


| Basic Information | |
|---|---|
| Family ID | F027947 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 193 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEA |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 193 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.67 % |
| % of genes near scaffold ends (potentially truncated) | 60.62 % |
| % of genes from short scaffolds (< 2000 bps) | 84.97 % |
| Associated GOLD sequencing projects | 119 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.093 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.979 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.041 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (64.249 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 193 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 4.15 |
| PF13432 | TPR_16 | 3.63 |
| PF13358 | DDE_3 | 2.59 |
| PF02534 | T4SS-DNA_transf | 2.07 |
| PF00072 | Response_reg | 1.55 |
| PF13847 | Methyltransf_31 | 1.55 |
| PF01965 | DJ-1_PfpI | 1.55 |
| PF12832 | MFS_1_like | 1.04 |
| PF13565 | HTH_32 | 1.04 |
| PF02371 | Transposase_20 | 1.04 |
| PF02776 | TPP_enzyme_N | 1.04 |
| PF04519 | Bactofilin | 1.04 |
| PF12847 | Methyltransf_18 | 0.52 |
| PF03401 | TctC | 0.52 |
| PF04471 | Mrr_cat | 0.52 |
| PF14690 | zf-ISL3 | 0.52 |
| PF00873 | ACR_tran | 0.52 |
| PF00196 | GerE | 0.52 |
| PF13426 | PAS_9 | 0.52 |
| PF01979 | Amidohydro_1 | 0.52 |
| PF04209 | HgmA_C | 0.52 |
| PF13489 | Methyltransf_23 | 0.52 |
| PF00534 | Glycos_transf_1 | 0.52 |
| PF01035 | DNA_binding_1 | 0.52 |
| PF05598 | DUF772 | 0.52 |
| PF00383 | dCMP_cyt_deam_1 | 0.52 |
| PF06147 | DUF968 | 0.52 |
| PF00903 | Glyoxalase | 0.52 |
| PF01575 | MaoC_dehydratas | 0.52 |
| PF00027 | cNMP_binding | 0.52 |
| PF08379 | Bact_transglu_N | 0.52 |
| PF04324 | Fer2_BFD | 0.52 |
| PF00011 | HSP20 | 0.52 |
| PF12307 | DUF3631 | 0.52 |
| PF00919 | UPF0004 | 0.52 |
| PF13551 | HTH_29 | 0.52 |
| PF00248 | Aldo_ket_red | 0.52 |
| PF13614 | AAA_31 | 0.52 |
| PF00239 | Resolvase | 0.52 |
| PF12599 | DUF3768 | 0.52 |
| PF13546 | DDE_5 | 0.52 |
| PF13384 | HTH_23 | 0.52 |
| PF13304 | AAA_21 | 0.52 |
| PF00296 | Bac_luciferase | 0.52 |
| PF04828 | GFA | 0.52 |
| PF00330 | Aconitase | 0.52 |
| PF05985 | EutC | 0.52 |
| PF13649 | Methyltransf_25 | 0.52 |
| PF11272 | DUF3072 | 0.52 |
| PF02738 | MoCoBD_1 | 0.52 |
| PF10030 | DUF2272 | 0.52 |
| PF03960 | ArsC | 0.52 |
| PF01972 | SDH_sah | 0.52 |
| PF10431 | ClpB_D2-small | 0.52 |
| PF13833 | EF-hand_8 | 0.52 |
| PF00171 | Aldedh | 0.52 |
| PF01068 | DNA_ligase_A_M | 0.52 |
| PF01047 | MarR | 0.52 |
| PF01527 | HTH_Tnp_1 | 0.52 |
| PF12867 | DinB_2 | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 193 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 4.15 |
| COG3505 | Type IV secretory pathway, VirD4 component, TraG/TraD family ATPase | Intracellular trafficking, secretion, and vesicular transport [U] | 2.07 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.04 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 1.04 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.04 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.52 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.52 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.52 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.52 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 0.52 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.52 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.52 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.52 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.52 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.52 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.52 |
| COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 0.52 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.52 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.52 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.09 % |
| Unclassified | root | N/A | 25.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_17255311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2607 | Open in IMG/M |
| 2170459015|G14TP7Y01BUJ2W | Not Available | 584 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10017130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1991 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10078454 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300001867|JGI12627J18819_10071261 | Not Available | 1444 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10029242 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1995 | Open in IMG/M |
| 3300004091|Ga0062387_101149499 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005172|Ga0066683_10295607 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300005180|Ga0066685_10117813 | Not Available | 1786 | Open in IMG/M |
| 3300005181|Ga0066678_10318352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium amorphae → Mesorhizobium amorphae CCNWGS0123 | 1021 | Open in IMG/M |
| 3300005332|Ga0066388_105694558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. | 630 | Open in IMG/M |
| 3300005434|Ga0070709_11367153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 572 | Open in IMG/M |
| 3300005436|Ga0070713_100257781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1593 | Open in IMG/M |
| 3300005450|Ga0066682_10717457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300005467|Ga0070706_100779103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 886 | Open in IMG/M |
| 3300005540|Ga0066697_10456276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300005549|Ga0070704_101143124 | Not Available | 708 | Open in IMG/M |
| 3300005552|Ga0066701_10093729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1743 | Open in IMG/M |
| 3300005553|Ga0066695_10882349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 511 | Open in IMG/M |
| 3300005564|Ga0070664_101398575 | Not Available | 661 | Open in IMG/M |
| 3300005610|Ga0070763_10035660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2300 | Open in IMG/M |
| 3300005713|Ga0066905_100189997 | Not Available | 1524 | Open in IMG/M |
| 3300005713|Ga0066905_101830436 | Not Available | 560 | Open in IMG/M |
| 3300005764|Ga0066903_100409860 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
| 3300005764|Ga0066903_101924670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1133 | Open in IMG/M |
| 3300005764|Ga0066903_105402299 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005764|Ga0066903_106967627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 586 | Open in IMG/M |
| 3300006028|Ga0070717_11452463 | Not Available | 622 | Open in IMG/M |
| 3300006059|Ga0075017_100551732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 878 | Open in IMG/M |
| 3300006162|Ga0075030_100496468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas turrisvirgatae | 970 | Open in IMG/M |
| 3300006174|Ga0075014_100003670 | All Organisms → cellular organisms → Bacteria | 4692 | Open in IMG/M |
| 3300006283|Ga0099601_10077637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
| 3300006791|Ga0066653_10017244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2645 | Open in IMG/M |
| 3300006796|Ga0066665_10156266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1735 | Open in IMG/M |
| 3300006796|Ga0066665_10402073 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300006800|Ga0066660_11333384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 562 | Open in IMG/M |
| 3300006844|Ga0075428_101230999 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006844|Ga0075428_101357990 | Not Available | 746 | Open in IMG/M |
| 3300006904|Ga0075424_100994187 | Not Available | 894 | Open in IMG/M |
| 3300009012|Ga0066710_100943713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1329 | Open in IMG/M |
| 3300009088|Ga0099830_11822583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 508 | Open in IMG/M |
| 3300010047|Ga0126382_11728053 | Not Available | 585 | Open in IMG/M |
| 3300010335|Ga0134063_10570383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 573 | Open in IMG/M |
| 3300010359|Ga0126376_10070244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 2560 | Open in IMG/M |
| 3300010375|Ga0105239_13544915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300010398|Ga0126383_12564807 | Not Available | 594 | Open in IMG/M |
| 3300012205|Ga0137362_10979008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300012205|Ga0137362_11641063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 530 | Open in IMG/M |
| 3300012285|Ga0137370_10166974 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300012917|Ga0137395_11175864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 538 | Open in IMG/M |
| 3300012955|Ga0164298_10887782 | Not Available | 647 | Open in IMG/M |
| 3300014495|Ga0182015_10644093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300014885|Ga0180063_1181800 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300015358|Ga0134089_10496038 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300015372|Ga0132256_102304222 | Not Available | 642 | Open in IMG/M |
| 3300015373|Ga0132257_101738996 | Not Available | 800 | Open in IMG/M |
| 3300016270|Ga0182036_10189212 | Not Available | 1499 | Open in IMG/M |
| 3300016270|Ga0182036_10280241 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300016270|Ga0182036_11259875 | Not Available | 616 | Open in IMG/M |
| 3300016270|Ga0182036_11487311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 568 | Open in IMG/M |
| 3300016294|Ga0182041_10187811 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300016294|Ga0182041_10327381 | Not Available | 1280 | Open in IMG/M |
| 3300016294|Ga0182041_10926661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300016319|Ga0182033_10112643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2027 | Open in IMG/M |
| 3300016319|Ga0182033_10608011 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300016319|Ga0182033_11935684 | Not Available | 536 | Open in IMG/M |
| 3300016341|Ga0182035_10262537 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300016341|Ga0182035_10476284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1063 | Open in IMG/M |
| 3300016357|Ga0182032_10112823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1944 | Open in IMG/M |
| 3300016357|Ga0182032_10866433 | Not Available | 766 | Open in IMG/M |
| 3300016371|Ga0182034_10190230 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300016371|Ga0182034_10595999 | Not Available | 932 | Open in IMG/M |
| 3300016387|Ga0182040_11462327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300016422|Ga0182039_10552497 | Not Available | 1001 | Open in IMG/M |
| 3300016422|Ga0182039_10614603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 951 | Open in IMG/M |
| 3300016422|Ga0182039_11446001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
| 3300016445|Ga0182038_10223615 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
| 3300016445|Ga0182038_10311704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1291 | Open in IMG/M |
| 3300016445|Ga0182038_10776957 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300017792|Ga0163161_10987743 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300017930|Ga0187825_10071702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1183 | Open in IMG/M |
| 3300017943|Ga0187819_10825417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 520 | Open in IMG/M |
| 3300018058|Ga0187766_10694429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 702 | Open in IMG/M |
| 3300018074|Ga0184640_10447621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 575 | Open in IMG/M |
| 3300018431|Ga0066655_10875863 | Not Available | 613 | Open in IMG/M |
| 3300018433|Ga0066667_11337231 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018465|Ga0190269_11150713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 604 | Open in IMG/M |
| 3300018482|Ga0066669_10335099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1248 | Open in IMG/M |
| 3300021420|Ga0210394_10550574 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300021475|Ga0210392_10366343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300021479|Ga0210410_10263990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1544 | Open in IMG/M |
| 3300021560|Ga0126371_11253362 | Not Available | 876 | Open in IMG/M |
| 3300021560|Ga0126371_11300574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 861 | Open in IMG/M |
| 3300021560|Ga0126371_12573277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300022507|Ga0222729_1029320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 691 | Open in IMG/M |
| 3300022525|Ga0242656_1105254 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300022712|Ga0242653_1067448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AS23.2 | 609 | Open in IMG/M |
| 3300022733|Ga0224562_1023583 | Not Available | 512 | Open in IMG/M |
| 3300024347|Ga0179591_1183287 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
| 3300025910|Ga0207684_10530020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1008 | Open in IMG/M |
| 3300026304|Ga0209240_1036832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1859 | Open in IMG/M |
| 3300026306|Ga0209468_1062861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1249 | Open in IMG/M |
| 3300026319|Ga0209647_1016616 | All Organisms → cellular organisms → Bacteria | 4692 | Open in IMG/M |
| 3300026322|Ga0209687_1041674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1493 | Open in IMG/M |
| 3300026335|Ga0209804_1335296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 509 | Open in IMG/M |
| 3300027634|Ga0209905_1091321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 518 | Open in IMG/M |
| 3300027812|Ga0209656_10033663 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3015 | Open in IMG/M |
| 3300027889|Ga0209380_10079610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300027902|Ga0209048_10227978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1340 | Open in IMG/M |
| 3300027903|Ga0209488_11172901 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300027911|Ga0209698_10069831 | Not Available | 3007 | Open in IMG/M |
| 3300027911|Ga0209698_10584141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas turrisvirgatae | 860 | Open in IMG/M |
| 3300027915|Ga0209069_10140468 | Not Available | 1194 | Open in IMG/M |
| 3300027915|Ga0209069_11055528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300028047|Ga0209526_10006354 | All Organisms → cellular organisms → Bacteria | 8090 | Open in IMG/M |
| 3300028720|Ga0307317_10024119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1873 | Open in IMG/M |
| 3300028755|Ga0307316_10022914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2004 | Open in IMG/M |
| 3300028875|Ga0307289_10025553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2301 | Open in IMG/M |
| 3300029636|Ga0222749_10091744 | Not Available | 1413 | Open in IMG/M |
| 3300030988|Ga0308183_1135547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 594 | Open in IMG/M |
| 3300031543|Ga0318516_10359508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 840 | Open in IMG/M |
| 3300031543|Ga0318516_10607701 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031545|Ga0318541_10074326 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300031545|Ga0318541_10104824 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1521 | Open in IMG/M |
| 3300031573|Ga0310915_10160866 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300031573|Ga0310915_10402950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2 | 971 | Open in IMG/M |
| 3300031573|Ga0310915_10515927 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300031573|Ga0310915_10621083 | Not Available | 765 | Open in IMG/M |
| 3300031708|Ga0310686_100722458 | Not Available | 977 | Open in IMG/M |
| 3300031708|Ga0310686_102181368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1582 | Open in IMG/M |
| 3300031708|Ga0310686_109949807 | Not Available | 586 | Open in IMG/M |
| 3300031708|Ga0310686_110416449 | Not Available | 572 | Open in IMG/M |
| 3300031719|Ga0306917_11447467 | Not Available | 529 | Open in IMG/M |
| 3300031736|Ga0318501_10006856 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4142 | Open in IMG/M |
| 3300031744|Ga0306918_10104776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2020 | Open in IMG/M |
| 3300031744|Ga0306918_10145619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1744 | Open in IMG/M |
| 3300031744|Ga0306918_10965786 | Not Available | 662 | Open in IMG/M |
| 3300031754|Ga0307475_10633479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 855 | Open in IMG/M |
| 3300031763|Ga0318537_10401840 | Not Available | 505 | Open in IMG/M |
| 3300031768|Ga0318509_10612224 | Not Available | 606 | Open in IMG/M |
| 3300031778|Ga0318498_10504036 | Not Available | 533 | Open in IMG/M |
| 3300031781|Ga0318547_10411957 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031821|Ga0318567_10508413 | Not Available | 684 | Open in IMG/M |
| 3300031833|Ga0310917_10477999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2 | 848 | Open in IMG/M |
| 3300031833|Ga0310917_10597262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 750 | Open in IMG/M |
| 3300031833|Ga0310917_10941313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 580 | Open in IMG/M |
| 3300031858|Ga0310892_10291290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1025 | Open in IMG/M |
| 3300031879|Ga0306919_11334576 | Not Available | 542 | Open in IMG/M |
| 3300031890|Ga0306925_10118309 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300031890|Ga0306925_10133867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2660 | Open in IMG/M |
| 3300031890|Ga0306925_10367348 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300031890|Ga0306925_10452173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1372 | Open in IMG/M |
| 3300031890|Ga0306925_11347950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 706 | Open in IMG/M |
| 3300031897|Ga0318520_10617570 | Not Available | 675 | Open in IMG/M |
| 3300031910|Ga0306923_10233981 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300031910|Ga0306923_10685527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1142 | Open in IMG/M |
| 3300031910|Ga0306923_11093332 | Not Available | 859 | Open in IMG/M |
| 3300031912|Ga0306921_10092739 | Not Available | 3490 | Open in IMG/M |
| 3300031912|Ga0306921_10773292 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300031912|Ga0306921_11171579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 857 | Open in IMG/M |
| 3300031912|Ga0306921_11478518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300031912|Ga0306921_11885005 | Not Available | 640 | Open in IMG/M |
| 3300031941|Ga0310912_10147499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1773 | Open in IMG/M |
| 3300031942|Ga0310916_10229801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1559 | Open in IMG/M |
| 3300031945|Ga0310913_10334819 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300031946|Ga0310910_10135323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1871 | Open in IMG/M |
| 3300031946|Ga0310910_10368371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1136 | Open in IMG/M |
| 3300031947|Ga0310909_11527191 | Not Available | 531 | Open in IMG/M |
| 3300031954|Ga0306926_10134524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3057 | Open in IMG/M |
| 3300031959|Ga0318530_10000300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 10335 | Open in IMG/M |
| 3300032001|Ga0306922_10274578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1811 | Open in IMG/M |
| 3300032001|Ga0306922_12149684 | Not Available | 539 | Open in IMG/M |
| 3300032035|Ga0310911_10395521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 799 | Open in IMG/M |
| 3300032059|Ga0318533_10033600 | Not Available | 3343 | Open in IMG/M |
| 3300032059|Ga0318533_10616051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 796 | Open in IMG/M |
| 3300032059|Ga0318533_10647621 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300032059|Ga0318533_10872151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 660 | Open in IMG/M |
| 3300032076|Ga0306924_10107547 | Not Available | 3161 | Open in IMG/M |
| 3300032076|Ga0306924_10580919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300032076|Ga0306924_10966280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 937 | Open in IMG/M |
| 3300032076|Ga0306924_11137797 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300032160|Ga0311301_10232979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3076 | Open in IMG/M |
| 3300032160|Ga0311301_11810982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300032160|Ga0311301_12384760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 598 | Open in IMG/M |
| 3300032261|Ga0306920_100140117 | Not Available | 3600 | Open in IMG/M |
| 3300032261|Ga0306920_100331834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2264 | Open in IMG/M |
| 3300032261|Ga0306920_100734384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1453 | Open in IMG/M |
| 3300032261|Ga0306920_101566605 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300032261|Ga0306920_103020871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300032261|Ga0306920_103413334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 589 | Open in IMG/M |
| 3300033290|Ga0318519_10192478 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.70% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.63% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.11% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.55% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.55% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.55% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.04% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.04% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.04% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.04% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.04% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.52% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.52% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.52% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.52% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.52% |
| Prairie Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Prairie Soil | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2170459015 | Litter degradation PV4 | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006283 | Prairie soil microbial communities from Kansas, USA, after rainfall - K15 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022507 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300027634 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030988 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_01743330 | 2088090014 | Soil | MLKLDASIFGVELPVGLGVVGIAVMLPGGDFVDDDLFVGNTAIEALRC |
| 4PV_04194520 | 2170459015 | Switchgrass, Maize And Mischanthus Litter | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR |
| AF_2010_repII_A1DRAFT_100171301 | 3300000597 | Forest Soil | MLKFDASIFGGELPVGVGVVGIAVVLPGGNFVDEDLFVGNAAVGALGR* |
| AF_2010_repII_A001DRAFT_100784544 | 3300000793 | Forest Soil | MLKFDASIFGGELPVGLCVVGIAVALPGGDFVDENLFVGNAAIEA |
| JGI12627J18819_100712612 | 3300001867 | Forest Soil | ASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEALRR* |
| JGIcombinedJ51221_100292422 | 3300003505 | Forest Soil | MLKFEAMIFGGELPIGLGVIGIAVVLPRGDFLDEGLFVGNAAIEAPGR* |
| Ga0062387_1011494991 | 3300004091 | Bog Forest Soil | MLESDAGIFGGELPVGFGVFGIAVVLPVGDFVDECLFVGNAAIEALG |
| Ga0066683_102956075 | 3300005172 | Soil | MLKFDASIFGGELPVGLGVGGIAVVLPGGDFLDEDLFVGN |
| Ga0066685_101178134 | 3300005180 | Soil | MLKFDASIFGGELPVGLGVVGVAVVLPGGDFLDEDLFVGNAAIEALGR* |
| Ga0066678_103183523 | 3300005181 | Soil | MLKFDASIFGGELPVGLGVIGIAVVLPGGDFVDEDLFVGNAAIEALGR* |
| Ga0066388_1056945581 | 3300005332 | Tropical Forest Soil | MLKFDAGIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEAL |
| Ga0070709_113671532 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEFDTSVSGGEVPI*LGVTDIAVVLPGGDFVDERLFVGNAAVEALGGKDAKLG |
| Ga0070713_1002577812 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKLDASIFGVELPVGLGVVGIAVMLPGGDFVDDDLFVGNTAIEALRC* |
| Ga0066682_107174573 | 3300005450 | Soil | MLKFDASIFGGELPVGLGVGGIAVVLPGGDFLDEDLFVGNTAIEALGR* |
| Ga0070706_1007791033 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKFDACVGCCEVPTGFGVGGIAVVLPGGDFVDEGLFVGDAAVEALG |
| Ga0066697_104562761 | 3300005540 | Soil | MLKFDASIFGGELPVGLGVVGVAVVLPGGDFLDEDL |
| Ga0070704_1011431241 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR* |
| Ga0066701_100937291 | 3300005552 | Soil | MLKFDASIFGGELPVGLGVFGIAVVLPGGDFVDEELFVGNAAIEALGR* |
| Ga0066695_108823491 | 3300005553 | Soil | MLEFDASIFCGELPVGLGVVGIAVVLPGGDFFDEG |
| Ga0070664_1013985751 | 3300005564 | Corn Rhizosphere | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNA |
| Ga0070763_100356603 | 3300005610 | Soil | MLEFDASIFCGELPVSLGVAGITVVLPGVDFLDESCFVGNAAIEALGR* |
| Ga0066905_1001899972 | 3300005713 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGSAVVLPGGDFVDEDLFVGNAATGQGPDGVSNQF* |
| Ga0066905_1018304362 | 3300005713 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFV |
| Ga0066903_1004098603 | 3300005764 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAIVLPGGDFVDEDLFVGN |
| Ga0066903_1019246702 | 3300005764 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFLYEDLFVGNAAIEALGR* |
| Ga0066903_1054022993 | 3300005764 | Tropical Forest Soil | MFKFGASIFGGELPVGLGVVGIAVVPPGGDFVDEDLFVGNT |
| Ga0066903_1069676272 | 3300005764 | Tropical Forest Soil | MPKFDESIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNVAIEALRR* |
| Ga0070717_114524632 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLKFDASIFGRELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALG |
| Ga0075017_1005517322 | 3300006059 | Watersheds | MLESDAGIFGGELPVGFGVVGIAVVLPGGDFVDERLFVGNAAIEALGC* |
| Ga0075030_1004964681 | 3300006162 | Watersheds | MLKFDTSAFGSEVPVRLGVTDIAVVLPGGDFVDERLFVGNAAVEAL |
| Ga0075014_1000036701 | 3300006174 | Watersheds | MLKFDTSAFGGEVPVRLGVTDIAVVLPGGDFVDERLFVG |
| Ga0099601_100776372 | 3300006283 | Prairie Soil | MLKFDASIFGGELPVGLGVVGIAVMLPGGDFVDEDLFVGNAAVEALGR* |
| Ga0066653_100172441 | 3300006791 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFLDED |
| Ga0066665_101562663 | 3300006796 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFLDEDLFVGNAAIE |
| Ga0066665_104020731 | 3300006796 | Soil | MLEFDTCIGGCEVPIGLGVVGVAVALPGGDFLDEGLFVGNPA |
| Ga0066660_113333842 | 3300006800 | Soil | VLEFDACIGGCEVPVGLGVVGIAVVLPGGDFVDEGLFVGDAPVEALGR* |
| Ga0075428_1012309992 | 3300006844 | Populus Rhizosphere | MLKFDASIFGGELPVSLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGG |
| Ga0075428_1013579901 | 3300006844 | Populus Rhizosphere | MLKFDASVFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALG |
| Ga0075424_1009941871 | 3300006904 | Populus Rhizosphere | KFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNVAIEALGR* |
| Ga0066710_1009437132 | 3300009012 | Grasslands Soil | MLEFDASIFGGELPVGLGVIGIAVVLPGGDFLDEDLFVGNAAI |
| Ga0099830_118225832 | 3300009088 | Vadose Zone Soil | MLEFDTCIGGCEVPVSLGVVGIAVLLPCGDFLDECLFVGNPAVEALAR* |
| Ga0126382_117280533 | 3300010047 | Tropical Forest Soil | MLKFDASIFGGELPIGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR* |
| Ga0134063_105703831 | 3300010335 | Grasslands Soil | MLEFDASIFCAELPVGLGVVGIAVVLPSGDFFDEGFFVGNPAIETLGR |
| Ga0126376_100702443 | 3300010359 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAVEALGR* |
| Ga0105239_135449151 | 3300010375 | Corn Rhizosphere | MLKLDASIFGVELPVGLGVVGIAVVLPGDDFVDEDLFVGNTAIEALRC* |
| Ga0126383_125648071 | 3300010398 | Tropical Forest Soil | MLKFDASVFGGELPVGLGVVGIAVVLPGGDFLDEDLFVGNAAIEALGR |
| Ga0137362_109790081 | 3300012205 | Vadose Zone Soil | MLKFDASIFGGELPVSLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR* |
| Ga0137362_116410631 | 3300012205 | Vadose Zone Soil | VLQFDTSIRGCEVPIGLGVVGIAVVLPSSDFLDEG |
| Ga0137370_101669741 | 3300012285 | Vadose Zone Soil | MLEFDASIFGGELPVRLGVVGIAVVFPSGDFLDEDLFVGNAAKLVEADD* |
| Ga0137395_111758641 | 3300012917 | Vadose Zone Soil | MLEFDACIGGGEVPVGLCVVGIAVVLPGGDFVDECLLVGDAAIETLGR* |
| Ga0164298_108877822 | 3300012955 | Soil | VLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVENTAIEALRR* |
| Ga0182015_106440932 | 3300014495 | Palsa | MLEFDASIFCGELPVGLGVVGIAVMLPGGDFLDEGFLVGNAAIEALGR* |
| Ga0180063_11818001 | 3300014885 | Soil | VFELDAGIGGGEVPVCFGVIGIAVVLPGGDFVAEGLFVGDAAIEAL* |
| Ga0134089_104960381 | 3300015358 | Grasslands Soil | MLEFDASIFCGELPVGLGVVGIAVVLPSGDFFDEGFF |
| Ga0132256_1023042222 | 3300015372 | Arabidopsis Rhizosphere | MLKFDTSAFGGEVSVRLGVTDIAVVLPGGDFVDERL |
| Ga0132257_1017389962 | 3300015373 | Arabidopsis Rhizosphere | MLKFDASIFGGELLVGLGVVGIAVVLPGGDLVDED |
| Ga0182036_101892121 | 3300016270 | Soil | MLKFDASIFGGELPVGLGVVGIAVMLPGGNFVDEDLFVGNTAIEALRR |
| Ga0182036_102802411 | 3300016270 | Soil | MLEFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDL |
| Ga0182036_112598751 | 3300016270 | Soil | LKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAVEALGR |
| Ga0182036_114873111 | 3300016270 | Soil | MLKFDASIFGGEMPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEALRR |
| Ga0182041_101878111 | 3300016294 | Soil | MLEFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFV |
| Ga0182041_103273812 | 3300016294 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPDGDFVDEELFVGNAAIEALGR |
| Ga0182041_109266611 | 3300016294 | Soil | ASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALRR |
| Ga0182033_101126433 | 3300016319 | Soil | MLKFDASIFGGELPVGLCGVGIAVVLLGGNFVDEDLFVGNAAVEALGR |
| Ga0182033_106080113 | 3300016319 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFVG |
| Ga0182033_119356842 | 3300016319 | Soil | MLKFDAGIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALG |
| Ga0182035_102625374 | 3300016341 | Soil | MLKFDASIFGCELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEA |
| Ga0182035_104762842 | 3300016341 | Soil | MLKFDASIFGGELPVGLGVVGIAVVPPGGNFVDEDLFVGNAAVEALGR |
| Ga0182032_101128234 | 3300016357 | Soil | MLKFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFVGNA |
| Ga0182032_108664332 | 3300016357 | Soil | MLKFDASIFGGELPVGLGVVGIAVMLPGGNFVDEDLFVGNTAI |
| Ga0182034_101902301 | 3300016371 | Soil | MLEFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFVGNAAI |
| Ga0182034_105959991 | 3300016371 | Soil | MLKFNASIFGGELPVGLGVVGIAVVLPGGDFVDEDL |
| Ga0182040_114623271 | 3300016387 | Soil | VLKFDASIFGGELPVGLGVVGISVVLPGGDFADEDLFVGNTAVEALRR |
| Ga0182039_105524972 | 3300016422 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVEEDLFVG |
| Ga0182039_106146031 | 3300016422 | Soil | MLKFDASIFGGELPVGLCVVGIAVALPGGDFVDENLFVGNAAIEALGR |
| Ga0182039_114460012 | 3300016422 | Soil | MLKFDAGIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNA |
| Ga0182038_102236154 | 3300016445 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAA |
| Ga0182038_103117041 | 3300016445 | Soil | MLKFDASIFGGEMPVGLGVVGIAVVLPGGDFVDEDLF |
| Ga0182038_107769571 | 3300016445 | Soil | MLKFDAGIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGN |
| Ga0163161_109877432 | 3300017792 | Switchgrass Rhizosphere | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAA |
| Ga0187825_100717021 | 3300017930 | Freshwater Sediment | MLEFDASIFCGELPVGLGVVGIAVVLPGGDFLDEGVFVRNAAFEALGR |
| Ga0187819_108254172 | 3300017943 | Freshwater Sediment | MFKFDTSAFGSEVPVRLGVTDIAVVLPGGDFVDERLFV |
| Ga0187766_106944292 | 3300018058 | Tropical Peatland | MLEFNASVVGGEVPVGFGVLSIAVALPGSDFVDEGLLVGNSTVEAL |
| Ga0184640_104476212 | 3300018074 | Groundwater Sediment | MLEFDACVGCCEVPVGLGVVGIAVVLPGGDFVDEGLLVGNAAVEALGR |
| Ga0066655_108758631 | 3300018431 | Grasslands Soil | MLKFDASMFGGELPVGLGVVGIAVVLPGGDFLDEDLFVGNAAIE |
| Ga0066667_113372312 | 3300018433 | Grasslands Soil | MLEFDASIFGGELPVGLGVIGIAVVLPGGDFLDEDLFVGNAAIEALGR |
| Ga0190269_111507131 | 3300018465 | Soil | ASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEAL |
| Ga0066669_103350993 | 3300018482 | Grasslands Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEALRR |
| Ga0210394_105505741 | 3300021420 | Soil | MLESDAGIFGGELPVGFGVIGIAVVLPRGDLVDECLFVGNAAIEAL |
| Ga0210392_103663432 | 3300021475 | Soil | MLKFEATIFGGELPIGLGVIGIAVVLPRGDFLDEGLFVGNATIEALGR |
| Ga0210410_102639903 | 3300021479 | Soil | MLEFDASIFCGELPVGLGVVGIAVVLPGGDFLDESCFVGNA |
| Ga0126371_112533621 | 3300021560 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFVGNAAIEAL |
| Ga0126371_113005741 | 3300021560 | Tropical Forest Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDED |
| Ga0126371_125732772 | 3300021560 | Tropical Forest Soil | VLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGN |
| Ga0222729_10293202 | 3300022507 | Soil | MLEFDASIFCGELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEAL |
| Ga0242656_11052541 | 3300022525 | Soil | MLEFDAGIFRGELPIGFGVVGIAVVLPGGDFVDECLFVGNAAIEALGC |
| Ga0242653_10674482 | 3300022712 | Soil | MLEFDAGIFRGELPIGFGVVGIAVVLPGGDFVDECLFVGNTAIEALAC |
| Ga0224562_10235832 | 3300022733 | Soil | MLESDAGIFGGELPVGFGVVGIAVVLPGGNFVDECLFVGNTAIEALGC |
| Ga0179591_11832874 | 3300024347 | Vadose Zone Soil | MLKFDASIFGRELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR |
| Ga0207933_12000791 | 3300025679 | Arctic Peat Soil | VLEFDTRIRCGELPVCDSVIGISVVLPGGDFVDEGLLVG |
| Ga0207684_105300202 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKFDACVGCCEVPTGFGVGGIAVVLPGGDFVDEGLFVGDAAVEALGR |
| Ga0209240_10368321 | 3300026304 | Grasslands Soil | MLKFDASIFGRELPVGLGVVGIAVVLPGGDFVDEDLF |
| Ga0209468_10628611 | 3300026306 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFLDEDLFVGNAAIEALGR |
| Ga0209647_101661610 | 3300026319 | Grasslands Soil | MLKFDASIFGRELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGG |
| Ga0209687_10416741 | 3300026322 | Soil | MLKFDASIFGGELPVGRGVVGVAVVLPGGDFLNEDLFV |
| Ga0209804_13352961 | 3300026335 | Soil | MLKFDASIFGGELPVGLGVVSIAVVLPGGDFVDEDLFVGNTAIEALRR |
| Ga0209905_10913211 | 3300027634 | Thawing Permafrost | MLEFDAGIGGCEVPVCHGVVDIPVVLPGGDFLDEGL |
| Ga0209656_100336635 | 3300027812 | Bog Forest Soil | VEALEFYASVWGCEAPIGLGVIGIAVVLPGGDFLDEGLFVGDAAIEALGR |
| Ga0209380_100796101 | 3300027889 | Soil | MLKFEAMIFGGELPIGLGVIGIAVVLPRGDFLDEGLFVGNAA |
| Ga0209048_102279781 | 3300027902 | Freshwater Lake Sediment | VLEFDTGILSCKLPVGLGVVGIAIELPSGDFLDKSLFVGNPAVEALGR |
| Ga0209488_111729011 | 3300027903 | Vadose Zone Soil | MLEFDACVGGGEVPVCLGVVGIAVVLPGSDFVDEGLFVWDAA |
| Ga0209698_100698313 | 3300027911 | Watersheds | MLKFEARIFGGELPIGLCVIGIAVVLPRGDFLDEGLFVGNAAIEALGR |
| Ga0209698_105841411 | 3300027911 | Watersheds | MLKFDTSAFGSEVPVRLGVTDIAVVLPGGDFVDERLFVGNAAV |
| Ga0209069_101404681 | 3300027915 | Watersheds | MLKFEARIFGGELPIGLGVIGIAVVLPRGDFLDEGLFVGNAAIE |
| Ga0209069_110555282 | 3300027915 | Watersheds | MLEFDACIGRREVPIGLGVIGIAVVLPSGNFVDEGLVVGYAAVEALGR |
| Ga0209526_100063549 | 3300028047 | Forest Soil | MLKFDASIFGGELPVGFGVVGIAVVLPGGDFIDED |
| Ga0307317_100241191 | 3300028720 | Soil | DTSIGGCEVPVGFGVVGIAVVLPGGDFLDEGPPTAL |
| Ga0307316_100229141 | 3300028755 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGEFVDEDLFV |
| Ga0307289_100255531 | 3300028875 | Soil | KILEFDTSIGGCEVPVGFGVVGIAVVLPGGDFLDEGPPTAL |
| Ga0222749_100917442 | 3300029636 | Soil | MLKFEAMIFGGELPIGLGVIGIAVALPRGDFLDEGLFVGNAAIEALGR |
| Ga0308183_11355472 | 3300030988 | Soil | MLEFDTSIGGCEVPVGFGVVGIAVVLPGGDFLDEGCFIGNPAVEALGR |
| Ga0318516_103595081 | 3300031543 | Soil | MVKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGN |
| Ga0318516_106077012 | 3300031543 | Soil | MRAFFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAVEALG |
| Ga0318541_100743261 | 3300031545 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLLGGNFVDEDLFVGNAAVEALGR |
| Ga0318541_101048241 | 3300031545 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAIEALGR |
| Ga0310915_101608664 | 3300031573 | Soil | MLEFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFVGN |
| Ga0310915_104029501 | 3300031573 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFV |
| Ga0310915_105159271 | 3300031573 | Soil | MLKFDASIFAGELPVGLGVVGIAVVLPGGDFVDEDLFV |
| Ga0310915_106210831 | 3300031573 | Soil | MLKFGASIFGGELPVGLGVVGIAVMLPGGNFVDEDLF |
| Ga0310686_1007224583 | 3300031708 | Soil | MLESDAGIFGGELPVGSGMVCIAVVPPGGDFVDECLFVGNTA |
| Ga0310686_1021813686 | 3300031708 | Soil | MLEFDASIFCGELPVGLGVVGIAVVLPGGDLLDESCFVGNAAIEALGR |
| Ga0310686_1099498071 | 3300031708 | Soil | MLESGAGIFGGELPVGSGMVCIAVVPPGGDFVDECLFVGNTA |
| Ga0310686_1104164491 | 3300031708 | Soil | MLKFEAMIFGGELPIGLGVIGIAVVLPRGDFLDEGLFVGNAAIE |
| Ga0306917_114474671 | 3300031719 | Soil | MLKFDASIFGGELPVGLGVVGIAVALPGGDFVDEDLFVGNAAIEALGR |
| Ga0318501_100068561 | 3300031736 | Soil | MLKFDASTFGGELPVGLGVVGIAVMLPGGNFVDEDLFVGNTAIEALRR |
| Ga0306918_101047761 | 3300031744 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLLGGNFVDEDLFVG |
| Ga0306918_101456194 | 3300031744 | Soil | MLKFDASIFGCELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEALGR |
| Ga0306918_109657861 | 3300031744 | Soil | MLKFDASIFGGELPVGLGVVGNAIMLPGGDFVDEDLFVGNTAIEALRR |
| Ga0307475_106334791 | 3300031754 | Hardwood Forest Soil | MLEFDASIFCGELPVGLGVVGIAVVLPGGDFLDESCFVGNAAIEALGG |
| Ga0318537_104018401 | 3300031763 | Soil | MLKFDASIFGGELPVGLGMVGIAVVLPGGNFVDEDLFVGNTAIEALRSTQQLQCF |
| Ga0318509_106122241 | 3300031768 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALG |
| Ga0318498_105040361 | 3300031778 | Soil | MLKFNASIFGGELPVGLGVVGIAVVLPGGDFVDEDLF |
| Ga0318547_104119573 | 3300031781 | Soil | MLKFDASIFGGELPVGLGVVGIAVVPPGGNFVDEDLFVGNAAVEA |
| Ga0318567_105084131 | 3300031821 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGSDLVDEDLFVGNTAIEAL |
| Ga0310917_104779991 | 3300031833 | Soil | MLMFDASIFGGELPVGLGVVGIAVVLPGGDFVDED |
| Ga0310917_105972621 | 3300031833 | Soil | MLKFDASIFGGELPVGLGVVGITVVLPGGDFVDEDLFVGNAAIEALGR |
| Ga0310917_109413132 | 3300031833 | Soil | MLKFDASIFGGEMPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEAL |
| Ga0310892_102912902 | 3300031858 | Soil | MFKFDACVGGCEVPVGLSMGGIAVALPGGDFVDEIVCQGC |
| Ga0306919_113345761 | 3300031879 | Soil | MLKFDASIFGGELPVGLGVVGFAVVLPGGDFVDEDLFVGNAAIEA |
| Ga0306925_101183095 | 3300031890 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVEEDLFVGNAAIEALGR |
| Ga0306925_101338676 | 3300031890 | Soil | MLKFDASIFGCELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAI |
| Ga0306925_103673482 | 3300031890 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVEEDLFVGNAAIEALGR |
| Ga0306925_104521734 | 3300031890 | Soil | MLKFDASIFSGELPVGLGVVGIAVVLPGGDFVEEDLSVGNTAIEALRR |
| Ga0306925_113479502 | 3300031890 | Soil | MLKFDASIFGGELPVGLGVVGIAIVLPGDDFVDEDLFVGNAAIEALGR |
| Ga0318520_106175702 | 3300031897 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAVEALGR |
| Ga0306923_102339811 | 3300031910 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNA |
| Ga0306923_106855271 | 3300031910 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFADEDLFVGNAAIEALGR |
| Ga0306923_110933321 | 3300031910 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLF |
| Ga0306921_100927391 | 3300031912 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIE |
| Ga0306921_107732922 | 3300031912 | Soil | MLKFDASIFGGELPVGLGVVGVAVVLLGGNFVDEDLFVGDAAVEALGR |
| Ga0306921_111715792 | 3300031912 | Soil | MLKFDASIFGGELPVGLGVVGITVVLPGGDFVDEDLFLGNAAI |
| Ga0306921_114785181 | 3300031912 | Soil | VLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAA |
| Ga0306921_118850051 | 3300031912 | Soil | MLKFDASIFAGELPVGLGVVGIAVVLPGGDFVDEDLFVGNT |
| Ga0310912_101474993 | 3300031941 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLLGGNFVDEDLFV |
| Ga0310916_102298012 | 3300031942 | Soil | MLKFDASIFGGELPVGLGVVGDFVDEDLFVGNTAIEALRR |
| Ga0310913_103348191 | 3300031945 | Soil | MLEFDASIFGGELPVGLGVVGIAIMLPGGDFVDEDLFVGNAAIE |
| Ga0310910_101353231 | 3300031946 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLLGGNFVDEDLFVGNAAVE |
| Ga0310910_103683711 | 3300031946 | Soil | DASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAIEALGR |
| Ga0310909_115271912 | 3300031947 | Soil | MLRFDASIFGGELPVGLGVVGISVVLPGGNFVDEELFVGNAAVEALG |
| Ga0306926_101345244 | 3300031954 | Soil | MLKFDASIFGGELPVGLGVVGIAAVLPGGDFVDEDLFVGNAAIEALGR |
| Ga0318530_1000030014 | 3300031959 | Soil | VLKFGASIFGGELPVGLGVVGIAVVPPGGDFVDEDLFVGNTAR |
| Ga0306922_102745781 | 3300032001 | Soil | MLKIDASIFGGELPVGLGVVGVAVVLLGGNFVDEDLFVGDAAVEALGR |
| Ga0306922_121496841 | 3300032001 | Soil | VLKFGASIFGGELPVGLGVVGIAVMPPGGDFVDEDLFVGNTAIE |
| Ga0310911_103955211 | 3300032035 | Soil | MLKFDASIFGGELPVGLGVVGNAIMLPGGDFVDED |
| Ga0318533_100336001 | 3300032059 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDL |
| Ga0318533_106160511 | 3300032059 | Soil | MLKFDASIFGGELPVGLGVVGVAVVLLGGNFVDEDLFIG |
| Ga0318533_106476213 | 3300032059 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEA |
| Ga0318533_108721511 | 3300032059 | Soil | MRAFFGGELPVGLGVVGIAVVLPGGNFVDEDLFVGNAAVEALGR |
| Ga0306924_101075471 | 3300032076 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGN |
| Ga0306924_105809191 | 3300032076 | Soil | MLKFDASIFGGELPVGPGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR |
| Ga0306924_109662801 | 3300032076 | Soil | MLKFDAGIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNAAIEALGR |
| Ga0306924_111377972 | 3300032076 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVGNTAI |
| Ga0311301_102329794 | 3300032160 | Peatlands Soil | MLESDAGIFGGELPVGFGVVGIAVVLPGGDFVDECLFVGDAAIEAPGC |
| Ga0311301_118109822 | 3300032160 | Peatlands Soil | MPESDAGIFGGELPVGFGVVGIAVVLPGGDFVDECLLVGNTA |
| Ga0311301_123847601 | 3300032160 | Peatlands Soil | MLEFDAGIFRGELPIGFGVVGIAVVLPGGDFVDECLF |
| Ga0306920_1001401171 | 3300032261 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVG |
| Ga0306920_1003318342 | 3300032261 | Soil | VLKFGASIFGGELPVGLGVVGIAVVPPGGDFVDEDLFVGNAAIEALRR |
| Ga0306920_1007343843 | 3300032261 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLPGGDFVDEDLFVG |
| Ga0306920_1015666051 | 3300032261 | Soil | MLKFDASIFGGELPVGLGVVGIAVMLPGGNFVDEDLFVGNSAIEALRR |
| Ga0306920_1030208712 | 3300032261 | Soil | MLKFDASIFGGELPVGLGVVGITVVLPGGDFVDEDLFVGNAAI |
| Ga0306920_1034133341 | 3300032261 | Soil | MLKFDASIFGGELPVGLGVVGIAVVLLGGNFVDEDLFVGDAAVEALGR |
| Ga0335071_107955951 | 3300032897 | Soil | MLEFDTGIRCGELPVGVGVVGISIILPSCDFVDIDPAR |
| Ga0318519_101924783 | 3300033290 | Soil | MLEFDASIFGGELPVGLGVVGIAVVLPGGDFVDED |
| ⦗Top⦘ |