


| Basic Information | |
|---|---|
| Family ID | F027949 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 25.39 % |
| % of genes near scaffold ends (potentially truncated) | 40.93 % |
| % of genes from short scaffolds (< 2000 bps) | 80.83 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (89.119 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.544 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.016 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.212 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.85% β-sheet: 0.00% Coil/Unstructured: 66.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF04255 | DUF433 | 1.55 |
| PF02371 | Transposase_20 | 1.55 |
| PF00589 | Phage_integrase | 1.55 |
| PF01850 | PIN | 1.55 |
| PF13646 | HEAT_2 | 1.04 |
| PF13545 | HTH_Crp_2 | 1.04 |
| PF00665 | rve | 1.04 |
| PF13620 | CarboxypepD_reg | 1.04 |
| PF13408 | Zn_ribbon_recom | 0.52 |
| PF00072 | Response_reg | 0.52 |
| PF00106 | adh_short | 0.52 |
| PF02604 | PhdYeFM_antitox | 0.52 |
| PF13470 | PIN_3 | 0.52 |
| PF08223 | PaaX_C | 0.52 |
| PF00989 | PAS | 0.52 |
| PF14690 | zf-ISL3 | 0.52 |
| PF14321 | DUF4382 | 0.52 |
| PF01979 | Amidohydro_1 | 0.52 |
| PF14257 | DUF4349 | 0.52 |
| PF13592 | HTH_33 | 0.52 |
| PF01569 | PAP2 | 0.52 |
| PF00400 | WD40 | 0.52 |
| PF05717 | TnpB_IS66 | 0.52 |
| PF13482 | RNase_H_2 | 0.52 |
| PF01019 | G_glu_transpept | 0.52 |
| PF00118 | Cpn60_TCP1 | 0.52 |
| PF13565 | HTH_32 | 0.52 |
| PF03544 | TonB_C | 0.52 |
| PF13701 | DDE_Tnp_1_4 | 0.52 |
| PF00924 | MS_channel | 0.52 |
| PF04264 | YceI | 0.52 |
| PF13414 | TPR_11 | 0.52 |
| PF01183 | Glyco_hydro_25 | 0.52 |
| PF01336 | tRNA_anti-codon | 0.52 |
| PF01695 | IstB_IS21 | 0.52 |
| PF13546 | DDE_5 | 0.52 |
| PF01904 | DUF72 | 0.52 |
| PF13655 | RVT_N | 0.52 |
| PF01894 | UPF0047 | 0.52 |
| PF01582 | TIR | 0.52 |
| PF00990 | GGDEF | 0.52 |
| PF13358 | DDE_3 | 0.52 |
| PF04679 | DNA_ligase_A_C | 0.52 |
| PF13683 | rve_3 | 0.52 |
| PF07607 | DUF1570 | 0.52 |
| PF12840 | HTH_20 | 0.52 |
| PF12704 | MacB_PCD | 0.52 |
| PF00069 | Pkinase | 0.52 |
| PF02810 | SEC-C | 0.52 |
| PF08937 | DUF1863 | 0.52 |
| PF06863 | DUF1254 | 0.52 |
| PF12006 | DUF3500 | 0.52 |
| PF01070 | FMN_dh | 0.52 |
| PF01515 | PTA_PTB | 0.52 |
| PF08447 | PAS_3 | 0.52 |
| PF13495 | Phage_int_SAM_4 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.07 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 1.55 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.55 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.04 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.04 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.04 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.04 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.52 |
| COG0280 | Phosphotransacetylase (includes Pta, EutD and phosphobutyryltransferase) | Energy production and conversion [C] | 0.52 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.52 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.52 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.52 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.52 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.52 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.52 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.52 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.52 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG3327 | DNA-binding transcriptional regulator PaaX (phenylacetic acid degradation) | Transcription [K] | 0.52 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.52 |
| COG3757 | Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.52 |
| COG5361 | Uncharacterized conserved protein | Mobilome: prophages, transposons [X] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.12 % |
| Unclassified | root | N/A | 10.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459010|GIO7OMY02GRAG3 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300001471|JGI12712J15308_10151587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300001593|JGI12635J15846_10008403 | All Organisms → cellular organisms → Bacteria | 8774 | Open in IMG/M |
| 3300001593|JGI12635J15846_10681363 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100214677 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300005172|Ga0066683_10066093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2156 | Open in IMG/M |
| 3300005174|Ga0066680_10754785 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005177|Ga0066690_10795892 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005184|Ga0066671_10809810 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300005540|Ga0066697_10212946 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005568|Ga0066703_10521351 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300005602|Ga0070762_10649943 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300005610|Ga0070763_10103125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1441 | Open in IMG/M |
| 3300005764|Ga0066903_102979501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300005921|Ga0070766_10148104 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300005921|Ga0070766_11132117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005950|Ga0066787_10004193 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300005994|Ga0066789_10454277 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300006046|Ga0066652_100065994 | All Organisms → cellular organisms → Bacteria | 2797 | Open in IMG/M |
| 3300006052|Ga0075029_101028550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300006059|Ga0075017_101170720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300006173|Ga0070716_101637230 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300006174|Ga0075014_100055573 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300006175|Ga0070712_100330202 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300006176|Ga0070765_100038653 | All Organisms → cellular organisms → Bacteria | 3798 | Open in IMG/M |
| 3300006176|Ga0070765_102108476 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006804|Ga0079221_10290872 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300006864|Ga0066797_1024039 | All Organisms → cellular organisms → Bacteria | 2128 | Open in IMG/M |
| 3300007258|Ga0099793_10024671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2504 | Open in IMG/M |
| 3300007258|Ga0099793_10687906 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300007265|Ga0099794_10409216 | Not Available | 709 | Open in IMG/M |
| 3300007819|Ga0104322_121315 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009090|Ga0099827_10413081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1154 | Open in IMG/M |
| 3300009176|Ga0105242_12507416 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300009523|Ga0116221_1533211 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009524|Ga0116225_1486663 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300009792|Ga0126374_10055370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
| 3300009839|Ga0116223_10562567 | Not Available | 660 | Open in IMG/M |
| 3300009839|Ga0116223_10611927 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300010046|Ga0126384_10656372 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300010048|Ga0126373_10017895 | All Organisms → cellular organisms → Bacteria | 5925 | Open in IMG/M |
| 3300010048|Ga0126373_10108455 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300010048|Ga0126373_10121453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2444 | Open in IMG/M |
| 3300010048|Ga0126373_10494425 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300010048|Ga0126373_12313361 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010154|Ga0127503_10162653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
| 3300010304|Ga0134088_10527323 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300010326|Ga0134065_10303641 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010326|Ga0134065_10359164 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010335|Ga0134063_10390996 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300010339|Ga0074046_10223995 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300010339|Ga0074046_10459261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300010341|Ga0074045_10020048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5266 | Open in IMG/M |
| 3300010341|Ga0074045_10605519 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300010358|Ga0126370_10230320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
| 3300010358|Ga0126370_10260063 | Not Available | 1352 | Open in IMG/M |
| 3300010361|Ga0126378_13215108 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010364|Ga0134066_10042285 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300010366|Ga0126379_10111622 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300010376|Ga0126381_100746472 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300010376|Ga0126381_100944979 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300010376|Ga0126381_101185415 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300010376|Ga0126381_101691717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter aggregans | 914 | Open in IMG/M |
| 3300010376|Ga0126381_102161722 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300010376|Ga0126381_103172197 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300010379|Ga0136449_100865629 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300010379|Ga0136449_100978512 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300010379|Ga0136449_102457243 | Not Available | 749 | Open in IMG/M |
| 3300010379|Ga0136449_104010233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300011120|Ga0150983_16440703 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300011270|Ga0137391_10229153 | Not Available | 1613 | Open in IMG/M |
| 3300011271|Ga0137393_10358211 | Not Available | 1247 | Open in IMG/M |
| 3300012096|Ga0137389_11270339 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012199|Ga0137383_10051841 | All Organisms → cellular organisms → Bacteria | 2934 | Open in IMG/M |
| 3300012199|Ga0137383_10075550 | All Organisms → cellular organisms → Bacteria | 2432 | Open in IMG/M |
| 3300012199|Ga0137383_10967642 | Not Available | 621 | Open in IMG/M |
| 3300012200|Ga0137382_10324927 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300012211|Ga0137377_10145011 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300012211|Ga0137377_11948509 | Not Available | 504 | Open in IMG/M |
| 3300012351|Ga0137386_10018802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 4662 | Open in IMG/M |
| 3300012359|Ga0137385_10034340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4551 | Open in IMG/M |
| 3300012362|Ga0137361_10298925 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300012378|Ga0134025_1126798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012683|Ga0137398_10713857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300012683|Ga0137398_11116464 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012685|Ga0137397_10280441 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012917|Ga0137395_10381644 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012922|Ga0137394_10146833 | Not Available | 2005 | Open in IMG/M |
| 3300012923|Ga0137359_10845957 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300012925|Ga0137419_10036900 | All Organisms → cellular organisms → Bacteria | 3049 | Open in IMG/M |
| 3300012925|Ga0137419_10231296 | Not Available | 1384 | Open in IMG/M |
| 3300012925|Ga0137419_10356013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300012927|Ga0137416_10619738 | Not Available | 944 | Open in IMG/M |
| 3300012958|Ga0164299_11674014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012971|Ga0126369_10685220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300012971|Ga0126369_12028452 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300012986|Ga0164304_10503564 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012989|Ga0164305_11859663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300013296|Ga0157374_11372210 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300014164|Ga0181532_10014301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6000 | Open in IMG/M |
| 3300014200|Ga0181526_10650370 | Not Available | 665 | Open in IMG/M |
| 3300014501|Ga0182024_10125229 | All Organisms → cellular organisms → Bacteria | 3666 | Open in IMG/M |
| 3300015054|Ga0137420_1092023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 956 | Open in IMG/M |
| 3300015241|Ga0137418_11142393 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300015371|Ga0132258_11903592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1497 | Open in IMG/M |
| 3300016270|Ga0182036_10186080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1510 | Open in IMG/M |
| 3300016404|Ga0182037_10390954 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300016445|Ga0182038_11292491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300017657|Ga0134074_1384248 | Not Available | 521 | Open in IMG/M |
| 3300017928|Ga0187806_1071564 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
| 3300017930|Ga0187825_10313912 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300017932|Ga0187814_10292746 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300017932|Ga0187814_10412227 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300017937|Ga0187809_10334116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300017946|Ga0187879_10566584 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018006|Ga0187804_10525348 | Not Available | 533 | Open in IMG/M |
| 3300018431|Ga0066655_11211020 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300020579|Ga0210407_10059917 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2849 | Open in IMG/M |
| 3300020579|Ga0210407_10467699 | Not Available | 986 | Open in IMG/M |
| 3300020579|Ga0210407_10838548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300020580|Ga0210403_10434356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300020581|Ga0210399_11005540 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300020581|Ga0210399_11380154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
| 3300021168|Ga0210406_10074033 | All Organisms → cellular organisms → Bacteria | 2923 | Open in IMG/M |
| 3300021168|Ga0210406_10827587 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300021170|Ga0210400_10633537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300021171|Ga0210405_10070241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2762 | Open in IMG/M |
| 3300021401|Ga0210393_10812079 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300021405|Ga0210387_10238780 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
| 3300021405|Ga0210387_11738212 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300021406|Ga0210386_10224173 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
| 3300021420|Ga0210394_10252785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1542 | Open in IMG/M |
| 3300021432|Ga0210384_10293844 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
| 3300021478|Ga0210402_10011674 | All Organisms → cellular organisms → Bacteria | 7578 | Open in IMG/M |
| 3300021559|Ga0210409_10533792 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300021559|Ga0210409_10646366 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300021559|Ga0210409_11312580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300021560|Ga0126371_11780097 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300025482|Ga0208715_1085380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300025929|Ga0207664_11007838 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
| 3300025939|Ga0207665_11596506 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300026295|Ga0209234_1003072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6347 | Open in IMG/M |
| 3300026324|Ga0209470_1038585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2381 | Open in IMG/M |
| 3300026328|Ga0209802_1067010 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
| 3300026328|Ga0209802_1321699 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026334|Ga0209377_1008601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5901 | Open in IMG/M |
| 3300026494|Ga0257159_1007216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1678 | Open in IMG/M |
| 3300026910|Ga0207840_1006222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1333 | Open in IMG/M |
| 3300027042|Ga0207766_1004078 | Not Available | 1818 | Open in IMG/M |
| 3300027324|Ga0209845_1054064 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300027660|Ga0209736_1111684 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300027698|Ga0209446_1107078 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300027748|Ga0209689_1026546 | All Organisms → cellular organisms → Bacteria | 3498 | Open in IMG/M |
| 3300027884|Ga0209275_10011534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3794 | Open in IMG/M |
| 3300027898|Ga0209067_10676571 | Not Available | 597 | Open in IMG/M |
| 3300027908|Ga0209006_10173657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1882 | Open in IMG/M |
| 3300028536|Ga0137415_10017148 | All Organisms → cellular organisms → Bacteria | 7182 | Open in IMG/M |
| 3300031231|Ga0170824_117292639 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300031469|Ga0170819_11911630 | Not Available | 884 | Open in IMG/M |
| 3300031469|Ga0170819_14195113 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300031474|Ga0170818_102886800 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300031561|Ga0318528_10531210 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300031564|Ga0318573_10195130 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300031708|Ga0310686_107370346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1716 | Open in IMG/M |
| 3300031708|Ga0310686_108300777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300031719|Ga0306917_10229296 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300031744|Ga0306918_10050941 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
| 3300031753|Ga0307477_10790156 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031792|Ga0318529_10478674 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031833|Ga0310917_10729721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300031873|Ga0315297_11636548 | Not Available | 517 | Open in IMG/M |
| 3300031879|Ga0306919_10483999 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031890|Ga0306925_10123296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2774 | Open in IMG/M |
| 3300031897|Ga0318520_11066506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300031912|Ga0306921_10131493 | All Organisms → cellular organisms → Bacteria | 2922 | Open in IMG/M |
| 3300031941|Ga0310912_10491966 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300031946|Ga0310910_11530549 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031947|Ga0310909_11575759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300031954|Ga0306926_10750891 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031954|Ga0306926_10803677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300031962|Ga0307479_10406621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1346 | Open in IMG/M |
| 3300031962|Ga0307479_10607935 | Not Available | 1075 | Open in IMG/M |
| 3300032001|Ga0306922_10086863 | All Organisms → cellular organisms → Bacteria | 3291 | Open in IMG/M |
| 3300032001|Ga0306922_10338204 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300032063|Ga0318504_10543307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300032180|Ga0307471_100346124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1594 | Open in IMG/M |
| 3300032205|Ga0307472_101639134 | Not Available | 633 | Open in IMG/M |
| 3300032261|Ga0306920_100415343 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300032261|Ga0306920_100656669 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300032261|Ga0306920_101827574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300032261|Ga0306920_103001646 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300033405|Ga0326727_10773049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300033977|Ga0314861_0100289 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.54% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.22% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.15% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.63% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.63% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.63% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.59% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.07% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.04% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.52% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.52% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459010 | Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!) | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F62_05098310 | 2170459010 | Grass Soil | MRAMVVEVGPEIEQFVFQICRRPEQHVIQILASKGAD |
| JGI12712J15308_101515871 | 3300001471 | Forest Soil | MGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNG |
| JGI12635J15846_100084037 | 3300001593 | Forest Soil | MVVEVGPEIEQLVFEVCRRPEQRVIQILAPNGAD* |
| JGI12635J15846_106813631 | 3300001593 | Forest Soil | MRAIVVEVGPEIEKLVFEICSGPEQHAIQILASKR |
| JGIcombinedJ26739_1002146771 | 3300002245 | Forest Soil | MGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNGADEPFHE |
| Ga0066683_100660931 | 3300005172 | Soil | MRAMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFHEWMG |
| Ga0066680_107547851 | 3300005174 | Soil | MVVEVVPELKQFIFEICGRPEQRVIQILASNRADEPFDERMR |
| Ga0066690_107958922 | 3300005177 | Soil | MVVEVVPELKEFIFEICGRPEQRVIQILASNRADEPFDERMR |
| Ga0066671_108098101 | 3300005184 | Soil | MRALVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPF |
| Ga0066697_102129461 | 3300005540 | Soil | MVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDE |
| Ga0066703_105213511 | 3300005568 | Soil | MMVVVVPEIEQFIFQIDSRPEQRVIQTFASNGADEPFHE |
| Ga0070762_106499431 | 3300005602 | Soil | MRAMVVEIGSEIEQLVFEICRRPEQDVIQVLAPKGAD* |
| Ga0070763_101031251 | 3300005610 | Soil | MVVEVGPEIQQFILEICTRPEQHVIQIFASNGANEPFHEGMRL |
| Ga0066903_1029795011 | 3300005764 | Tropical Forest Soil | MGAMVVEVGSEIEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0070766_101481042 | 3300005921 | Soil | MGAMVVEVGPKIEQLVFEICRRSEQSAIQILSANGAD* |
| Ga0070766_111321172 | 3300005921 | Soil | MGAMVVEVGPEIEQFILQICTRPEQHVIQIFASNGANEPF |
| Ga0066787_100041932 | 3300005950 | Soil | MVVEVGPEIEQLVFEICRRPEQGVIQILASKGAD* |
| Ga0066789_104542772 | 3300005994 | Soil | MVVVVVLEIEQFIFQIDSRPEQRVIQIFASNGADEP |
| Ga0066652_1000659945 | 3300006046 | Soil | MVVEVGPEIEQLVFEICRRPEQSVIQVLAPNDAD* |
| Ga0075029_1010285501 | 3300006052 | Watersheds | MRAMVVEVGPEIEQLVFKICRRPEQQVIQIFASKSPD* |
| Ga0075017_1011707201 | 3300006059 | Watersheds | MRAMVVEVGPEIEQLVFEIASRPEQQVIQILSAKGAD* |
| Ga0070716_1016372301 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAMVVEVVPELKEFIFEICGRPEQRVIQTLASNGAD* |
| Ga0075014_1000555733 | 3300006174 | Watersheds | MGAMVVEVVAEIEQFIFEIYRRPEQRVIQTLASNGAD* |
| Ga0070712_1003302021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILASQGSD* |
| Ga0070765_1000386532 | 3300006176 | Soil | MRAMVVEIGSEIEQLVFEICRRPEQDVIQVLASNGAD* |
| Ga0070765_1021084761 | 3300006176 | Soil | MMVVVVSEIEQFIFQIDSRPEQHVIQIFASNGANEPFHEGM |
| Ga0079221_102908722 | 3300006804 | Agricultural Soil | MVVEVVPELKEFIFEICGRPEQRVIQTLASNRTDEPFGERMREGNAGDALDF |
| Ga0066797_10240392 | 3300006864 | Soil | MVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD* |
| Ga0099793_100246714 | 3300007258 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEIFRRPEQSVIQVLAPKGA |
| Ga0099793_106879061 | 3300007258 | Vadose Zone Soil | MRAMTVKVGPEIEQLVFEICRRPEQSVIQVLAPKGAD* |
| Ga0099794_104092161 | 3300007265 | Vadose Zone Soil | MRAMVVKVGPEIEQLVFEIGRRPEQSVIQVLAPKGAD* |
| Ga0104322_1213152 | 3300007819 | Permafrost Soil | MRAMVVEVRPEIEQLVFEICRRPEQGVIQILASKGAD* |
| Ga0099827_104130813 | 3300009090 | Vadose Zone Soil | MVVEVGPEIEQLVFEVRSRPEQRVIQILASNGAD* |
| Ga0105242_125074162 | 3300009176 | Miscanthus Rhizosphere | SPFPRGMRAMVVEVAPEIKQLVFQNCRRPEQHVI* |
| Ga0116221_15332112 | 3300009523 | Peatlands Soil | MRAMVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD* |
| Ga0116225_14866632 | 3300009524 | Peatlands Soil | MRAMVIEVGSEIEQFRFEICGCPEQHVIQILASNGTD* |
| Ga0126374_100553701 | 3300009792 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0116223_105625672 | 3300009839 | Peatlands Soil | MRAMVVEIGPEVEQFVFEIHRRPEQHVIQILASNGAD* |
| Ga0116223_106119272 | 3300009839 | Peatlands Soil | MRAMVVEVGSEIEQFAFEIGTRPEQHVIQVLASNGAD* |
| Ga0126384_106563723 | 3300010046 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNAIQILLSVAN* |
| Ga0126373_100178956 | 3300010048 | Tropical Forest Soil | MGAMVVEVGPEIEQFVLEIRRSPEQNVIQVLPSNGAD* |
| Ga0126373_101084554 | 3300010048 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAVL* |
| Ga0126373_101214532 | 3300010048 | Tropical Forest Soil | MGAMAVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0126373_104944252 | 3300010048 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNVIQILSSNSAD* |
| Ga0126373_123133612 | 3300010048 | Tropical Forest Soil | MVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0127503_101626532 | 3300010154 | Soil | MRAMVVEVSPEIEQLVFEICRRPEQQVIQILSAKGAD* |
| Ga0134088_105273232 | 3300010304 | Grasslands Soil | MRAMVVEVAPEIEQLVFEIASRPEQQVIQILSAKGAD* |
| Ga0134065_103036411 | 3300010326 | Grasslands Soil | MRAMVVEVGPEIEQLVFEICRRPEQSVIQVLAPNDAD* |
| Ga0134065_103591642 | 3300010326 | Grasslands Soil | MRAMAVKVRPEIVQFVFEVCCRPKKHLIQILASDGA |
| Ga0134063_103909961 | 3300010335 | Grasslands Soil | MRAMVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDE |
| Ga0074046_102239953 | 3300010339 | Bog Forest Soil | MGAMVVEVGSEIKQFVFEIYSRPEQHVIQILASNGAD* |
| Ga0074046_104592611 | 3300010339 | Bog Forest Soil | MRAMVVEVGPEIEQLVFEIASRPEQQVIQILASNGAD* |
| Ga0074045_100200489 | 3300010341 | Bog Forest Soil | MRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKRAD* |
| Ga0074045_106055192 | 3300010341 | Bog Forest Soil | MPAMVIEVGSEIEQFGFEICGRPEQHVIQILASNRAD* |
| Ga0126370_102303202 | 3300010358 | Tropical Forest Soil | MGAMVVEVGPEIEQLVLEIRRSPEQNVIQILPSNGAD* |
| Ga0126370_102600631 | 3300010358 | Tropical Forest Soil | MRAMVVEVGSEIEQLVFKVCGRPEQQVIQILASKGAD* |
| Ga0126378_132151082 | 3300010361 | Tropical Forest Soil | MGAMVVEVGPEIERLVFEIRRSPEQNVIQILPSNGAN* |
| Ga0134066_100422852 | 3300010364 | Grasslands Soil | MRAMMVEVCAEIEQLVFEIRSGPEQRAIQKLASNRADQ |
| Ga0126379_101116221 | 3300010366 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNLIQMLPSNGAD* |
| Ga0126381_1007464721 | 3300010376 | Tropical Forest Soil | MVVEVGPEIEQLILEIRRSPEQNVIQILPSNGAD* |
| Ga0126381_1009449791 | 3300010376 | Tropical Forest Soil | MGATVVEVSPEIEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0126381_1011854152 | 3300010376 | Tropical Forest Soil | MRAMVVEVAPEIEQLVFQICRRPEQHLIQILASKAADEPFHEGMG* |
| Ga0126381_1016917171 | 3300010376 | Tropical Forest Soil | MGAMVVEVGLEIEQLVFEIRRSPEENVIQILPSNGAD* |
| Ga0126381_1021617221 | 3300010376 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNVIQVLPSNGAD* |
| Ga0126381_1031721971 | 3300010376 | Tropical Forest Soil | MGAMVVEVGPENEQLVFEIRRSPEQNVIQILPSNGAD* |
| Ga0136449_1008656292 | 3300010379 | Peatlands Soil | MRAMVVKVGPEIEQLVFEICRRPEQQVIQILSAKGAD* |
| Ga0136449_1009785122 | 3300010379 | Peatlands Soil | MRAMVVEVGSEIEQFAFEICSRPEQHVIQVLASNGAD* |
| Ga0136449_1024572431 | 3300010379 | Peatlands Soil | MRAMVVEVGSEIEQFVFEICGRPEQHVIQILASNGAD* |
| Ga0136449_1040102331 | 3300010379 | Peatlands Soil | MRAMVVEVGSEIEQFVFQICRRPEQHVIQILASNGAD* |
| Ga0150983_164407031 | 3300011120 | Forest Soil | MRAMVVKVGPEIEQLVFEIASRPEQQVIQILSAKGAD* |
| Ga0137391_102291532 | 3300011270 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEICSGPEQHAIQILASKGAD* |
| Ga0137393_103582111 | 3300011271 | Vadose Zone Soil | MRAMVVEIGPEIEQLVFEICRHPEQSVIQVLAPKGAD* |
| Ga0137389_112703391 | 3300012096 | Vadose Zone Soil | MRAMTVKVGPEIEQFVFEVCCRPKQHLIQILAPDGAD* |
| Ga0137383_100518412 | 3300012199 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEICRRPEQSVIQVLTPKGAD* |
| Ga0137383_100755502 | 3300012199 | Vadose Zone Soil | MRAIVVEVGSEIEQLAFKICSRPEQQVIKILESNRAD* |
| Ga0137383_109676421 | 3300012199 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEVCSRPEQRVIQMLASNGAD* |
| Ga0137382_103249271 | 3300012200 | Vadose Zone Soil | MRAMVVEVGPEIEQFVFEVCSGPEQHAIQILAPKGAD* |
| Ga0137377_101450113 | 3300012211 | Vadose Zone Soil | MRAMVVEVGPELEQFVFEVRRRPEQQVIQIFASQRADHS |
| Ga0137377_119485091 | 3300012211 | Vadose Zone Soil | MGALMVEVCPEIEQLVFEIRRGPEQGAIQILASNRADQ |
| Ga0137386_100188028 | 3300012351 | Vadose Zone Soil | MRAMVVKVGPEIEQLVFEICCRPKQRMIQIFASNGADQPFHKW |
| Ga0137385_100343406 | 3300012359 | Vadose Zone Soil | MSAMVVKVGPEIEQLVFEICCRPKQRMIQILASNG |
| Ga0137361_102989252 | 3300012362 | Vadose Zone Soil | MRAIVVEVGSEIEQLAFKICSRPEQQVIQILASNRAD* |
| Ga0134025_11267982 | 3300012378 | Grasslands Soil | MRAMVLEVGPEIERLVFEICRCPEQHAIQILVSKGA |
| Ga0137398_107138572 | 3300012683 | Vadose Zone Soil | MRAMVVEVGPEIEQLLFEIRSCPEQRLIEILAAKGAD* |
| Ga0137398_111164641 | 3300012683 | Vadose Zone Soil | MGAMMVVVVLEIEQFIFQIDSRPEQRVIQTFASNGADEPLHEGKIRGIGEKN |
| Ga0137397_102804411 | 3300012685 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEVCRRPEQGVIQILAPKGAD* |
| Ga0137395_103816442 | 3300012917 | Vadose Zone Soil | MRAIVVEVSPEIEQLVFEICRRPEQSVIQVLASNGAD |
| Ga0137394_101468334 | 3300012922 | Vadose Zone Soil | MRAIVVEVGPEIEQLVFEICRRPEQSVIQVLAPKDAD* |
| Ga0137359_108459572 | 3300012923 | Vadose Zone Soil | MRAMVVEIGPEIEQLVFEIGRRPEQSVIQVLASNGAD* |
| Ga0137419_100369002 | 3300012925 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEIGRRPEQSVIQVLAPKGAD* |
| Ga0137419_102312961 | 3300012925 | Vadose Zone Soil | MRATVVEVRPEIEQLLFEICGRPEQRVIQILASNGAD* |
| Ga0137419_103560131 | 3300012925 | Vadose Zone Soil | MRAIVVEVSPEIEQLVFEICRGPEQSVIQALAPQGADEPFHE* |
| Ga0137416_106197382 | 3300012927 | Vadose Zone Soil | GMRATVVEVRPEIEQLLFEICGRPEQRVIQILASNGAD* |
| Ga0164299_116740141 | 3300012958 | Soil | MRAMVVKVDPEIEQLVFEIASRPEQQVIQILASQGSD* |
| Ga0126369_106852202 | 3300012971 | Tropical Forest Soil | MRPMVVKVGPEIEQFVFETCPSPEQYVIQILPSKSAD* |
| Ga0126369_120284521 | 3300012971 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRRGPEQNVIQILPSNGAD* |
| Ga0164304_105035641 | 3300012986 | Soil | MRAMVVEVSPEIEQLVFEICRCPEQQVIQILAAKGAD* |
| Ga0164305_118596631 | 3300012989 | Soil | MVVEVGPEIEQLVFEIASRPEQQVIQILASKGSD* |
| Ga0157374_113722101 | 3300013296 | Miscanthus Rhizosphere | MRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKGAD* |
| Ga0181532_100143015 | 3300014164 | Bog | MLAMVVEVGPEIEQLVFEICRRPEKRVIQILASKGAD* |
| Ga0181526_106503702 | 3300014200 | Bog | MLIEICPEIEQLVFQIRRGPEQRMIQILASNRADQPF |
| Ga0182024_101252295 | 3300014501 | Permafrost | MRAMVVEVRPEIEQLVFEICRRPEQAVIQILASKGAD* |
| Ga0137420_10920231 | 3300015054 | Vadose Zone Soil | MRAMVVEVGPEIEQLVFEICRRPEQSVIQVLAPKGAD* |
| Ga0137418_111423931 | 3300015241 | Vadose Zone Soil | MRAMAVKVRPEIEQFVFEVCCRPKQHLIQILASDGAD* |
| Ga0132258_119035922 | 3300015371 | Arabidopsis Rhizosphere | MRAMVVEVVPELEEFIFEICRRPEQRVIQILASNRADEPFDERM |
| Ga0182036_101860805 | 3300016270 | Soil | MRAMVVEVGPEIEQLVFEIASRPEEQVIQILASKGTD |
| Ga0182037_103909543 | 3300016404 | Soil | MRALVVEVGFEIEQFVFEIYRRPEQHVIQIIASKGAD |
| Ga0182038_112924911 | 3300016445 | Soil | MRAMVVEVAPEIKQLVFEICRRPEQQVIQILSAKGAD |
| Ga0134074_13842481 | 3300017657 | Grasslands Soil | MMVEVCPEIEQLVFEIRRGPEQGAIQILASNGADQP |
| Ga0187806_10715641 | 3300017928 | Freshwater Sediment | MRAMVVEVSPEIEQFVFEIYRRPEQHAIQILSSQGAD |
| Ga0187825_103139122 | 3300017930 | Freshwater Sediment | MRAMVVKVGPEIEQLVFEICGRPEQQVIQILSAKGAD |
| Ga0187814_102927462 | 3300017932 | Freshwater Sediment | MRAMVVEVGPEIEQLVFEISSRPEQQVIQILASKGAD |
| Ga0187814_104122271 | 3300017932 | Freshwater Sediment | MRAMVVEVGPEIEQLVFEIASRPEQQVIQILASKGAD |
| Ga0187809_103341161 | 3300017937 | Freshwater Sediment | MVVEVGTEIEQLVFEIGSRPEQQVIQILASNGPDQPFHERMG |
| Ga0187879_105665841 | 3300017946 | Peatland | MIVEVCPEIEQLVFEIRCRPEQRTIQILASNRADQP |
| Ga0187804_105253482 | 3300018006 | Freshwater Sediment | MRAMVVEVDLGIEQLVFEICRRPEQPVIQILAAKGAD |
| Ga0066655_112110202 | 3300018431 | Grasslands Soil | MVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFDER |
| Ga0210407_100599171 | 3300020579 | Soil | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILSAKGAD |
| Ga0210407_104676993 | 3300020579 | Soil | MRAMVVEVAPEVEQFVFEICRRPEQQVIQILASNGAD |
| Ga0210407_108385482 | 3300020579 | Soil | MVVEVVPELEQFIFEICGRPEQRVIQILASNRADEPFDERM |
| Ga0210403_104343561 | 3300020580 | Soil | MRAMVVKVGPEIEQLVFEICRRPEQQVIQILSAKGAD |
| Ga0210399_110055402 | 3300020581 | Soil | MVVEVVPEIEQFIFEICSRPEQRVIQILTSNSADQPFDERM |
| Ga0210399_113801541 | 3300020581 | Soil | MRALVVEVGFEIEQFVFEIYRRPEQHVIQILASNGAD |
| Ga0210406_100740331 | 3300021168 | Soil | PMVVKVDPEIEQLVFEICRCPEQQVIQILSAKGAD |
| Ga0210406_108275872 | 3300021168 | Soil | MRAMVVEVGPEIEQLVFEIASRPEQQVIQIFASKSPD |
| Ga0210400_106335371 | 3300021170 | Soil | MGAMVVKAGPEIEQFILQICTRPEQHVIQIFASNGANEPF |
| Ga0210405_100702413 | 3300021171 | Soil | MRAMVVEVGPEIEQFVFEIASRPEQQVIQILASKGAD |
| Ga0210393_108120791 | 3300021401 | Soil | MRPMVVKVGPEIEQLVFEICCRPEQNVVQILPSNGS |
| Ga0210387_102387801 | 3300021405 | Soil | MRPMVVKVGSEIEQLVFEICRSPKQNVIQIFPSNG |
| Ga0210387_117382121 | 3300021405 | Soil | MRPMVVKVGPEIEQLVFEISRSPKQNVIQILPSDGAD |
| Ga0210386_102241733 | 3300021406 | Soil | MVVEVGPEIQQFILQICTRPEQHVIQIFASNGANEPFHEGMR |
| Ga0210394_102527852 | 3300021420 | Soil | MGAMVVEVGPENEQLILQICTRPEQHVIQIFASNG |
| Ga0210384_102938442 | 3300021432 | Soil | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILAAKGAD |
| Ga0210402_100116742 | 3300021478 | Soil | MRAMVVEVGPEIEQLVFEIASRPEQQVVQILSAKGAD |
| Ga0210409_105337922 | 3300021559 | Soil | MRAMVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGAD |
| Ga0210409_106463661 | 3300021559 | Soil | MVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGADEPFDERVR |
| Ga0210409_113125801 | 3300021559 | Soil | MRAMVVEVSPEIEQLVFEICRCPEQQVIQILSAKGAD |
| Ga0126371_117800971 | 3300021560 | Tropical Forest Soil | MRAMVVEVGPEIKQLVFEIRRSPEQNVIQILPSNGAD |
| Ga0208715_10853801 | 3300025482 | Arctic Peat Soil | MRAMVVEVGPEIEQFVFEIYRRPEQHVIQILASKGAD |
| Ga0207664_110078382 | 3300025929 | Agricultural Soil | MVVEVVPEIEQFIFEIYSRPEQRVIQTLASNGADEPFD |
| Ga0207665_115965061 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVEVVPELKEFIFEICGRPEQRVIQTLASNRTDEPFGERMRKGNAG |
| Ga0209234_10030726 | 3300026295 | Grasslands Soil | MRAMAVKVRPEIEQFVFEVCCRPKKHLIQILASDGAN |
| Ga0209470_10385856 | 3300026324 | Soil | MVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPFHEWMG |
| Ga0209802_10670101 | 3300026328 | Soil | MVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQPF |
| Ga0209802_13216991 | 3300026328 | Soil | MVVEVVPELKQFIFEICGRPEQRVIQILASNRADEPFDERMRE |
| Ga0209377_10086011 | 3300026334 | Soil | MVVKVGPEIEQLVFEICCRPKQRMIQIVASNGADQPFHKWMG |
| Ga0257159_10072161 | 3300026494 | Soil | MVVEVGPEIEQFILQICTRPEQHVIQIFASNGANEPFHEG |
| Ga0207840_10062222 | 3300026910 | Tropical Forest Soil | MGAMVVEVGPEIEQLVFEIRGSPEQNVIQILPSNGAD |
| Ga0207766_10040783 | 3300027042 | Tropical Forest Soil | MVVEVGPEIEQLVFEIRRSPEQNVTQILPSNLNPA |
| Ga0209845_10540642 | 3300027324 | Groundwater Sand | MRAMIVEVGSEIEQLVFEILARPEQCAIQILPPYR |
| Ga0209736_11116843 | 3300027660 | Forest Soil | MVVEVGPEIEQLVFEIFRRPEQHMIQILASKGAFP |
| Ga0209446_11070783 | 3300027698 | Bog Forest Soil | MRPMVVKVGPEIEQLVFEICRSPKQNVIQILPSNGAVLWRSP |
| Ga0209689_10265467 | 3300027748 | Soil | MVVEVGPEIEQLVFEVCRRPEQHVIQVFPPQGADQ |
| Ga0209275_100115344 | 3300027884 | Soil | MRALVVEVGPEIEQLVFQICRRPKQRVIQILASKGAD |
| Ga0209067_106765711 | 3300027898 | Watersheds | MGAMVVEGVPEIEQFIFEIYSRPEQRVIQTLASNGAD |
| Ga0209006_101736571 | 3300027908 | Forest Soil | MGTMVIVVGPQIEQFILEICTRPEHHMIQIFASNGAD |
| Ga0137415_100171482 | 3300028536 | Vadose Zone Soil | MRAMTVKVGPEIEQFVFEVCCRPKQHLIQILAPDGAD |
| Ga0170824_1172926391 | 3300031231 | Forest Soil | MRAMVVEVGPEIEQLVFEIASRPEQQAIQILASKGAD |
| Ga0170819_119116301 | 3300031469 | Forest Soil | MRAMVVKAGPEIEQLAFEICRRPEQQVIQILSAKGAD |
| Ga0170819_141951131 | 3300031469 | Forest Soil | MRPMVVKVGPEIEQLVFEICRSPKQNVIQILPSNG |
| Ga0170818_1028868001 | 3300031474 | Forest Soil | MRPMVVKVGSEIEQLVFEICRSPKQNVIRILPSNGA |
| Ga0318528_105312102 | 3300031561 | Soil | MVVEVSPEIEQFVFQICSRPEQHVIQILASNGADQPFHEGIGQR |
| Ga0318573_101951302 | 3300031564 | Soil | GMGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD |
| Ga0310686_1073703461 | 3300031708 | Soil | MRAMVIEVGPEIEQLVFEICRRPEQQVIQILAAKGAD |
| Ga0310686_1083007772 | 3300031708 | Soil | MVVVVGPEIQQFIFQIYTRPEQRMIQVFASNGTDEPFHE |
| Ga0306917_102292963 | 3300031719 | Soil | MGAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD |
| Ga0306918_100509411 | 3300031744 | Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNLIQILPSNGAD |
| Ga0307477_107901562 | 3300031753 | Hardwood Forest Soil | MVVEVGPEIEQLVFEICRCPEQCVIQILASNGADEPFHKWM |
| Ga0318529_104786741 | 3300031792 | Soil | MRVMVVEVGPEIEQLVFEVCRRPEQPVLQVFAPQR |
| Ga0310917_107297211 | 3300031833 | Soil | MRAMVVEVGPEIEQFVFEICRRPEQHVIQILASNGAD |
| Ga0315297_116365481 | 3300031873 | Sediment | MIVEVGPEIEQLVFEIRARPDQRAIEILAAKGPDG |
| Ga0306919_104839992 | 3300031879 | Soil | MGAMVVEVGPEIEQLVLEIRRSPEQNLIQILPSNGAD |
| Ga0306925_101232962 | 3300031890 | Soil | MRAMVVEVGFEIEQFVFQIYRRPEQHVIQILASKG |
| Ga0318520_110665062 | 3300031897 | Soil | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILASKGAD |
| Ga0306921_101314934 | 3300031912 | Soil | MRALVVEAGFEIEQFVFEIYRRPEQHVIQIIASKGAD |
| Ga0310912_104919661 | 3300031941 | Soil | MGAMVVEVGPEIEQLVFEIRLSPEQNVIQILPSNGAD |
| Ga0310910_115305491 | 3300031946 | Soil | MVVEVAPEIEQLVFQICRRPEQHLIQILASNGADEPF |
| Ga0310909_115757592 | 3300031947 | Soil | MVVEVGPEIEQLVFQICRRPEQHVIQILASKGADE |
| Ga0306926_107508911 | 3300031954 | Soil | MRAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAD |
| Ga0306926_108036771 | 3300031954 | Soil | MRAMVVEVGFEIEQFVFQIYRRPEQHVIQILASKGAD |
| Ga0307479_104066211 | 3300031962 | Hardwood Forest Soil | MRAMVVEVGPEIEQLVFEICSRPEQRVIQILASNRADQP |
| Ga0307479_106079351 | 3300031962 | Hardwood Forest Soil | MRAMVVEVVPEPEQFIFEICGRPEQRVIQTLASNRADEPFDERMR |
| Ga0306922_100868631 | 3300032001 | Soil | MVVEVGPEIERFVFQICRRPEQHVIQILASQGADEPLDHML |
| Ga0306922_103382042 | 3300032001 | Soil | MGAMVVEVGPEIEQLVFEIRRSPEQNVIQILPSNGAN |
| Ga0318504_105433071 | 3300032063 | Soil | MRAMVVEVGPEIEQLVFEICRRPEQQVIQILASNGAD |
| Ga0307471_1003461241 | 3300032180 | Hardwood Forest Soil | MRAMVVEVVPEIEQFIFQIYSRPEQRVIQTLASNGAV |
| Ga0307472_1016391341 | 3300032205 | Hardwood Forest Soil | MRALVVEVGPEIQQLVFKICRGPEQHVIQIFAWKSS |
| Ga0306920_1004153432 | 3300032261 | Soil | MGAMVVEVGLEIEQLVLEIRRSPEQNVIQILPSNGAD |
| Ga0306920_1006566693 | 3300032261 | Soil | MGAMVVEVGTEIEQLVFEIRRSPEQNVIKILPSKGTD |
| Ga0306920_1018275741 | 3300032261 | Soil | MRAMVVEVGPEIEQFVFQICSRLEQHVIQILASKGAD |
| Ga0306920_1030016461 | 3300032261 | Soil | ALVVEVGPEIEQLVFEIASRPEQEVIQILASTGAD |
| Ga0326727_107730491 | 3300033405 | Peat Soil | MRAMVVEVGPEIEQLVFKICRRPEQGVIPILASKGADDPFHERMGQ |
| Ga0314861_0100289_573_686 | 3300033977 | Peatland | MRAMVVEVGPEIEQLVLEICRRPEHRAIQILASKGAD |
| ⦗Top⦘ |