMG/M |
| 3300026866|Ga0207786_105727 | Not Available | 1111 | Open in IMG/M |
| 3300026871|Ga0207825_111686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 608 | Open in IMG/M |
| 3300026887|Ga0207805_1019669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 683 | Open in IMG/M |
| 3300026934|Ga0207816_1010389 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300027000|Ga0207803_1009811 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 3300027019|Ga0207857_1013287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1388 | Open in IMG/M |
| 3300027104|Ga0208095_1004629 | Not Available | 931 | Open in IMG/M |
| 3300027548|Ga0209523_1008570 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300031545|Ga0318541_10007923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4635 | Open in IMG/M |
| 3300031545|Ga0318541_10134666 | Not Available | 1349 | Open in IMG/M |
| 3300031545|Ga0318541_10371755 | Not Available | 798 | Open in IMG/M |
| 3300031545|Ga0318541_10502686 | Not Available | 678 | Open in IMG/M |
| 3300031545|Ga0318541_10689830 | Not Available | 570 | Open in IMG/M |
| 3300031545|Ga0318541_10730186 | Not Available | 553 | Open in IMG/M |
| 3300031561|Ga0318528_10490150 | Not Available | 660 | Open in IMG/M |
| 3300031561|Ga0318528_10500769 | Not Available | 652 | Open in IMG/M |
| 3300031572|Ga0318515_10035239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2465 | Open in IMG/M |
| 3300031572|Ga0318515_10469485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 672 | Open in IMG/M |
| 3300031573|Ga0310915_10002824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9284 | Open in IMG/M |
| 3300031573|Ga0310915_10393824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 983 | Open in IMG/M |
| 3300031573|Ga0310915_10891441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 623 | Open in IMG/M |
| 3300031640|Ga0318555_10666711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 562 | Open in IMG/M |
| 3300031668|Ga0318542_10154621 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300031680|Ga0318574_10454369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 749 | Open in IMG/M |
| 3300031681|Ga0318572_10195189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1180 | Open in IMG/M |
| 3300031682|Ga0318560_10297949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 869 | Open in IMG/M |
| 3300031682|Ga0318560_10431352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300031715|Ga0307476_10330510 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300031716|Ga0310813_10375345 | Not Available | 1218 | Open in IMG/M |
| 3300031716|Ga0310813_11746152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 583 | Open in IMG/M |
| 3300031719|Ga0306917_10212746 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300031719|Ga0306917_10897335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 693 | Open in IMG/M |
| 3300031719|Ga0306917_11491198 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 520 | Open in IMG/M |
| 3300031724|Ga0318500_10100602 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300031724|Ga0318500_10209767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 935 | Open in IMG/M |
| 3300031736|Ga0318501_10545316 | Not Available | 634 | Open in IMG/M |
| 3300031744|Ga0306918_10222272 | Not Available | 1432 | Open in IMG/M |
| 3300031744|Ga0306918_10345314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1154 | Open in IMG/M |
| 3300031744|Ga0306918_11232441 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300031744|Ga0306918_11534640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
| 3300031747|Ga0318502_10200984 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
| 3300031751|Ga0318494_10606588 | Not Available | 640 | Open in IMG/M |
| 3300031753|Ga0307477_10326292 | Not Available | 1057 | Open in IMG/M |
| 3300031764|Ga0318535_10202953 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300031768|Ga0318509_10060282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1962 | Open in IMG/M |
| 3300031771|Ga0318546_10205923 | Not Available | 1345 | Open in IMG/M |
| 3300031781|Ga0318547_10164476 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300031793|Ga0318548_10069778 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300031797|Ga0318550_10109188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1309 | Open in IMG/M |
| 3300031823|Ga0307478_10541901 | Not Available | 971 | Open in IMG/M |
| 3300031833|Ga0310917_10609398 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300031833|Ga0310917_11197291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium macuxiense | 505 | Open in IMG/M |
| 3300031879|Ga0306919_10112081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1938 | Open in IMG/M |
| 3300031880|Ga0318544_10130658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas oryzicola | 957 | Open in IMG/M |
| 3300031890|Ga0306925_11158670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 777 | Open in IMG/M |
| 3300031890|Ga0306925_11496387 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300031893|Ga0318536_10085124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → Methylobacterium nodulans → Methylobacterium nodulans ORS 2060 | 1571 | Open in IMG/M |
| 3300031896|Ga0318551_10148452 | Not Available | 1278 | Open in IMG/M |
| 3300031897|Ga0318520_10611567 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300031897|Ga0318520_10881497 | Not Available | 563 | Open in IMG/M |
| 3300031910|Ga0306923_10727597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1 | 1102 | Open in IMG/M |
| 3300031910|Ga0306923_10764172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1070 | Open in IMG/M |
| 3300031910|Ga0306923_10998212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 909 | Open in IMG/M |
| 3300031910|Ga0306923_11460184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300031910|Ga0306923_11537991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300031910|Ga0306923_11929861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300031912|Ga0306921_11366889 | Not Available | 780 | Open in IMG/M |
| 3300031912|Ga0306921_11397098 | Not Available | 770 | Open in IMG/M |
| 3300031941|Ga0310912_10267149 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031941|Ga0310912_11096196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 608 | Open in IMG/M |
| 3300031942|Ga0310916_10163164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1846 | Open in IMG/M |
| 3300031942|Ga0310916_10322917 | Not Available | 1309 | Open in IMG/M |
| 3300031943|Ga0310885_10050889 | Not Available | 1719 | Open in IMG/M |
| 3300031945|Ga0310913_10996549 | Not Available | 587 | Open in IMG/M |
| 3300031946|Ga0310910_11179620 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300031947|Ga0310909_10314469 | Not Available | 1313 | Open in IMG/M |
| 3300031947|Ga0310909_10336966 | Not Available | 1265 | Open in IMG/M |
| 3300031947|Ga0310909_10717853 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031954|Ga0306926_10726623 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300031954|Ga0306926_11840057 | Not Available | 686 | Open in IMG/M |
| 3300031954|Ga0306926_11891131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 674 | Open in IMG/M |
| 3300031959|Ga0318530_10167119 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300031962|Ga0307479_11296265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 689 | Open in IMG/M |
| 3300031981|Ga0318531_10430701 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032001|Ga0306922_10539036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1241 | Open in IMG/M |
| 3300032001|Ga0306922_11249987 | Not Available | 753 | Open in IMG/M |
| 3300032025|Ga0318507_10094143 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300032025|Ga0318507_10282149 | Not Available | 722 | Open in IMG/M |
| 3300032035|Ga0310911_10012612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3889 | Open in IMG/M |
| 3300032035|Ga0310911_10330388 | Not Available | 879 | Open in IMG/M |
| 3300032041|Ga0318549_10143059 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300032043|Ga0318556_10144636 | Not Available | 1224 | Open in IMG/M |
| 3300032043|Ga0318556_10191752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1062 | Open in IMG/M |
| 3300032043|Ga0318556_10446916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300032054|Ga0318570_10172801 | Not Available | 971 | Open in IMG/M |
| 3300032059|Ga0318533_10096054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2044 | Open in IMG/M |
| 3300032059|Ga0318533_10412286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
| 3300032059|Ga0318533_10619451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300032063|Ga0318504_10109952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1242 | Open in IMG/M |
| 3300032063|Ga0318504_10329359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Devosia → Devosia psychrophila | 724 | Open in IMG/M |
| 3300032065|Ga0318513_10109116 | Not Available | 1300 | Open in IMG/M |
| 3300032076|Ga0306924_10087776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3497 | Open in IMG/M |
| 3300032076|Ga0306924_10706445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1132 | Open in IMG/M |
| 3300032076|Ga0306924_10795437 | Not Available | 1054 | Open in IMG/M |
| 3300032090|Ga0318518_10001975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7101 | Open in IMG/M |
| 3300032090|Ga0318518_10129476 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300032261|Ga0306920_100118471 | Not Available | 3932 | Open in IMG/M |
| 3300032261|Ga0306920_100614573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1607 | Open in IMG/M |
| 3300032261|Ga0306920_100627173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1589 | Open in IMG/M |
| 3300032261|Ga0306920_100641494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1569 | Open in IMG/M |
| 3300032261|Ga0306920_100674034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1525 | Open in IMG/M |
| 3300032261|Ga0306920_104083029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 528 | Open in IMG/M |
| 3300033289|Ga0310914_10935509 | Not Available | 766 | Open in IMG/M |
| 3300033412|Ga0310810_10417715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1375 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.04% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.65% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.65% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.08% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.56% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.56% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.04% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.52% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.52% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000660 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025953 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026645 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -Nitrogen NN342 (SPAdes) | Environmental | Open in IMG/M |
| 3300026683 | Grasslands soil microbial communities from Chapel Hill, North Carolina, USA that are Nitrogen fertilized -NN352 (SPAdes) | Environmental | Open in IMG/M |
| 3300026819 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 59 (SPAdes) | Environmental | Open in IMG/M |
| 3300026830 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 33 (SPAdes) | Environmental | Open in IMG/M |
| 3300026847 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 20 (SPAdes) | Environmental | Open in IMG/M |
| 3300026852 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 62 (SPAdes) | Environmental | Open in IMG/M |
| 3300026859 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 25 (SPAdes) | Environmental | Open in IMG/M |
| 3300026866 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 76 (SPAdes) | Environmental | Open in IMG/M |
| 3300026871 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 78 (SPAdes) | Environmental | Open in IMG/M |
| 3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026934 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026947 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027000 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 41 (SPAdes) | Environmental | Open in IMG/M |
| 3300027019 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 22 (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12415J11908_101352 | 3300000660 | Tropical Forest Soil | GGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG* |
| Ga0066395_108615041 | 3300004633 | Tropical Forest Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVYAAAEG* |
| Ga0066388_1001422024 | 3300005332 | Tropical Forest Soil | MSAFGGVFNRSTQHLLILLEEEVCDGGDCTDMVYAAAEGEL |
| Ga0066388_1005489765 | 3300005332 | Tropical Forest Soil | MSALGGGFNGSTQHLLILLEEEVCDGGDCTNMVHAAAEG* |
| Ga0066388_1010696791 | 3300005332 | Tropical Forest Soil | MTAMGRGFNRSTQHLLILLDWEVSDGGECTDVVHAETAGRALGA |
| Ga0066388_1019094101 | 3300005332 | Tropical Forest Soil | MSAFGRGFNRSRQHLLILLDWEVSDGGECTDVVHAETAGR |
| Ga0066388_1027763292 | 3300005332 | Tropical Forest Soil | MSAYGCGFNRSTQHLLILLDWEVSDGGECTDVVHAETAGRALGAM |
| Ga0066388_1033516681 | 3300005332 | Tropical Forest Soil | MLFAAVRWSANGRGFNRSRQHLLILLDWEVSDGGECTDVVHAETAGRALG |
| Ga0066388_1054388441 | 3300005332 | Tropical Forest Soil | MRVLSRVSALLRGFNRSRQHLLILLDWEVSDGGECTDVVHAETAGR |
| Ga0066903_1047668393 | 3300005764 | Tropical Forest Soil | MSAFGGEFNESTQHLLILADEEDANGGACTDMVHAETEG |
| Ga0066903_1059013573 | 3300005764 | Tropical Forest Soil | MSALGGGFNGSTQHLLILLEEEVCDGGDCTNMVHAAAE |
| Ga0066903_1061390311 | 3300005764 | Tropical Forest Soil | LAMSALCGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEG |
| Ga0066903_1069451741 | 3300005764 | Tropical Forest Soil | MSALGGEFNESTQHLLILADEEDANGGACTDLVHAETE |
| Ga0070717_120837431 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIGGVFNWSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0066652_1010279551 | 3300006046 | Soil | GGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG* |
| Ga0075015_1005458991 | 3300006102 | Watersheds | MSAIGGVFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG* |
| Ga0075421_1020422911 | 3300006845 | Populus Rhizosphere | VRADSNVPLGGEFNRSTQHLLIFVGWEVNDGVACPDMVHAESEGRDL |
| Ga0075430_1004809782 | 3300006846 | Populus Rhizosphere | MVRLGGEFNRSTQHLLIFADWEVNDGVACPDMVHA |
| Ga0075429_1005034003 | 3300006880 | Populus Rhizosphere | VRADSNVPLGGEFNRSTQHLLIFADWEVNDGVACPDMVHAESEGRDL |
| Ga0164303_102257892 | 3300012957 | Soil | MSALGGEFNRSTQHLLILLDWEVSDGGECTDMVHAQAEGRALGALEER |
| Ga0164301_100371171 | 3300012960 | Soil | MSAIGGEFNRSTQHLLILLDWEVSDGGECTDMVHAQAEGRALG |
| Ga0164302_118814501 | 3300012961 | Soil | MSALGGEFNRSTQHLLILLDWEVSDGGECTDMVHAQAEGRALG |
| Ga0075354_10048003 | 3300014308 | Natural And Restored Wetlands | MSAFDGGFNRWTQHLLIVSDWEVSDGGECTDTVHAKAAG |
| Ga0075352_10950972 | 3300014324 | Natural And Restored Wetlands | VSDGMSAIGGGFNRWTQHLLIVSDWEVSDGGECTDTVHAKAAGRALGAM |
| Ga0132258_123023514 | 3300015371 | Arabidopsis Rhizosphere | MSALGGGFNRSTQHLLIVSDWEVSDGGECTDMVHAAAA |
| Ga0182036_101993941 | 3300016270 | Soil | MSALLGGFNRSTQHLLILLDWEVSDGGECADVVHAETA |
| Ga0182041_116490352 | 3300016294 | Soil | VGLAMSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVH |
| Ga0182033_109667761 | 3300016319 | Soil | MPANGRGFNRSTQHLLILLDWEVSDGGECADVVHAETAG |
| Ga0182035_101484444 | 3300016341 | Soil | MRLRMSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAA |
| Ga0182035_102948172 | 3300016341 | Soil | MSAFGGGFNRSTQHLLILLDWEVSDGGECADVVHAETAG |
| Ga0182035_107431582 | 3300016341 | Soil | MSAYDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAE |
| Ga0182034_107924461 | 3300016371 | Soil | MSVIDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAE |
| Ga0182034_111554511 | 3300016371 | Soil | MSAFNGGFNRSTQHLLILLEKEVRDGGDCTDMVHVAAE |
| Ga0182034_112638551 | 3300016371 | Soil | MSAFGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAE |
| Ga0182034_115238981 | 3300016371 | Soil | MTNGRFRGGFNRSTQHLLILLDWEVSDGGECADVVHAETAGRALG |
| Ga0182037_100037671 | 3300016404 | Soil | MSAFDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAE |
| Ga0182037_105397311 | 3300016404 | Soil | MSALGGGFNRSTQHLLILPEEEVCDGGDCTDMVHAAA |
| Ga0182037_111669592 | 3300016404 | Soil | MSALGRGFSGSTQHLLILLEKEVCDGGDCTDMVHV |
| Ga0182037_112725052 | 3300016404 | Soil | MSVIDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAA |
| Ga0182037_116396141 | 3300016404 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0182039_112212342 | 3300016422 | Soil | MSAFNGGFNRSTQHLLILLEKEVRDGGDCTDMVHVAA |
| Ga0182039_114080632 | 3300016422 | Soil | MSAFDGGFDGSTQHLLILLEEEVCDGGDCTNMVHAAA |
| Ga0182039_121368582 | 3300016422 | Soil | MSAFDGVFNRSTQHLLILLEKEVCDGGDCTDMVHAAA |
| Ga0187802_100337911 | 3300017822 | Freshwater Sediment | MSALGGGFNRSTQHLLILRDGEVCYGREYTDMVYA |
| Ga0187807_11945892 | 3300017926 | Freshwater Sediment | MSAIGGEFNRSTQHLLILRDGEVCDGRECTDMVYAEAE |
| Ga0187808_105489211 | 3300017942 | Freshwater Sediment | MSAYGSEFNRSTQHLLILRDGEVCDGRECTDMVYAEAED |
| Ga0187786_106423871 | 3300017944 | Tropical Peatland | MPALCGGFNRSTQHLLIVSAWEVSDGGECTDMGHAAAAG |
| Ga0187817_100413755 | 3300017955 | Freshwater Sediment | MSAYDGEFNRSTQRLLILRDGEVCDGRECTDMVQPKQRAELW |
| Ga0187777_101634814 | 3300017974 | Tropical Peatland | MSAKGGGFNRSTQHLLILLGWEVIDGVACTDVVYAEAASRALGAVE |
| Ga0187815_102247642 | 3300018001 | Freshwater Sediment | GGEFNRSTQHLLILRDGEVCDGRECTDMVYAEAED |
| Ga0187787_104918872 | 3300018029 | Tropical Peatland | MPAFDGGFNRSTQHLLILPDGEVSDGVACTDMVHAEAASRALGALE |
| Ga0187788_100456762 | 3300018032 | Tropical Peatland | MFAFGGEFNRPTQHLLILLDREVSDGGACTDLVYAEAEGRALGAVE |
| Ga0187788_103935031 | 3300018032 | Tropical Peatland | MQLAMSALGGEFNRPTQHLLILLDREVSDGGACTDLVYAEAEGRA |
| Ga0187773_101245102 | 3300018064 | Tropical Peatland | MSALTGVFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0187770_102335541 | 3300018090 | Tropical Peatland | MSAFDGGFNRSTQHLLILRDGEVCDGRECTDMVYAEAEG |
| Ga0193749_10438091 | 3300020010 | Soil | PTVFHRMSANDGEFNRSTQHLLILLDWEVSDGGECTDMVHAAAEG |
| Ga0210407_112185142 | 3300020579 | Soil | PGEFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210396_103771771 | 3300021180 | Soil | CLLYPGEFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210389_108025751 | 3300021404 | Soil | GGEFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210386_103610262 | 3300021406 | Soil | PGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210394_103664201 | 3300021420 | Soil | AFGGVFNRSTQHLLIWLEEEVCDGGDCTDMVHAAAEG |
| Ga0213879_100862061 | 3300021439 | Bulk Soil | GNNPQGRMSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG |
| Ga0210390_103461481 | 3300021474 | Soil | AFGGGLNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210402_113343482 | 3300021478 | Soil | SAMGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0210409_103872112 | 3300021559 | Soil | MSAFGGEFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207692_103959901 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ARCPLYPGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207700_107517481 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PLSGGGFNGSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207709_102365381 | 3300025935 | Miscanthus Rhizosphere | MPALGGGFNRSTQHLLILLDEEVSHGDVTDMVHAAVEVGAVGAVE |
| Ga0210068_10348451 | 3300025953 | Natural And Restored Wetlands | MSALGGGFNRSTQHLLIVSDWEVSDGGECTDMVHAEAEGRALGALE |
| Ga0256821_10371421 | 3300026452 | Sediment | MSALGGEFNRSTQHLLIVSDWEVSDGGECTDTVHAKAAG |
| Ga0208572_100422 | 3300026645 | Soil | WGGGFNGSTQHLLILLEKEVCDGGDCTNMVHAAAEG |
| Ga0208210_1000702 | 3300026683 | Soil | LLGGGFNGSTQHLLILLEKEVCDGGDCTNMVHAAAEG |
| Ga0207765_1013644 | 3300026819 | Tropical Forest Soil | CGGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG |
| Ga0207861_1029541 | 3300026830 | Tropical Forest Soil | QCPLLGGVFNRSTQHLLILPEEEVCDGGDCTNMVHPAAEG |
| Ga0207802_10023231 | 3300026847 | Tropical Forest Soil | LPMSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG |
| Ga0207838_1039582 | 3300026852 | Tropical Forest Soil | NQCPLSGGVFNRSTQHLLILPEEEVCDGGDCTNMVHPAAEG |
| Ga0207859_10028682 | 3300026859 | Tropical Forest Soil | MEQLGAMSALGGVFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207786_1057272 | 3300026866 | Tropical Forest Soil | RRMSAFGGGFNRSTQHLPILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207825_1116861 | 3300026871 | Tropical Forest Soil | GGVFNRSTQHLLILPEEEVCDGGDCTNMVHPAAEG |
| Ga0207805_10196692 | 3300026887 | Tropical Forest Soil | MSALGGGFNGSTQHLLILLEKEVCDGGDCTDMVHAAAEG |
| Ga0207816_10103891 | 3300026934 | Tropical Forest Soil | GGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0207853_10213501 | 3300026947 | Tropical Forest Soil | ESACEANCCECLLYPGVFNRSTQHLLILPEEEVCDGGDCTNMVHPAAEG |
| Ga0207803_10098112 | 3300027000 | Tropical Forest Soil | PPMSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVHAAAEG |
| Ga0207857_10132872 | 3300027019 | Tropical Forest Soil | MSALCGVFNRSTQHLLILPEEEVCDGGDCTNMVHPAAEG |
| Ga0208095_10046292 | 3300027104 | Forest Soil | FGGEFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0209523_10085703 | 3300027548 | Forest Soil | QCLLYPGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318541_100079235 | 3300031545 | Soil | MSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAE |
| Ga0318541_101346661 | 3300031545 | Soil | MSPIGGGFNRSTQHLLILLDWEVSDGGECADVVHAE |
| Ga0318541_103717551 | 3300031545 | Soil | MSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318541_105026861 | 3300031545 | Soil | MSAFGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0318541_106898301 | 3300031545 | Soil | MSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0318541_107301861 | 3300031545 | Soil | MSALPGGFNRSTQHLLILLDWEVSDGGECAEVVHAETAGRALG |
| Ga0318528_104901501 | 3300031561 | Soil | MSALPGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0318528_105007692 | 3300031561 | Soil | MSALGEGGFNRSTQHLLILLDWEVSDGGECADVVHAETAGRALGAME |
| Ga0318515_100352392 | 3300031572 | Soil | MSAYPMSAFDGGFNRSTQHLLILLEKEVCDGGDCTDMVHV |
| Ga0318515_104694851 | 3300031572 | Soil | CGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0310915_1000282411 | 3300031573 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0310915_103938241 | 3300031573 | Soil | MSALCGVFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0310915_108914412 | 3300031573 | Soil | NECPLLGGGFNRSTQHLLILLEEEVCDGGDCTDMVHGAAEG |
| Ga0318555_106667111 | 3300031640 | Soil | SLSTIAMSALCGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318542_101546211 | 3300031668 | Soil | RMSAFDGGFNGSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0318574_104543691 | 3300031680 | Soil | VGISGMSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318572_101951892 | 3300031681 | Soil | MSAYPMSAFDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAA |
| Ga0318560_102979492 | 3300031682 | Soil | VGLAMSALGGGFNRSTQHLLILLEKEVCDGGDCTDM |
| Ga0318560_104313521 | 3300031682 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHA |
| Ga0307476_103305102 | 3300031715 | Hardwood Forest Soil | IARQCPLLGGVFNRSTQHLLIWLEEEVCDGGDCTDMVHAAAEG |
| Ga0310813_103753451 | 3300031716 | Soil | MSANDGEFNRSTQHLLILPDGEVSDGVACTDVVHAEAAGRAL |
| Ga0310813_117461521 | 3300031716 | Soil | MSALGGEFNRSTQHLLILPDGEVSDGVACTDVVHAEA |
| Ga0306917_102127461 | 3300031719 | Soil | TLVGDAAMSAFDGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0306917_108973351 | 3300031719 | Soil | SRGMSALCGGFNGSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0306917_114911981 | 3300031719 | Soil | MSALVGGFNRSTQHLLILLDWEVSDGGECTDVVHAET |
| Ga0318500_101006021 | 3300031724 | Soil | TLELSCAMSALCGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEG |
| Ga0318500_102097672 | 3300031724 | Soil | MSAYPMSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0318501_105453162 | 3300031736 | Soil | MSAYDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAA |
| Ga0306918_102222722 | 3300031744 | Soil | MCPLYPGGFNRSTQHLLILLDEEVCDGGDCTDMVH |
| Ga0306918_103453141 | 3300031744 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEGSALGAL |
| Ga0306918_112324411 | 3300031744 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0306918_115346402 | 3300031744 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTNMVHA |
| Ga0318502_102009842 | 3300031747 | Soil | DETAGLSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318494_106065882 | 3300031751 | Soil | MLHCIMSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAE |
| Ga0307477_103262922 | 3300031753 | Hardwood Forest Soil | RTLKGAHRMSALCGVFNRSTQHLLIWLEEEVCDGGDCTDMVHAAAEG |
| Ga0318535_102029532 | 3300031764 | Soil | MSALPGGFNRSTQHLLILLEKEVRDGGDCTDMVHVAAEG |
| Ga0318509_100602821 | 3300031768 | Soil | MSAYDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVA |
| Ga0318546_102059231 | 3300031771 | Soil | MSAFGGGFNRSTQHLLILLDWEVSDGGECADVVHAETAGR |
| Ga0318547_101644761 | 3300031781 | Soil | FGSPARMSAFGGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0318548_100697783 | 3300031793 | Soil | VRPMSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318550_101091881 | 3300031797 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAE |
| Ga0307478_105419011 | 3300031823 | Hardwood Forest Soil | LGGVFNRSTQHLLIWLEEEVCDGGDCTDMVHAAAEG |
| Ga0310917_106093982 | 3300031833 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTNMVHAA |
| Ga0310917_111972912 | 3300031833 | Soil | MSALCGGFNRSTQHLLILLEKEVCDGGDCTDMVHVA |
| Ga0306919_101120813 | 3300031879 | Soil | MSAFDGGFNRSTQHLLILLEEEVYDGGDCTDMVHAAPEG |
| Ga0318544_101306582 | 3300031880 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0306925_111586702 | 3300031890 | Soil | MSALGGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAA |
| Ga0306925_114963872 | 3300031890 | Soil | MRAECPLLLGGFNRSTQHLLILLDWEVSDGGECAEVVHAETAGRALGAME |
| Ga0318536_100851242 | 3300031893 | Soil | MSALYGGFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0318551_101484521 | 3300031896 | Soil | MEQLGAMSALGGGFNRSTQHLLILLEKEVRDGGDCTDMVHVAAEG |
| Ga0318520_106115672 | 3300031897 | Soil | MSALTGGFNRSTQHLLILLDWEVSDGGECADVVHAETA |
| Ga0318520_108814971 | 3300031897 | Soil | MSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVA |
| Ga0306923_107275971 | 3300031910 | Soil | MSALGRGFNRSTQHLLILLDWEVSDGGECTDVVHAETA |
| Ga0306923_107641721 | 3300031910 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAA |
| Ga0306923_109982122 | 3300031910 | Soil | MSAFDGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEG |
| Ga0306923_114601841 | 3300031910 | Soil | LRKSAAMSAFDGVFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0306923_115379911 | 3300031910 | Soil | MSAFSGGFNRSTQHLLILLEKEVCDGGDCTDMVHVA |
| Ga0306923_119298612 | 3300031910 | Soil | MSAFGGGFNRSTQHLLILLEEEVCGGGDCTNMVHAAA |
| Ga0306921_113668893 | 3300031912 | Soil | MSAFDGGFNRSTQHLLILLEKEVCDGGDCTDMVHV |
| Ga0306921_113970981 | 3300031912 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVA |
| Ga0310912_102671491 | 3300031941 | Soil | RLRMSALCGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0310912_110961961 | 3300031941 | Soil | MNHIETGMSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHGA |
| Ga0310916_101631641 | 3300031942 | Soil | MRLRMSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEG |
| Ga0310916_103229172 | 3300031942 | Soil | MRRRMSAFGGGFNRSTQHLLILLEEEVCDGGDCTDMVHA |
| Ga0310885_100508891 | 3300031943 | Soil | MSAFDGEFNRSTQHLLILPDGEVSDGVACTDMVHAEAEGRALGALE |
| Ga0310913_109965491 | 3300031945 | Soil | MSALLGGFNRSTQHLLILLDWEVSDGGECADVVHAE |
| Ga0310910_111796201 | 3300031946 | Soil | MSALCGVFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0310909_103144691 | 3300031947 | Soil | MRRRMSAFGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0310909_103369662 | 3300031947 | Soil | MEQLGAMSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0310909_107178531 | 3300031947 | Soil | MSAYDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0306926_107266233 | 3300031954 | Soil | MSAFDGGLNRSLQHLLILLEKEVCDGGDCTDMVHV |
| Ga0306926_118400571 | 3300031954 | Soil | MSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVDAAAEG |
| Ga0306926_118911312 | 3300031954 | Soil | AGVTNAMSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHGAAEG |
| Ga0318530_101671192 | 3300031959 | Soil | MSALPGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAE |
| Ga0307479_112962651 | 3300031962 | Hardwood Forest Soil | MSAFGGVFNRSTQHLLIWLEEEVCDGGDCTDMVHAAAEG |
| Ga0318531_104307012 | 3300031981 | Soil | MSAFDGGFNGSTQHLLILLEEEVCDGVDCTNMVHAAAEG |
| Ga0306922_105390361 | 3300032001 | Soil | LLGHCGMSAFGGGFNRSTQHLLILLEKEVCDGGDCT |
| Ga0306922_112499871 | 3300032001 | Soil | MSAYDGVFNRSTQHLLILLEEEVCDGGDCTDMVHPAAE |
| Ga0318507_100941431 | 3300032025 | Soil | SNGRASMSAFDGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318507_102821491 | 3300032025 | Soil | MSALCGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0310911_100126121 | 3300032035 | Soil | MEARRMSALGGGFNRSTQHLLILLEEEVRDGGDCTDMVHVAA |
| Ga0310911_103303881 | 3300032035 | Soil | MSALVGGFNRSTQHLLILLDWEVSDGGECADVVHAETA |
| Ga0318549_101430592 | 3300032041 | Soil | MEARRMSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAA |
| Ga0318556_101446361 | 3300032043 | Soil | MEQLGAMSALGGGFNRSTQHLLILLEKEVRDGGDCTDMVHVAA |
| Ga0318556_101917522 | 3300032043 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAE |
| Ga0318556_104469161 | 3300032043 | Soil | MSALCGGFNRSTQHLLILLEEEVCDGVDCTDMVHPAAE |
| Ga0318570_101728012 | 3300032054 | Soil | PMSAYDGVFNRSTQHLLILLEEEVCDGGDCTDMVHPAAEG |
| Ga0318533_100960545 | 3300032059 | Soil | MSAFDGGFNRSTQHLLILLEEEVYDGGDCTDMVHA |
| Ga0318533_104122861 | 3300032059 | Soil | MSALGRGFSGSTQHLLILLEKEVCDGGDCTDMVHVTAEG |
| Ga0318533_106194512 | 3300032059 | Soil | MSALGGGFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0318504_101099521 | 3300032063 | Soil | MSAYPMSAFDGGFNRSTQHLLILLEKEVCDGGDCTD |
| Ga0318504_103293592 | 3300032063 | Soil | DGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0318513_101091161 | 3300032065 | Soil | MEQLGAMSALGGGFNRSTQHLLILLEEEVCDGGDCTD |
| Ga0306924_100877764 | 3300032076 | Soil | MSALYGGFNRSTQHLLILLEEEVCDGGDCTDMVHAAAEG |
| Ga0306924_107064452 | 3300032076 | Soil | MSAYDGVFNRSTQHLLILLEEEVCDGGDCTDMVHAA |
| Ga0306924_107954371 | 3300032076 | Soil | RWPVSALDGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0318518_100019751 | 3300032090 | Soil | ERMSALGGGFNRSTQYLLILLEDGADCTDMVHAAAEG |
| Ga0318518_101294761 | 3300032090 | Soil | REMSALCGGFNRSTQHLLILLEEEVCDGGDCTNMVHAAAEG |
| Ga0306920_1001184711 | 3300032261 | Soil | MSAFGGGFNRSTQHLLILLDWEVSDGGECADVVHAET |
| Ga0306920_1006145733 | 3300032261 | Soil | MSALDGGFNRSTQHLLILLEEEVCDGGDCTDMVHA |
| Ga0306920_1006271733 | 3300032261 | Soil | MSVLGGGFNRSTQHLLILLEEEVCDGGDCTDMVYAA |
| Ga0306920_1006414943 | 3300032261 | Soil | MGDAMSAFGGGFNRSTQHLLILLEKEVCDGGDCTDM |
| Ga0306920_1006740343 | 3300032261 | Soil | MSAFGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAA |
| Ga0306920_1040830292 | 3300032261 | Soil | MSALGGGFNRSTQHLLILLEKEVCDGGDCTDMVHVAAEG |
| Ga0310914_109355091 | 3300033289 | Soil | MSAFGGGFNRSTQHLLILLEEEVCDGGDCTDMVHA |
| Ga0310810_104177153 | 3300033412 | Soil | MSALGGEFNRSTQHLLILPDGEVSDGVACTDVVHAEAAGRA |
| ⦗Top⦘ |