


| Basic Information | |
|---|---|
| Family ID | F027607 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 194 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG |
| Number of Associated Samples | 158 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.09 % |
| % of genes near scaffold ends (potentially truncated) | 95.88 % |
| % of genes from short scaffolds (< 2000 bps) | 81.96 % |
| Associated GOLD sequencing projects | 143 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.454 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (20.619 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.804 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.938 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.48% β-sheet: 0.00% Coil/Unstructured: 51.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF04134 | DCC1-like | 68.56 |
| PF05656 | DUF805 | 7.73 |
| PF12802 | MarR_2 | 2.06 |
| PF07681 | DoxX | 2.06 |
| PF13439 | Glyco_transf_4 | 1.55 |
| PF11066 | DUF2867 | 1.03 |
| PF14158 | YndJ | 1.03 |
| PF13460 | NAD_binding_10 | 1.03 |
| PF17209 | Hfq | 1.03 |
| PF08338 | DUF1731 | 0.52 |
| PF03795 | YCII | 0.52 |
| PF13813 | MBOAT_2 | 0.52 |
| PF03061 | 4HBT | 0.52 |
| PF03668 | ATP_bind_2 | 0.52 |
| PF07291 | MauE | 0.52 |
| PF04237 | YjbR | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 68.56 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 7.73 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 2.06 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 2.06 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 0.52 |
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 0.52 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.52 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.45 % |
| Unclassified | root | N/A | 1.55 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_105855847 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300000955|JGI1027J12803_107582552 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100906156 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300002917|JGI25616J43925_10079823 | All Organisms → cellular organisms → Bacteria | 1372 | Open in IMG/M |
| 3300004092|Ga0062389_100021495 | All Organisms → cellular organisms → Bacteria | 4563 | Open in IMG/M |
| 3300004092|Ga0062389_103400742 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300004092|Ga0062389_103535892 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005434|Ga0070709_11109722 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005434|Ga0070709_11330972 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005439|Ga0070711_101630502 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005529|Ga0070741_10260370 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
| 3300005559|Ga0066700_10165540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1508 | Open in IMG/M |
| 3300005561|Ga0066699_10037222 | All Organisms → cellular organisms → Bacteria | 2881 | Open in IMG/M |
| 3300005561|Ga0066699_10042689 | All Organisms → cellular organisms → Bacteria | 2730 | Open in IMG/M |
| 3300005561|Ga0066699_11044327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300005586|Ga0066691_10267120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
| 3300005591|Ga0070761_10318813 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005610|Ga0070763_10644500 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005610|Ga0070763_10702155 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005712|Ga0070764_10698912 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300005764|Ga0066903_103905482 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005841|Ga0068863_100901587 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300005921|Ga0070766_11019725 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005952|Ga0080026_10143814 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006173|Ga0070716_101089418 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300006174|Ga0075014_100422223 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006176|Ga0070765_100810354 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300006755|Ga0079222_11402925 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006755|Ga0079222_12064593 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006797|Ga0066659_10028036 | All Organisms → cellular organisms → Bacteria | 3330 | Open in IMG/M |
| 3300006797|Ga0066659_10240783 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300007255|Ga0099791_10004149 | All Organisms → cellular organisms → Bacteria | 5928 | Open in IMG/M |
| 3300007788|Ga0099795_10236991 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009038|Ga0099829_10108995 | All Organisms → cellular organisms → Bacteria | 2165 | Open in IMG/M |
| 3300009088|Ga0099830_10142432 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300009088|Ga0099830_10708338 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009098|Ga0105245_12238124 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300009137|Ga0066709_101508864 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300009143|Ga0099792_10045577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2113 | Open in IMG/M |
| 3300010043|Ga0126380_10843307 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300010048|Ga0126373_10414728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1374 | Open in IMG/M |
| 3300010159|Ga0099796_10575523 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010343|Ga0074044_10872301 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Arachidicoccus → Arachidicoccus ginsenosidivorans | 588 | Open in IMG/M |
| 3300010360|Ga0126372_12537007 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010361|Ga0126378_11849921 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300010375|Ga0105239_11095940 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300010376|Ga0126381_100036568 | All Organisms → cellular organisms → Bacteria | 5915 | Open in IMG/M |
| 3300010376|Ga0126381_101000408 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
| 3300011269|Ga0137392_10350687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1222 | Open in IMG/M |
| 3300011270|Ga0137391_10092898 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
| 3300011271|Ga0137393_10098553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2382 | Open in IMG/M |
| 3300011271|Ga0137393_11534189 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012189|Ga0137388_11437284 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300012198|Ga0137364_10015515 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4526 | Open in IMG/M |
| 3300012203|Ga0137399_10446820 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300012205|Ga0137362_10636106 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300012207|Ga0137381_10590064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300012210|Ga0137378_10208067 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300012351|Ga0137386_10301677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300012351|Ga0137386_10629752 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300012351|Ga0137386_11117428 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300012361|Ga0137360_10918723 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300012363|Ga0137390_10136790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2431 | Open in IMG/M |
| 3300012683|Ga0137398_10986658 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012918|Ga0137396_10078498 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300012918|Ga0137396_10933537 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300012922|Ga0137394_10249094 | All Organisms → cellular organisms → Bacteria | 1519 | Open in IMG/M |
| 3300012923|Ga0137359_10329159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1359 | Open in IMG/M |
| 3300012924|Ga0137413_11313940 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300012929|Ga0137404_11126572 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300012976|Ga0134076_10016152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2601 | Open in IMG/M |
| 3300012977|Ga0134087_10202242 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300014164|Ga0181532_10029598 | All Organisms → cellular organisms → Bacteria | 3825 | Open in IMG/M |
| 3300014200|Ga0181526_10831870 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015051|Ga0137414_1027130 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300015051|Ga0137414_1082709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1451 | Open in IMG/M |
| 3300015241|Ga0137418_11279553 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300016270|Ga0182036_11848532 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300016294|Ga0182041_10757565 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300016294|Ga0182041_12248401 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300016404|Ga0182037_10086364 | Not Available | 2218 | Open in IMG/M |
| 3300016404|Ga0182037_10886997 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300016404|Ga0182037_11162810 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300017654|Ga0134069_1227149 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300017822|Ga0187802_10335343 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300017932|Ga0187814_10420678 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300017934|Ga0187803_10181950 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300017942|Ga0187808_10032850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2149 | Open in IMG/M |
| 3300017943|Ga0187819_10064057 | All Organisms → cellular organisms → Bacteria | 2184 | Open in IMG/M |
| 3300017955|Ga0187817_10311968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300017973|Ga0187780_10868540 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300017974|Ga0187777_10110804 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1810 | Open in IMG/M |
| 3300017974|Ga0187777_10678455 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300017995|Ga0187816_10233137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300018012|Ga0187810_10035661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1841 | Open in IMG/M |
| 3300018012|Ga0187810_10163187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 898 | Open in IMG/M |
| 3300018038|Ga0187855_10080538 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300018064|Ga0187773_10650484 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300018089|Ga0187774_10829534 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300018431|Ga0066655_10807257 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300019789|Ga0137408_1073028 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300019789|Ga0137408_1350609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300019887|Ga0193729_1001387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12404 | Open in IMG/M |
| 3300020579|Ga0210407_10674208 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300020579|Ga0210407_11360861 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300020580|Ga0210403_10158133 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300020583|Ga0210401_10086501 | All Organisms → cellular organisms → Bacteria | 2949 | Open in IMG/M |
| 3300021046|Ga0215015_10595348 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300021086|Ga0179596_10047005 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300021086|Ga0179596_10304271 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300021168|Ga0210406_10008016 | All Organisms → cellular organisms → Bacteria | 10634 | Open in IMG/M |
| 3300021171|Ga0210405_10379342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
| 3300021171|Ga0210405_10626297 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300021171|Ga0210405_11298770 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Arachidicoccus → Arachidicoccus ginsenosidivorans | 534 | Open in IMG/M |
| 3300021404|Ga0210389_11321990 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300021407|Ga0210383_10232761 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300021432|Ga0210384_11167153 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300021433|Ga0210391_10791889 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300021475|Ga0210392_11137060 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021476|Ga0187846_10224932 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300021478|Ga0210402_11930068 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300021559|Ga0210409_10446207 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300021559|Ga0210409_11209418 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300021560|Ga0126371_12205434 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300025501|Ga0208563_1012578 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300025906|Ga0207699_11231554 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025927|Ga0207687_11466824 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300025929|Ga0207664_11613436 | Not Available | 571 | Open in IMG/M |
| 3300025939|Ga0207665_10637028 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300025941|Ga0207711_11121673 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300026088|Ga0207641_12551284 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026318|Ga0209471_1193520 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300026330|Ga0209473_1227168 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300026334|Ga0209377_1155893 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300026490|Ga0257153_1050061 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300026530|Ga0209807_1051800 | All Organisms → cellular organisms → Bacteria | 1892 | Open in IMG/M |
| 3300026532|Ga0209160_1024781 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300026542|Ga0209805_1347426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300027313|Ga0207780_1001797 | All Organisms → cellular organisms → Bacteria | 5768 | Open in IMG/M |
| 3300027330|Ga0207777_1008856 | All Organisms → cellular organisms → Bacteria | 2171 | Open in IMG/M |
| 3300027671|Ga0209588_1208943 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027684|Ga0209626_1111048 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300027748|Ga0209689_1034721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2960 | Open in IMG/M |
| 3300027812|Ga0209656_10433441 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027862|Ga0209701_10426810 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300027867|Ga0209167_10195653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300027875|Ga0209283_10737744 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Arachidicoccus → Arachidicoccus ginsenosidivorans | 612 | Open in IMG/M |
| 3300027879|Ga0209169_10265145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 901 | Open in IMG/M |
| 3300027879|Ga0209169_10625381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300027884|Ga0209275_10811819 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027895|Ga0209624_10084586 | All Organisms → cellular organisms → Bacteria | 2057 | Open in IMG/M |
| 3300027911|Ga0209698_10243122 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300028047|Ga0209526_10346293 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300028047|Ga0209526_10962654 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300028536|Ga0137415_10007804 | All Organisms → cellular organisms → Bacteria | 10613 | Open in IMG/M |
| 3300028775|Ga0302231_10407796 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300028906|Ga0308309_10367599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1229 | Open in IMG/M |
| 3300028906|Ga0308309_11376919 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300029636|Ga0222749_10226353 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300030524|Ga0311357_10033592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5319 | Open in IMG/M |
| 3300030974|Ga0075371_10930773 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300030991|Ga0073994_12381127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300031057|Ga0170834_102141897 | Not Available | 580 | Open in IMG/M |
| 3300031090|Ga0265760_10074289 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300031128|Ga0170823_12129124 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300031231|Ga0170824_100041192 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031231|Ga0170824_126868712 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031474|Ga0170818_111413816 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031545|Ga0318541_10493108 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300031546|Ga0318538_10455959 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300031715|Ga0307476_10890357 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031720|Ga0307469_10094951 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300031720|Ga0307469_11186657 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300031736|Ga0318501_10868411 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031754|Ga0307475_10124214 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2035 | Open in IMG/M |
| 3300031779|Ga0318566_10556268 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031820|Ga0307473_10948502 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031897|Ga0318520_10884846 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031912|Ga0306921_12212650 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031947|Ga0310909_10058796 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300031962|Ga0307479_10007035 | All Organisms → cellular organisms → Bacteria | 10365 | Open in IMG/M |
| 3300031962|Ga0307479_10684454 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300031962|Ga0307479_12090067 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300032001|Ga0306922_12377942 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032043|Ga0318556_10568696 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300032076|Ga0306924_11482438 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300032180|Ga0307471_100038766 | All Organisms → cellular organisms → Bacteria | 3787 | Open in IMG/M |
| 3300032180|Ga0307471_101783504 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300032205|Ga0307472_102699849 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300032783|Ga0335079_11793823 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300032898|Ga0335072_10036347 | All Organisms → cellular organisms → Bacteria | 6786 | Open in IMG/M |
| 3300032955|Ga0335076_10532885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300032955|Ga0335076_11518445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300033158|Ga0335077_11779766 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.25% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.67% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.67% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.61% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.09% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.58% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.58% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.58% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.55% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.03% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.03% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.03% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.03% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.52% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.52% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.52% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027330 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 35 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030974 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1058558472 | 3300000955 | Soil | TAMSGLFEEIVRMPMPALKGVIKLRGKVVTLLGAKKVG* |
| JGI1027J12803_1075825521 | 3300000955 | Soil | AMTGLFDEILRMPAGTLKSVVKLKGKVVTILGAGNKKAG* |
| JGIcombinedJ26739_1009061562 | 3300002245 | Forest Soil | GLFDEVLRMPAAALKGVGKLRGKVFTLLGKKAVNS* |
| JGI25616J43925_100798233 | 3300002917 | Grasslands Soil | MLDFLTIMSGLFEEILRMPMGALKGVGKLRGKVITLLGSDKKKVG* |
| Ga0062389_1000214957 | 3300004092 | Bog Forest Soil | MLEFLTAMTGMFEEIMRMPTPALKGMVKLRGKVITLLGSEKKKTG* |
| Ga0062389_1034007421 | 3300004092 | Bog Forest Soil | FLTAMTGLFEEIIRMPTVALKGVVKLRGKVITLLGSEKKKAVG* |
| Ga0062389_1035358922 | 3300004092 | Bog Forest Soil | TPMTGLFEEIIRMPMGALKGVGKLRGRVITLLGGEKKKAG* |
| Ga0070709_111097221 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TAMTGLFEEILRMPTGALKSVVKLRGKVITLLGAEKKKAG* |
| Ga0070709_113309722 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LEFLTVMTGLFDEVLRMPTSALKGVGKLRGKVVTLLGKKAG* |
| Ga0070711_1016305021 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | EFLTAMSALFEEIVRMPMPALKGVVKLRGKVVTLLGKRAG* |
| Ga0070741_102603703 | 3300005529 | Surface Soil | LFEEVIRMPIPALKGVVKLRGKVISLLASDKKKAG* |
| Ga0066700_101655401 | 3300005559 | Soil | LTAMTGLFDEIIHMPTGALKGVVKLRGKVITLLGKKAG* |
| Ga0066699_100372225 | 3300005561 | Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGNDRKKAAG* |
| Ga0066699_100426891 | 3300005561 | Soil | REFLTAMSGLFDEAIRMPAGALKGVLKLRGKVVTMLGKKAV* |
| Ga0066699_110443272 | 3300005561 | Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAG* |
| Ga0066691_102671203 | 3300005586 | Soil | EEIIRMPTGALKGVVKLRGKVITLLGNDRKKAAG* |
| Ga0070761_103188133 | 3300005591 | Soil | MLEFLTIMTGLFDEVLRMPVAALKGVGKLRGKVVTLLGKKAANG* |
| Ga0070763_106445001 | 3300005610 | Soil | SMLEFLTIMTGLFDEVLRMPVSALKGVGKLRGKVVTLLGKKAANG* |
| Ga0070763_107021553 | 3300005610 | Soil | LFEEVVKMPTGALKGAMKLRGKVVTLLGQKKAANV* |
| Ga0070764_106989123 | 3300005712 | Soil | EFLTGMTGLFEEVVKMPTGALKGAMKLRGKVVTLLGQKKAANG* |
| Ga0066903_1039054821 | 3300005764 | Tropical Forest Soil | SMLEFLTAMSGLFEEIVRMPMPALKGVVKLRGKVVTLLGKRAG* |
| Ga0068863_1009015871 | 3300005841 | Switchgrass Rhizosphere | VMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGKKAG* |
| Ga0070766_110197252 | 3300005921 | Soil | TGLFDEVLRMPTTALKGVGKLRGKVFTLLGKKAG* |
| Ga0080026_101438142 | 3300005952 | Permafrost Soil | LTAMTGLFEEVLRMPTGALKSVVKLRGKVVTLLGKKAG* |
| Ga0070716_1010894182 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | SGLFEEVLRMPMGALKGVGKLRGKVITLLGSEKKKVG* |
| Ga0075014_1004222233 | 3300006174 | Watersheds | GLFEEVLRMPVGALKGVGKLRGKVITLLGTDKKKAV* |
| Ga0070765_1008103542 | 3300006176 | Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGSDKKKAVNS* |
| Ga0079222_114029252 | 3300006755 | Agricultural Soil | LTDMREFLTAMSGLFDEAIRIPAGTLKGVLKLRGKVVTMLGKKAM* |
| Ga0079222_120645932 | 3300006755 | Agricultural Soil | TAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSSKAKVAG* |
| Ga0066659_100280361 | 3300006797 | Soil | AMTGLFEEIIRMPTGALKGVVKLRGKVITLLGTEKKKATG* |
| Ga0066659_102407831 | 3300006797 | Soil | LTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAG* |
| Ga0099791_100041497 | 3300007255 | Vadose Zone Soil | EFLTAMTGLFEEIIRMPTAALKGVVKLRGKVITLLGKKAANG* |
| Ga0099795_102369911 | 3300007788 | Vadose Zone Soil | MTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0099829_101089954 | 3300009038 | Vadose Zone Soil | TGLFEEILRMPTGALKGVVKLRGKVITLLGAGKAKIAG* |
| Ga0099830_101424323 | 3300009088 | Vadose Zone Soil | LTAMTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0099830_107083383 | 3300009088 | Vadose Zone Soil | LFEEILRMPTGALKGVVKLRGKVISLLGPEKKKAG* |
| Ga0105245_122381242 | 3300009098 | Miscanthus Rhizosphere | TVMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGKKAG* |
| Ga0066709_1015088643 | 3300009137 | Grasslands Soil | AAMTGLFDEILRMLAGTLKSVGELRGKVVTILGAGNKKAG* |
| Ga0099792_100455774 | 3300009143 | Vadose Zone Soil | LEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSRKTKAAG* |
| Ga0126380_108433071 | 3300010043 | Tropical Forest Soil | GMFEEVLRMPAGALKGVAKLRGKVITLLGNSTKKAAS* |
| Ga0126373_104147284 | 3300010048 | Tropical Forest Soil | AMTGLFEEVIRMPAGALKGVLKLRGKVVTMLGKKAG* |
| Ga0099796_105755232 | 3300010159 | Vadose Zone Soil | LFEEIIRMPTVALKGVVKLRGKVITLLSSSKTRAAG* |
| Ga0074044_108723012 | 3300010343 | Bog Forest Soil | GLFDEVLRMPTSALKGVGKLRGKVFTLLGKKAANG* |
| Ga0126372_125370072 | 3300010360 | Tropical Forest Soil | SGLFEEVLRMPMGALRGVGKLRGKVITLLGSEKKKVG* |
| Ga0126378_118499212 | 3300010361 | Tropical Forest Soil | LFEEILRMPTGALKGVAKLRGKVVTILGAGNKKAG* |
| Ga0105239_110959403 | 3300010375 | Corn Rhizosphere | LEFLTVMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGKKAG* |
| Ga0126381_1000365689 | 3300010376 | Tropical Forest Soil | TGLFEEVIRMPAGALKGVLKLRGKVVTMLGKKAG* |
| Ga0126381_1010004084 | 3300010376 | Tropical Forest Soil | AMTGLFDEVIHMPAGTLKGVLKLRGKVVTMLGKKAG* |
| Ga0137392_103506871 | 3300011269 | Vadose Zone Soil | TGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAASG* |
| Ga0137391_100928985 | 3300011270 | Vadose Zone Soil | MLEFLVAMSGLFEEILRMPTGALKSVVKLRGKVITLLGTGAKKAG* |
| Ga0137393_100985534 | 3300011271 | Vadose Zone Soil | MLEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLIGSSKTKAAG* |
| Ga0137393_115341892 | 3300011271 | Vadose Zone Soil | EFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAANG* |
| Ga0137388_114372841 | 3300012189 | Vadose Zone Soil | LFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0137364_100155151 | 3300012198 | Vadose Zone Soil | LTAMTGLFEEVIRMPAGALKGVLKLRGKVVTMLGKKAG* |
| Ga0137399_104468203 | 3300012203 | Vadose Zone Soil | TGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAVNS* |
| Ga0137362_106361063 | 3300012205 | Vadose Zone Soil | TAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGGEKKKAV* |
| Ga0137381_105900641 | 3300012207 | Vadose Zone Soil | LFDEILRMPAGTLKSVVKLRGKVVTILGVGNKKAG* |
| Ga0137378_102080673 | 3300012210 | Vadose Zone Soil | FDEILRMPAGTLKSVVKLRGKVVTILGAGNKKAG* |
| Ga0137386_103016771 | 3300012351 | Vadose Zone Soil | MTGLFEEIIRRPTGALKGVVKLRGKVITLLGSSKTKAAG* |
| Ga0137386_106297523 | 3300012351 | Vadose Zone Soil | GLFEEIIRMPTGALKGVVKLRGKVITLLGKKAATG* |
| Ga0137386_111174282 | 3300012351 | Vadose Zone Soil | TGLFEEIIRMPTGALKGVVKLRGKVITLLGKRAVNS* |
| Ga0137360_109187233 | 3300012361 | Vadose Zone Soil | SGLFEEILRMPTGALKSVVKLRGKVITLLGTGAKKAG* |
| Ga0137390_101367904 | 3300012363 | Vadose Zone Soil | MLDFLTIMSGLFEEILRMPVGALKGVGKLRGKVITLLGSDKKKAV* |
| Ga0137398_109866582 | 3300012683 | Vadose Zone Soil | LEFLTGMTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0137396_100784981 | 3300012918 | Vadose Zone Soil | FLTAMTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0137396_109335371 | 3300012918 | Vadose Zone Soil | LFEEILRMPTGALKGVVKLRGKVITLLGTQKKKAG* |
| Ga0137394_102490941 | 3300012922 | Vadose Zone Soil | FEEVMRMPPGALKGVAKLRGKVITLLSSSNKKAAS* |
| Ga0137359_103291593 | 3300012923 | Vadose Zone Soil | VMTGMFEEVLRMPSGTLKGVAKLRGKVITLLGSGAKKAAG* |
| Ga0137413_113139401 | 3300012924 | Vadose Zone Soil | LFEEILRMPVGALKGVGKLRGKVITLLGSDKKKVG* |
| Ga0137404_111265722 | 3300012929 | Vadose Zone Soil | FEEILRMPTGALKGVVKLRGKVITLLGAEKKKAG* |
| Ga0134076_100161521 | 3300012976 | Grasslands Soil | AMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSEKKKAAG* |
| Ga0134087_102022421 | 3300012977 | Grasslands Soil | FLTAMTGLFDEIIHMPTGALKGVVKLRGKVITLLGKKAG* |
| Ga0181532_100295981 | 3300014164 | Bog | TMSGLFEEVLRMPVGALKGVGKLRGKVITLLGSDKKKAG* |
| Ga0181526_108318701 | 3300014200 | Bog | TMTGLFEEVLRMPVGALKGVGKLRGKVITLLGSEKKKAG* |
| Ga0137414_10271301 | 3300015051 | Vadose Zone Soil | MFEEVLRMPSGTLKGVAKLRAKLRGKVITLLGSGTKKAAG* |
| Ga0137414_10827093 | 3300015051 | Vadose Zone Soil | VMTGMFEEVLRMPSGTLKGVAKLRGKVITLLGSGTKKAAG* |
| Ga0137418_112795531 | 3300015241 | Vadose Zone Soil | TAMTGLFEEVLRMPTGALKSVVKLRGKVVTLLGKRAG* |
| Ga0182036_118485321 | 3300016270 | Soil | MLEFLTAMTGLFEEILRMPPAALKSVVKLRGKVVTILGAGNKKIG |
| Ga0182041_107575651 | 3300016294 | Soil | MTGLFEEILRMPVGALKGVGKLRGKVITLLGNEKKKAV |
| Ga0182041_122484012 | 3300016294 | Soil | LTTMSGLFEEVLRMPMAALKGVGQLRGKVITLLGSEKKKVG |
| Ga0182037_100863644 | 3300016404 | Soil | GLFEEILRMPVGALKGVGKLRGKVITLLGSEKQKAV |
| Ga0182037_108869971 | 3300016404 | Soil | TGLFEEILRMPVGALKGVGKLRGKVITLLGSEKKKAV |
| Ga0182037_111628101 | 3300016404 | Soil | TTMTGLFEEILRMPVGAWKGVGKLRGKVITLLANEKKKAV |
| Ga0134069_12271492 | 3300017654 | Grasslands Soil | EFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSEKKKAAG |
| Ga0187802_103353431 | 3300017822 | Freshwater Sediment | MTGLFEEIIRMPTGALKGVAKLRGKVITLLSSEKKKAAS |
| Ga0187814_104206782 | 3300017932 | Freshwater Sediment | TTMSGLFEEVVRMPAGALKGVGKLRGKVITLLGDKKKAG |
| Ga0187803_101819503 | 3300017934 | Freshwater Sediment | DFLTTMTGLFEEILRMPVGALKGVGKLRGKVITLLGSEKKKAG |
| Ga0187808_100328505 | 3300017942 | Freshwater Sediment | TVMTGLFEEVVRMPASTLKGVAKLRGKVITLLGANRQKAAG |
| Ga0187819_100640574 | 3300017943 | Freshwater Sediment | TTMSGLFEEVLRMPAGALKGVGKLRGKVITLLGSEKKKAG |
| Ga0187817_103119681 | 3300017955 | Freshwater Sediment | VMTGLFEEVVRMPASTLKGVAKLRGKVITLLGTTRQKAAG |
| Ga0187780_108685401 | 3300017973 | Tropical Peatland | FLTTMSGLFEEILRMPAGTLKGVGKLRGKVITLLGDKKKAG |
| Ga0187777_101108043 | 3300017974 | Tropical Peatland | FLRVMSGLFEEVLHMPTPALKGVGKLRGKVVTLLGRKAANE |
| Ga0187777_106784551 | 3300017974 | Tropical Peatland | LEFLTVMSGLFEEVLRMPTPALKGVGKLRGKVITLIGKKAG |
| Ga0187816_102331373 | 3300017995 | Freshwater Sediment | EFLSAMTGLFEEAVRMPASALRGIAKLRGKLSALLGASRQKGVS |
| Ga0187810_100356611 | 3300018012 | Freshwater Sediment | LTVMTGLFEEVVRMPASTLKGVAKLRGKVITLLGTTRQKAAG |
| Ga0187810_101631871 | 3300018012 | Freshwater Sediment | TVVSGLFEEVVRIPASALKGVAKLRGKMVTLLGAARHSEGG |
| Ga0187855_100805384 | 3300018038 | Peatland | EFLTVMTGLFEEILHMPTGALKGVVKLRGKVVTLLGKKAG |
| Ga0187773_106504842 | 3300018064 | Tropical Peatland | VMLEFLTTMTGLFEEMIRMPAGALKSVGKLRGKVVTMLGKKAG |
| Ga0187774_108295341 | 3300018089 | Tropical Peatland | MLDFLTIMTGLFDEVLRMPAGTLKGVGKLRGKVITLLGSDKKKAV |
| Ga0066655_108072573 | 3300018431 | Grasslands Soil | LTVMTGMFEEVLRMPSGTLKGVAKLRGKVITLLGGGAKKAAG |
| Ga0137408_10730283 | 3300019789 | Vadose Zone Soil | LFEEIIRMPTGALKGVVKLRGKVITLLGTEKKKATG |
| Ga0137408_13506093 | 3300019789 | Vadose Zone Soil | MFEEVLRMPSGALKGVAKLRGKVITLLGSGTKKAAG |
| Ga0193729_10013871 | 3300019887 | Soil | LSAMTALFEEVVRMPDAALRGVVKLRGKVITLLGTGRKKAG |
| Ga0210407_106742081 | 3300020579 | Soil | LTVMTGLFDEVLRMPTTALKGVGKLRGKVFTLLGKKAG |
| Ga0210407_113608611 | 3300020579 | Soil | LEFLTVMTGLFDEVLRMPVSALKGVGKLRGKVVTLLGKKAANG |
| Ga0210403_101581331 | 3300020580 | Soil | MSGLFEEVLRMPVGALKGVGKLRGKVITLLGNDKKKAG |
| Ga0210401_100865011 | 3300020583 | Soil | MLDFLTTMSGLFEEVLRMPVGALKGVGKLRGKVITLLGSDKKKAG |
| Ga0215015_105953482 | 3300021046 | Soil | MLEFLTAMTGLFEEILRMPTGALKGVVKLRGKVITLLGAGKTKAAG |
| Ga0179596_100470053 | 3300021086 | Vadose Zone Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGSSKTKAAG |
| Ga0179596_103042712 | 3300021086 | Vadose Zone Soil | MLEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSSKTKAAG |
| Ga0210406_100080161 | 3300021168 | Soil | TAMTGLFEEIMRMPTPALKGVVKLRGKVISMLGKKASA |
| Ga0210405_103793423 | 3300021171 | Soil | DFLTTMSGLFEEILRMPMGALKGVGKLRGKVITLLGSDKKKAV |
| Ga0210405_106262971 | 3300021171 | Soil | FLTAMTGLFEEILRMPTGALKGVVKLRGKVVTLLGAEKKKAG |
| Ga0210405_112987702 | 3300021171 | Soil | LTIMTGLFDEVLRMPVAALKGVGKLRGKVVTLLGKKAANG |
| Ga0210389_113219902 | 3300021404 | Soil | TAMTGLFEEILRMPTGALKGVVKLRGKVITLLGAEKKKVG |
| Ga0210383_102327613 | 3300021407 | Soil | EFLTIMTGLFDEVLRMPTSTLKGVGKLRGKVFTLLGKKAG |
| Ga0210384_111671531 | 3300021432 | Soil | GLFEEIMRMPTPALKGVVKLRGKVISMLGKKAAAS |
| Ga0210391_107918891 | 3300021433 | Soil | FLTVMTGLFDEVLRMPTTALKGVGKLRGKVFTLLGKKAG |
| Ga0210392_111370602 | 3300021475 | Soil | GLFEEVLRMPMGALKGVGKLRGKVITLLGSEKKKVG |
| Ga0187846_102249323 | 3300021476 | Biofilm | VMTGLFEEVMRMPAGALKGVVKLRGKVVTMLGKKAAG |
| Ga0210402_119300682 | 3300021478 | Soil | MTGLFEEILRMPIGALKGVGKLRGKVITLLGSDKKKAV |
| Ga0210409_104462071 | 3300021559 | Soil | MLDFLTTMSGLFEEILRMPMGALKGVGKLRGKVITLLGTDKKKAG |
| Ga0210409_112094182 | 3300021559 | Soil | LFEEVLRMPMGALKGVGKLRGKVITLLGSEKKKVG |
| Ga0126371_122054341 | 3300021560 | Tropical Forest Soil | SMLEFLTTMSGLFEEVLRMPMGALKGVGKLRGKVITLLGSEKKKVG |
| Ga0208563_10125784 | 3300025501 | Peatland | GLFEEILRMPVGTLKGVGKLRGKVITLLGSEKKKAG |
| Ga0207699_112315542 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TIMSGLFEEILRMPVGALKGVGKLRGKVITLLGSDKKKAV |
| Ga0207687_114668241 | 3300025927 | Miscanthus Rhizosphere | TVMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGKKAG |
| Ga0207664_116134361 | 3300025929 | Agricultural Soil | GLFEEVVRMPAGALRGAMKLRGKVVTLLGQKKVANG |
| Ga0207665_106370281 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | SMLEFLTVMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGRKAAG |
| Ga0207711_111216733 | 3300025941 | Switchgrass Rhizosphere | TAMSGLFEEIVRMPMPALKGVVKLRGKVVTLLGKRAG |
| Ga0207641_125512841 | 3300026088 | Switchgrass Rhizosphere | LEFLTVMSGLFEEVMRMPMPALKGMGKLRGKVVTLLGKKAG |
| Ga0209471_11935202 | 3300026318 | Soil | AMTGLFDEVIHMPASTLKGVLKLRGKVVTMLGKKAG |
| Ga0209473_12271681 | 3300026330 | Soil | EFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAVNS |
| Ga0209377_11558933 | 3300026334 | Soil | AEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAANG |
| Ga0257153_10500611 | 3300026490 | Soil | AMSGLFEEILRMPTGALKSVVKLRGKVITLLGTGAKKAG |
| Ga0209807_10518003 | 3300026530 | Soil | GMLEFLTAMTGLFEEILRMPTGALKSVLKLRGKVITLLGTGSKKAG |
| Ga0209160_10247815 | 3300026532 | Soil | LFDEILRMPAGTLKSVVKLRGKVVTILGAGNKKAG |
| Ga0209805_13474261 | 3300026542 | Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAG |
| Ga0207780_10017979 | 3300027313 | Tropical Forest Soil | FLTTMTGLFEEILRMPVGALKGVGKLRGKVITLLGNEKKKAV |
| Ga0207777_10088561 | 3300027330 | Tropical Forest Soil | TGLFEEILRMPVGALKGVGKLRGKVITLLGNEKKKAV |
| Ga0209588_12089432 | 3300027671 | Vadose Zone Soil | LTIMSGLFEEILRMPMGALKGVGKLRGKVITLLGSDKKKVG |
| Ga0209626_11110481 | 3300027684 | Forest Soil | FLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGKKAVNS |
| Ga0209689_10347215 | 3300027748 | Soil | MLEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSEKKKAAG |
| Ga0209656_104334411 | 3300027812 | Bog Forest Soil | EFLTAMTGLFEEILRMPTGALKGVVKLRGKVFTLLGRKAG |
| Ga0209701_104268102 | 3300027862 | Vadose Zone Soil | EFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGSEKKKAG |
| Ga0209167_101956532 | 3300027867 | Surface Soil | MNGLFEELVRMPTGALKGVVKLRGKVLTILGSGSKKAG |
| Ga0209283_107377442 | 3300027875 | Vadose Zone Soil | GLFEEIIRMPTGALKGVVKLRGKVITLLGSEKKKAG |
| Ga0209169_102651451 | 3300027879 | Soil | GMTGLFEEVVRMPTGALKGAMKLRGKVVTLLGQKKAATG |
| Ga0209169_106253811 | 3300027879 | Soil | EFLTGMTGLFEEVVKMPTGALKGAMKLRGKVVTLLGQKKAANG |
| Ga0209275_108118191 | 3300027884 | Soil | TTMSGLFEEILRMPMGALKGVGKLRGKVITLLGSDKKKAG |
| Ga0209624_100845864 | 3300027895 | Forest Soil | MTGLFEEVVKMPTGALKGAMKLRGKVVTLLGQKKAANG |
| Ga0209698_102431221 | 3300027911 | Watersheds | MTGLFEEVIRMPTPALKSVAKLRGKVVTLFGKKAVNS |
| Ga0209526_103462931 | 3300028047 | Forest Soil | MTALFEEILRMPPGALKSVVKLRGKVVTLLGKKAVNS |
| Ga0209526_109626541 | 3300028047 | Forest Soil | SAMTGLFEEVVRMPDAALRGVVKLRGKVITLLGTGRKKAG |
| Ga0137415_100078041 | 3300028536 | Vadose Zone Soil | LDLLTIMSGLFEEILRMSMGALKGVGKLRGKVITLLGSEKKKAV |
| Ga0302231_104077962 | 3300028775 | Palsa | TAMTGMFEEIMRMPTPALKGMVKLRGKVITLLGTEKKKTG |
| Ga0308309_103675991 | 3300028906 | Soil | VMTGLFDEVQRMPTAALKGVGKLRGKVFTLLGKKAANA |
| Ga0308309_113769191 | 3300028906 | Soil | EFLTVMTGLFDEVLRMPTSALKGVGKLRGKVFTLLGKKAG |
| Ga0222749_102263533 | 3300029636 | Soil | LSAMTGLFEEVVRMPDAALRGVVKLRGKVITLLGTGRKKAG |
| Ga0311357_100335925 | 3300030524 | Palsa | MLEFLTAMTGMFEEIMRMPTPALKGMVKLRGKVITLLGTEKKKTG |
| Ga0075371_109307732 | 3300030974 | Soil | MSGLFEEVLRMPTGALKGVGKLRGKVITLLRSEKKVG |
| Ga0073994_123811272 | 3300030991 | Soil | GLFEEIIRMPTGALKGVVKLRGKVITLLGKKAVNS |
| Ga0170834_1021418972 | 3300031057 | Forest Soil | LFEEVVRMPAGALRGAMKLRGKVVTLLGQKKVANG |
| Ga0265760_100742893 | 3300031090 | Soil | LEFLTIMTGLFDEVLRMPTSALKGVGKLRGKVFTLLGKKAG |
| Ga0170823_121291241 | 3300031128 | Forest Soil | FLVAMSGLFEEILRMPTGALKSVVKLRGKVLTLLGTGAKKAG |
| Ga0170824_1000411921 | 3300031231 | Forest Soil | GLFEEVVKMPTGALKGAMKLRGKVVTLLGQKKAANG |
| Ga0170824_1268687121 | 3300031231 | Forest Soil | SGLFEEILRMPTGALKSVVKLRGKVLTLLGTGAKKAG |
| Ga0170818_1114138161 | 3300031474 | Forest Soil | MTGLFEEVVRMPDAALRGVVKLRGKVITLLGTGRKKAG |
| Ga0318541_104931082 | 3300031545 | Soil | TGLFEEILRMPVGALKGVGKLRGKVITLLGSEKQKAV |
| Ga0318538_104559591 | 3300031546 | Soil | AMTGLFEEVLRMPAAALKGVLKLRGKVVTMLGKKAG |
| Ga0307476_108903572 | 3300031715 | Hardwood Forest Soil | MLEFLTAMTGLFEEIMRMPTGALKGVVKLRGKVITLLGNEKKRA |
| Ga0307469_100949514 | 3300031720 | Hardwood Forest Soil | MSGLFEEILRMPVGALKGVGKLRGKVITLLGSDKKKVG |
| Ga0307469_111866571 | 3300031720 | Hardwood Forest Soil | FLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGTEKKKAAG |
| Ga0318501_108684111 | 3300031736 | Soil | SAIFEEVLRMPTGTLKGVAKLRGKVVTILGTGGKKAG |
| Ga0307475_101242141 | 3300031754 | Hardwood Forest Soil | EFLTTMSGLFEEILRMPTGALKGVGKLRGKVVTLLGKKVG |
| Ga0318566_105562682 | 3300031779 | Soil | TMSGLFDEVLRMPAGALKGVGKLRGKVITLLGSDKKKAG |
| Ga0307473_109485021 | 3300031820 | Hardwood Forest Soil | LEFLTAMTGLFEEIIRMPTGALKGVVKLRGKVITLLGTEKKKAVNS |
| Ga0318520_108848462 | 3300031897 | Soil | TMTGLFEEILRMPVGALKGLGKLRGKVITLLGSEKQKAV |
| Ga0306921_122126501 | 3300031912 | Soil | NGLFEEILRMPTGALKSVAKLRGKVVTILGAGKKAG |
| Ga0310909_100587961 | 3300031947 | Soil | TTMTGLFEEFLRMPSCALKGAGKLRGKVITLFGGEKKKAL |
| Ga0307479_100070351 | 3300031962 | Hardwood Forest Soil | MTGLFEEIIRMPTGALKGVVKLRGKVITLLGSSKAKAAG |
| Ga0307479_106844541 | 3300031962 | Hardwood Forest Soil | LDFLTIMSGLFEEILRMPMGALKGVGKLRGKVITLLGSDKKKAG |
| Ga0307479_120900671 | 3300031962 | Hardwood Forest Soil | GLFDEVLRMPTAALKGVGKLRGKVFTLLGKKAANA |
| Ga0306922_123779421 | 3300032001 | Soil | MLEFLTAMTGLFEEILRMPTGALKGVARLRGRVVTILGAGGKKAG |
| Ga0318556_105686961 | 3300032043 | Soil | TMTGLFEEILRMPVGALKGVGKLRGKVITLLGSEKQKAV |
| Ga0306924_114824381 | 3300032076 | Soil | FLTAMTGLFEEVIRMPAGALKGVLKLRGKVVTMLGKKAG |
| Ga0307471_1000387661 | 3300032180 | Hardwood Forest Soil | MSGLFEEVLRMPMGALKGVGKLRGKVITLLGSDKKKAG |
| Ga0307471_1017835042 | 3300032180 | Hardwood Forest Soil | FLSAMTGLFEEVVRMPDAALRGVVKLRGKVITLLGTGRKKAG |
| Ga0307472_1026998491 | 3300032205 | Hardwood Forest Soil | AMTGLFEEVIRMPAGALKGVMKLRGKVITLIGSEKKKAAG |
| Ga0335079_117938232 | 3300032783 | Soil | LEFLTTMSGLFDEVLRMPVGALKGVGKLRGKVITLLGSEKKKAG |
| Ga0335072_100363477 | 3300032898 | Soil | TGLFDEVLRMPPSTLKSVGKLRGRVITILGADKKKVG |
| Ga0335076_105328851 | 3300032955 | Soil | QEFLTAMNGLFEELLRMPTPALKGLVKLRGKVVNILGMGRKTG |
| Ga0335076_115184451 | 3300032955 | Soil | FLTIMTGLFDEVVRMPPGTLKGVAKLRGKLNILLGRRDAK |
| Ga0335077_117797662 | 3300033158 | Soil | SMLEFLTVMMGLFEEVVRMPASTLKGVAKLRGKVITLIGGNRQKEAG |
| ⦗Top⦘ |