


| Basic Information | |
|---|---|
| Family ID | F027459 |
| Family Type | Metagenome |
| Number of Sequences | 194 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VPEAVAFRWPWRVIALVVIAALSYLAWRGYQQPDLILDFANLRYC |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 194 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.07 % |
| % of genes near scaffold ends (potentially truncated) | 26.29 % |
| % of genes from short scaffolds (< 2000 bps) | 76.80 % |
| Associated GOLD sequencing projects | 155 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.969 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.825 % of family members) |
| Environment Ontology (ENVO) | Unclassified (19.588 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.05% β-sheet: 0.00% Coil/Unstructured: 47.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 194 Family Scaffolds |
|---|---|---|
| PF04299 | FMN_bind_2 | 20.62 |
| PF01479 | S4 | 19.07 |
| PF13411 | MerR_1 | 17.01 |
| PF01430 | HSP33 | 7.22 |
| PF00535 | Glycos_transf_2 | 0.52 |
| PF00501 | AMP-binding | 0.52 |
| PF07593 | UnbV_ASPIC | 0.52 |
| PF01520 | Amidase_3 | 0.52 |
| PF07715 | Plug | 0.52 |
| PF00132 | Hexapep | 0.52 |
| PF02666 | PS_Dcarbxylase | 0.52 |
| PF02634 | FdhD-NarQ | 0.52 |
| PF13840 | ACT_7 | 0.52 |
| PF00749 | tRNA-synt_1c | 0.52 |
| PF01464 | SLT | 0.52 |
| COG ID | Name | Functional Category | % Frequency in 194 Family Scaffolds |
|---|---|---|---|
| COG1281 | Redox-regulated molecular chaperone, HSP33 family | Posttranslational modification, protein turnover, chaperones [O] | 7.22 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.52 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.52 |
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.52 |
| COG1526 | Formate dehydrogenase assembly factor FdhD, a sulfurtransferase | Energy production and conversion [C] | 0.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.97 % |
| Unclassified | root | N/A | 1.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908044|A5_c1_ConsensusfromContig39302 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1402 | Open in IMG/M |
| 3300000550|F24TB_12596522 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300001593|JGI12635J15846_10064677 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2728 | Open in IMG/M |
| 3300001593|JGI12635J15846_10894125 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100109244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2596 | Open in IMG/M |
| 3300004152|Ga0062386_100200891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1568 | Open in IMG/M |
| 3300004152|Ga0062386_101080832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300004152|Ga0062386_101195633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 632 | Open in IMG/M |
| 3300004633|Ga0066395_10401016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300005166|Ga0066674_10285353 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300005171|Ga0066677_10008339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 4377 | Open in IMG/M |
| 3300005171|Ga0066677_10139089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1321 | Open in IMG/M |
| 3300005174|Ga0066680_10334210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 966 | Open in IMG/M |
| 3300005174|Ga0066680_10957772 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
| 3300005177|Ga0066690_10200886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1326 | Open in IMG/M |
| 3300005178|Ga0066688_10170943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1369 | Open in IMG/M |
| 3300005181|Ga0066678_10049808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2382 | Open in IMG/M |
| 3300005332|Ga0066388_100272548 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2335 | Open in IMG/M |
| 3300005332|Ga0066388_101169330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1311 | Open in IMG/M |
| 3300005332|Ga0066388_102883751 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 879 | Open in IMG/M |
| 3300005332|Ga0066388_107991187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
| 3300005445|Ga0070708_100107778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2558 | Open in IMG/M |
| 3300005445|Ga0070708_100694924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 958 | Open in IMG/M |
| 3300005542|Ga0070732_10471713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 759 | Open in IMG/M |
| 3300005554|Ga0066661_10553604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300005556|Ga0066707_10482756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 804 | Open in IMG/M |
| 3300005574|Ga0066694_10124636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300005586|Ga0066691_10168470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300005587|Ga0066654_10273502 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300005598|Ga0066706_10578441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae | 892 | Open in IMG/M |
| 3300005598|Ga0066706_11490236 | Not Available | 509 | Open in IMG/M |
| 3300005764|Ga0066903_100218078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2887 | Open in IMG/M |
| 3300005764|Ga0066903_102581855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 984 | Open in IMG/M |
| 3300005938|Ga0066795_10047630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300005995|Ga0066790_10410041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300006794|Ga0066658_10602417 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300006796|Ga0066665_10299973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1291 | Open in IMG/M |
| 3300006796|Ga0066665_10893201 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 689 | Open in IMG/M |
| 3300006852|Ga0075433_11703756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
| 3300006854|Ga0075425_100039270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5281 | Open in IMG/M |
| 3300006854|Ga0075425_100198658 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2305 | Open in IMG/M |
| 3300007258|Ga0099793_10572392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300007821|Ga0104323_102490 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1036 | Open in IMG/M |
| 3300009012|Ga0066710_100292364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2382 | Open in IMG/M |
| 3300009012|Ga0066710_103781020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 568 | Open in IMG/M |
| 3300009038|Ga0099829_10262205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1411 | Open in IMG/M |
| 3300009147|Ga0114129_10097467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4071 | Open in IMG/M |
| 3300009162|Ga0075423_10081053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3382 | Open in IMG/M |
| 3300009176|Ga0105242_12041118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300009792|Ga0126374_11208230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300010046|Ga0126384_10005134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7993 | Open in IMG/M |
| 3300010320|Ga0134109_10401754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 548 | Open in IMG/M |
| 3300010336|Ga0134071_10367515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 729 | Open in IMG/M |
| 3300010337|Ga0134062_10793573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
| 3300010339|Ga0074046_10378644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 858 | Open in IMG/M |
| 3300010341|Ga0074045_10015121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6232 | Open in IMG/M |
| 3300010358|Ga0126370_10117576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1877 | Open in IMG/M |
| 3300010360|Ga0126372_11149307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 798 | Open in IMG/M |
| 3300010361|Ga0126378_12494662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 590 | Open in IMG/M |
| 3300010366|Ga0126379_12816433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 582 | Open in IMG/M |
| 3300010376|Ga0126381_103241775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300010379|Ga0136449_100028585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 13636 | Open in IMG/M |
| 3300011269|Ga0137392_11391449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 561 | Open in IMG/M |
| 3300011270|Ga0137391_10275562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
| 3300011444|Ga0137463_1055876 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300011998|Ga0120114_1012457 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1892 | Open in IMG/M |
| 3300012019|Ga0120139_1012734 | All Organisms → cellular organisms → Bacteria | 1930 | Open in IMG/M |
| 3300012189|Ga0137388_10434063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1217 | Open in IMG/M |
| 3300012198|Ga0137364_10091183 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2127 | Open in IMG/M |
| 3300012200|Ga0137382_10364738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300012201|Ga0137365_10675999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 755 | Open in IMG/M |
| 3300012202|Ga0137363_10256079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1423 | Open in IMG/M |
| 3300012203|Ga0137399_10306167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1313 | Open in IMG/M |
| 3300012205|Ga0137362_10493123 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300012208|Ga0137376_10514758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1038 | Open in IMG/M |
| 3300012210|Ga0137378_10000995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 23599 | Open in IMG/M |
| 3300012212|Ga0150985_100591206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2307 | Open in IMG/M |
| 3300012349|Ga0137387_10708621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 728 | Open in IMG/M |
| 3300012351|Ga0137386_11214317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 527 | Open in IMG/M |
| 3300012353|Ga0137367_10954852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012355|Ga0137369_10305590 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300012356|Ga0137371_10709548 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300012357|Ga0137384_11536859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
| 3300012948|Ga0126375_10589629 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300012971|Ga0126369_10003899 | All Organisms → cellular organisms → Bacteria | 10854 | Open in IMG/M |
| 3300012971|Ga0126369_11332090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 808 | Open in IMG/M |
| 3300013832|Ga0120132_1046880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 828 | Open in IMG/M |
| 3300014829|Ga0120104_1110234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 556 | Open in IMG/M |
| 3300015069|Ga0167633_114527 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 918 | Open in IMG/M |
| 3300015075|Ga0167636_1024053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 809 | Open in IMG/M |
| 3300015080|Ga0167639_1011599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1272 | Open in IMG/M |
| 3300015090|Ga0167634_1000050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8645 | Open in IMG/M |
| 3300015193|Ga0167668_1003697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3344 | Open in IMG/M |
| 3300015193|Ga0167668_1004284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3159 | Open in IMG/M |
| 3300015264|Ga0137403_10668069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300015371|Ga0132258_10108981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6549 | Open in IMG/M |
| 3300015371|Ga0132258_13895531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300015374|Ga0132255_102813093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 744 | Open in IMG/M |
| 3300017659|Ga0134083_10289769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 692 | Open in IMG/M |
| 3300017939|Ga0187775_10405308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 565 | Open in IMG/M |
| 3300017959|Ga0187779_10004243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 8544 | Open in IMG/M |
| 3300017959|Ga0187779_10020043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3809 | Open in IMG/M |
| 3300017959|Ga0187779_10060108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2229 | Open in IMG/M |
| 3300017959|Ga0187779_10909227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 606 | Open in IMG/M |
| 3300017961|Ga0187778_10000092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 54528 | Open in IMG/M |
| 3300017961|Ga0187778_11099128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300017966|Ga0187776_10213495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1219 | Open in IMG/M |
| 3300017966|Ga0187776_10634300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 748 | Open in IMG/M |
| 3300017973|Ga0187780_11395303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
| 3300017974|Ga0187777_10263240 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300018000|Ga0184604_10101355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 892 | Open in IMG/M |
| 3300018027|Ga0184605_10343141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 675 | Open in IMG/M |
| 3300018029|Ga0187787_10168601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300018031|Ga0184634_10357096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 670 | Open in IMG/M |
| 3300018058|Ga0187766_10077311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1990 | Open in IMG/M |
| 3300018058|Ga0187766_10708699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
| 3300018061|Ga0184619_10112993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1226 | Open in IMG/M |
| 3300018062|Ga0187784_10733318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 790 | Open in IMG/M |
| 3300018071|Ga0184618_10129697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1015 | Open in IMG/M |
| 3300018075|Ga0184632_10168417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 966 | Open in IMG/M |
| 3300018085|Ga0187772_10811099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 676 | Open in IMG/M |
| 3300018433|Ga0066667_10670645 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 868 | Open in IMG/M |
| 3300018482|Ga0066669_10528957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1024 | Open in IMG/M |
| 3300019879|Ga0193723_1010472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2977 | Open in IMG/M |
| 3300019887|Ga0193729_1127704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 941 | Open in IMG/M |
| 3300019888|Ga0193751_1030573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2528 | Open in IMG/M |
| 3300020006|Ga0193735_1181281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 519 | Open in IMG/M |
| 3300021073|Ga0210378_10296833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300021432|Ga0210384_10007607 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11409 | Open in IMG/M |
| 3300021432|Ga0210384_10759305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 866 | Open in IMG/M |
| 3300021444|Ga0213878_10424572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 580 | Open in IMG/M |
| 3300021478|Ga0210402_10000302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 56289 | Open in IMG/M |
| 3300021478|Ga0210402_10397511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1280 | Open in IMG/M |
| 3300021560|Ga0126371_10105195 | All Organisms → cellular organisms → Bacteria | 2820 | Open in IMG/M |
| 3300021560|Ga0126371_10168959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2262 | Open in IMG/M |
| 3300021560|Ga0126371_13215174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 552 | Open in IMG/M |
| 3300025910|Ga0207684_10659127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 891 | Open in IMG/M |
| 3300025928|Ga0207700_11368419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300026310|Ga0209239_1073694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1487 | Open in IMG/M |
| 3300026314|Ga0209268_1017407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2703 | Open in IMG/M |
| 3300026315|Ga0209686_1118540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 889 | Open in IMG/M |
| 3300026343|Ga0209159_1146710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 934 | Open in IMG/M |
| 3300026537|Ga0209157_1373066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
| 3300026550|Ga0209474_10500377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 615 | Open in IMG/M |
| 3300027535|Ga0209734_1001191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4279 | Open in IMG/M |
| 3300027587|Ga0209220_1083307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 844 | Open in IMG/M |
| 3300027651|Ga0209217_1075304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 986 | Open in IMG/M |
| 3300027678|Ga0209011_1002022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7218 | Open in IMG/M |
| 3300027678|Ga0209011_1046046 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1344 | Open in IMG/M |
| 3300027783|Ga0209448_10135265 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 824 | Open in IMG/M |
| 3300027824|Ga0209040_10477705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 559 | Open in IMG/M |
| 3300027842|Ga0209580_10314189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 780 | Open in IMG/M |
| 3300027902|Ga0209048_10006885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 10575 | Open in IMG/M |
| 3300027903|Ga0209488_11100421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
| 3300028047|Ga0209526_10600566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 705 | Open in IMG/M |
| 3300028665|Ga0302160_10105175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300028792|Ga0307504_10059571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1116 | Open in IMG/M |
| 3300028870|Ga0302254_10040455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1670 | Open in IMG/M |
| 3300029923|Ga0311347_10606737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300029990|Ga0311336_11325877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300030114|Ga0311333_10133121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1885 | Open in IMG/M |
| 3300030943|Ga0311366_10125784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2204 | Open in IMG/M |
| 3300031232|Ga0302323_100708227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
| 3300031543|Ga0318516_10860148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 511 | Open in IMG/M |
| 3300031544|Ga0318534_10011041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4536 | Open in IMG/M |
| 3300031546|Ga0318538_10664082 | Not Available | 565 | Open in IMG/M |
| 3300031720|Ga0307469_10011648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4353 | Open in IMG/M |
| 3300031720|Ga0307469_11377836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 672 | Open in IMG/M |
| 3300031720|Ga0307469_11676060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 612 | Open in IMG/M |
| 3300031747|Ga0318502_10015346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 3593 | Open in IMG/M |
| 3300031747|Ga0318502_10161062 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300031820|Ga0307473_10190504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300031820|Ga0307473_11099619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 586 | Open in IMG/M |
| 3300031820|Ga0307473_11202049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 563 | Open in IMG/M |
| 3300031835|Ga0318517_10369063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
| 3300031880|Ga0318544_10060733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1380 | Open in IMG/M |
| 3300031912|Ga0306921_12675291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 513 | Open in IMG/M |
| 3300031918|Ga0311367_10167030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2312 | Open in IMG/M |
| 3300032010|Ga0318569_10255354 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 815 | Open in IMG/M |
| 3300032160|Ga0311301_10214612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3262 | Open in IMG/M |
| 3300032174|Ga0307470_10186227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1311 | Open in IMG/M |
| 3300032180|Ga0307471_100858034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1075 | Open in IMG/M |
| 3300032261|Ga0306920_102761844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300032770|Ga0335085_10245638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 2155 | Open in IMG/M |
| 3300032770|Ga0335085_10859945 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
| 3300032954|Ga0335083_10005191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 16470 | Open in IMG/M |
| 3300032955|Ga0335076_11048209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300033290|Ga0318519_10554551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 695 | Open in IMG/M |
| 3300033803|Ga0314862_0011504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1601 | Open in IMG/M |
| 3300034090|Ga0326723_0305506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 714 | Open in IMG/M |
| 3300034115|Ga0364945_0051137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1154 | Open in IMG/M |
| 3300034125|Ga0370484_0142738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 640 | Open in IMG/M |
| 3300034176|Ga0364931_0051772 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300034177|Ga0364932_0287830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 621 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.31% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.12% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.61% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.09% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.58% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.58% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.06% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.06% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.06% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.06% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.55% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.55% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.03% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.03% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.03% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.03% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.52% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.52% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.52% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.52% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.52% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.52% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.52% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.52% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.52% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015069 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4C, Ice margin, adjacent to proglacial lake | Environmental | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015080 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6C, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015090 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5A, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A5_c1_00430180 | 2124908044 | Soil | VPEALAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC |
| F24TB_125965222 | 3300000550 | Soil | SAPRRRRSVPDALVRWPWRLVALVLTAALMYVVWRGYQQPELILDFASMRLC* |
| JGI12635J15846_100646775 | 3300001593 | Forest Soil | PWRVIALVAVAALSYLAWRGYQQPDLILDFANLRYC* |
| JGI12635J15846_108941252 | 3300001593 | Forest Soil | VPDALVRWPWRLVALVLVAALGYVIWRGYQQPELILDFASMRLC* |
| JGIcombinedJ26739_1001092443 | 3300002245 | Forest Soil | VPEALAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFATLRYC* |
| Ga0062386_1002008912 | 3300004152 | Bog Forest Soil | MEREWRRRSVPDTLTRWPWRVIALVLLAALGYLVWRGYQQPELILEFGNVRLC* |
| Ga0062386_1010808322 | 3300004152 | Bog Forest Soil | VPDVVVRLPWRVIGLVRVAALGYLVWRGYQQPEFILEFGNLRLC* |
| Ga0062386_1011956332 | 3300004152 | Bog Forest Soil | VPDGLIRWPWRVIALVLIAALGYLIWRGYQQPELILDFGNVRLCLGTAAAAA* |
| Ga0066395_104010162 | 3300004633 | Tropical Forest Soil | LATVTGTVVRSHRSVPEAAVHWSWRLIGLVLIAALGYLAWRGYQQPELIFDFANFRLC* |
| Ga0066674_102853532 | 3300005166 | Soil | VPDALLRWPWRLVALVLLAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0066677_100083392 | 3300005171 | Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0066677_101390892 | 3300005171 | Soil | VPDALLRWPWRLVATVLLVALAYVIWRGYQQPELILDFAGMRLC* |
| Ga0066680_103342102 | 3300005174 | Soil | VLETAIGRFPLRVIALIAITALGYVVWRGYQQPELILDFANLPFC* |
| Ga0066680_109577722 | 3300005174 | Soil | LRVTGRSCHNVPDALLHWPWRLVAVVLVAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0066690_102008862 | 3300005177 | Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFA |
| Ga0066688_101709432 | 3300005178 | Soil | VPEAVAFRWPWRVIALVVIAALSYLAWRGYQQPDLILDFANVRYC* |
| Ga0066678_100498082 | 3300005181 | Soil | VLDLAAVHWPWRIVALVLIAALAYLVWRGYQQPEFILDLANLRLC* |
| Ga0066388_1002725482 | 3300005332 | Tropical Forest Soil | VPETTALHWSWRLIALALMAALSYLVWRGYQQPDLIFDFANLRLC* |
| Ga0066388_1011693301 | 3300005332 | Tropical Forest Soil | VLEAAGLHCTWRVVALIAITALAFLVWRGYQQPELILDFA |
| Ga0066388_1028837512 | 3300005332 | Tropical Forest Soil | VLETAGLRFTWRVVALIAITALAFLVWRGYQQPELILDFANLRFC* |
| Ga0066388_1079911872 | 3300005332 | Tropical Forest Soil | VPELTLQRFPWRLIALVAMAALAYLAWRGYQQPDMVIDFGNLRFC* |
| Ga0070708_1001077782 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPEALAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0070708_1006949242 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDALVRWPWRLVALVLIAALGYVIWRGYQQPELILDFAAMRLC* |
| Ga0070732_104717132 | 3300005542 | Surface Soil | MVGRHRGVPDTLFRWPWRVIALVLVAALSYLVWRGYQQPELILDLANLRLC* |
| Ga0066661_105536042 | 3300005554 | Soil | VPDALLRWPWRLVAVVLFAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0066707_104827561 | 3300005556 | Soil | VLETAIGRFPLRVIALIAITALGYVVWRGYQQPELI |
| Ga0066694_101246363 | 3300005574 | Soil | VLETAIGRFPWRVIALIAITALGYVVWRGYQQPELILDFANLPFC* |
| Ga0066691_101684703 | 3300005586 | Soil | VPEAVAFRWPWRVIALVVIAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0066654_102735022 | 3300005587 | Soil | VPDALLRWPWRLVAVVLVAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0066706_105784412 | 3300005598 | Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANVRYC* |
| Ga0066706_114902361 | 3300005598 | Soil | CSSVLETAIGRFPLRVIALIAITALGYVVWRGYQQPELILDFANLPFC* |
| Ga0066903_1002180782 | 3300005764 | Tropical Forest Soil | VPEAVLHWSWRLVALVLMAALSYLIWRGYQQPDMIFDFANLRLC* |
| Ga0066903_1025818553 | 3300005764 | Tropical Forest Soil | VLEAAGLRFTWRVVALIAITALAFLVWRGYQQPELILDFANLRFC* |
| Ga0066795_100476302 | 3300005938 | Soil | VLEAVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC* |
| Ga0066790_104100412 | 3300005995 | Soil | SSVPEAVAFRWPWRVIALVLVAALSYLVWRGYQQPDFILDFANLRYC* |
| Ga0066658_106024172 | 3300006794 | Soil | LRWPWRLVAVVLLAALGYVIWRGYQQPELILDFAAMRLC* |
| Ga0066665_102999731 | 3300006796 | Soil | VLDLVAVHWLWRIVALVLITALAYLVWRGYQQPEFIFDFANMRLC* |
| Ga0066665_108932012 | 3300006796 | Soil | VPDALLHWPWRLVAVVLVAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0075433_117037562 | 3300006852 | Populus Rhizosphere | VPDALVRWPWRLVAVVLTAALIYVAWHGYQQPELILDF |
| Ga0075425_1000392707 | 3300006854 | Populus Rhizosphere | SVPDALLRWPWRLVAVVLLAALGYVIWRGYQQPELILDFAAMRLC* |
| Ga0075425_1001986583 | 3300006854 | Populus Rhizosphere | MGPKRHSALRRRRSVPDALVRWPWRLVAVVLTAALIYVAWHGYQQPELILDFASMRLC* |
| Ga0099793_105723922 | 3300007258 | Vadose Zone Soil | CSSVPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANVRYC* |
| Ga0104323_1024902 | 3300007821 | Soil | VPDGLILHWPWRVIALVLIAALGYLVWRGYQQPELILDFANMRFC* |
| Ga0066710_1002923644 | 3300009012 | Grasslands Soil | VLDLAAVHWPWRIVALVLIAALAYLVWRGYQQPEFILDLANLRLC |
| Ga0066710_1037810201 | 3300009012 | Grasslands Soil | VPDALLHWPWRLVAVVLVAALGYVIWRGYQQPELIL |
| Ga0099829_102622051 | 3300009038 | Vadose Zone Soil | VPEALALRWPWRVIALVVVAALSYLAWRGYQQPDLILD |
| Ga0114129_100974674 | 3300009147 | Populus Rhizosphere | VPDALVRWPWRLVALVLMAALIYVVWRGYQQPELILDFANLRLC* |
| Ga0075423_100810533 | 3300009162 | Populus Rhizosphere | VPDALVRWPWRLVAVVLTAALIYVAWHGYQQPELILDFASMRLC* |
| Ga0105242_120411182 | 3300009176 | Miscanthus Rhizosphere | DALVRWPWRLVALVLIAALGYVIWRGYQQPELILDFAGMRLC* |
| Ga0126374_112082302 | 3300009792 | Tropical Forest Soil | VERNRRSVPENAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFKLC* |
| Ga0126384_100051345 | 3300010046 | Tropical Forest Soil | VPEAVLHWSWRLVALVLMAALSYLIWRGYQQPDLIFDFANLRLC* |
| Ga0134109_104017542 | 3300010320 | Grasslands Soil | CHSVPDALLRWPWRLVATVLLVALAYVIWRGYQQPELILDFAGMRLC* |
| Ga0134071_103675152 | 3300010336 | Grasslands Soil | VLDLVAVHWLWRIVALVLITALAYLVWRGYQQPEFIFDFANLRLC* |
| Ga0134062_107935732 | 3300010337 | Grasslands Soil | VPEALAFRWPWRLIALVAVAALSYLVWRGYQQPDLILDFANLGYC* |
| Ga0074046_103786442 | 3300010339 | Bog Forest Soil | VPDALCHWPWRVIALVLIAALGYLVWRGYQQPELILEFGNLRLC* |
| Ga0074045_100151215 | 3300010341 | Bog Forest Soil | VPDGLIRWPWRVIALVLIAALGYFIWRGYQQPELILDFGNVRLCLGAGAAAA* |
| Ga0126370_101175763 | 3300010358 | Tropical Forest Soil | VPEAVLHWSWRLVALVLMAALSYLIWRGYQQPELIFDFANLRLC* |
| Ga0126372_111493072 | 3300010360 | Tropical Forest Soil | VVRSHRSVPEAAVHWSWRLIGLVLIAALGYLAWRGYQQPELIFDFANFRLC* |
| Ga0126378_124946622 | 3300010361 | Tropical Forest Soil | MAERSLRSVPETAVHWSWRLIGLVLIAALSYLAWRGYQQPELIFDFANFRLC* |
| Ga0126379_128164332 | 3300010366 | Tropical Forest Soil | VSAAIAGWPRRVIALILIAALGYLIWRGYQQPDFILDFANLRLC* |
| Ga0126381_1032417752 | 3300010376 | Tropical Forest Soil | QTETVQRRPHHSVPEAVLHWSWRLVALVLMAALSYLIWRGYQQPDLIFDFANLRLC* |
| Ga0136449_1000285859 | 3300010379 | Peatlands Soil | MEWRRRGVPDTLSRWPWRVIALVLIAALGYLVWRGYQQPELILEFGNMRLC* |
| Ga0137392_113914491 | 3300011269 | Vadose Zone Soil | SSVPEALALRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0137391_102755624 | 3300011270 | Vadose Zone Soil | VPEALALRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0137463_10558762 | 3300011444 | Soil | VPDALPRWPWRVVALFVIAALGYLVWRGYQQPELILDFANLRLC* |
| Ga0120114_10124571 | 3300011998 | Permafrost | MLRLPWRVIALVLIAALGYLAWRGYQQPELILDFANARFC* |
| Ga0120139_10127342 | 3300012019 | Permafrost | VPDALMLRWPWRVIALVLIAALGYLVWRGYQQPEMILDFANARFC* |
| Ga0137388_104340632 | 3300012189 | Vadose Zone Soil | VPEAVAFRWPWRVIALVVVAALSYLVWRGYQQPDFILDFANLRYC* |
| Ga0137364_100911833 | 3300012198 | Vadose Zone Soil | VPEAVAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANVRYC* |
| Ga0137382_103647382 | 3300012200 | Vadose Zone Soil | VPEAVAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0137365_106759992 | 3300012201 | Vadose Zone Soil | VLETVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC* |
| Ga0137363_102560793 | 3300012202 | Vadose Zone Soil | VPEAITFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0137399_103061671 | 3300012203 | Vadose Zone Soil | VLETVEFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRF |
| Ga0137362_104931232 | 3300012205 | Vadose Zone Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDFILDFANLRYC* |
| Ga0137376_105147582 | 3300012208 | Vadose Zone Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILEFANLRYC* |
| Ga0137378_1000099520 | 3300012210 | Vadose Zone Soil | VPDTLVFHWPWRVVALVLIAALSYLVWRGYQQPELILDFANLRYC* |
| Ga0150985_1005912062 | 3300012212 | Avena Fatua Rhizosphere | MVLRPRWAYHALALIATAALGYLAWRGYQQPELILELGGLRLC* |
| Ga0137387_107086211 | 3300012349 | Vadose Zone Soil | VPDALLRWPWRLVATVLLAALAYVIWRGYQQPELILDFAGM |
| Ga0137386_112143172 | 3300012351 | Vadose Zone Soil | VVLVAAVLLAALAYVIWRGYQQPELILDFAGMRLC* |
| Ga0137367_109548521 | 3300012353 | Vadose Zone Soil | GRSCRSVPDALLRWPWRLVAVVLLAALGYVIWRGYQQPELILDFAAMRLC* |
| Ga0137369_103055901 | 3300012355 | Vadose Zone Soil | KCRSVPDALLRWPWRLVAVVLLAALGYVIWRGYQQPELILDFAAMRLC* |
| Ga0137371_107095482 | 3300012356 | Vadose Zone Soil | VLDLVAVHWLWRIVALVLITALAYLVWRGYQQPEFILDFANLRLC* |
| Ga0137384_115368592 | 3300012357 | Vadose Zone Soil | PWRVIALVLVAALSYLVWRGYQQPDFILDFANLRYC* |
| Ga0126375_105896292 | 3300012948 | Tropical Forest Soil | MVERRLRSAPENALHWSWRLIGLVLIAALSYLAWRGYQQPELILDFANFRLC* |
| Ga0126369_100038993 | 3300012971 | Tropical Forest Soil | VLETATLHWSWRLIALALMAALSYLVWRGYQQPDLIFDFANLRLC* |
| Ga0126369_113320902 | 3300012971 | Tropical Forest Soil | VERSHRSVPETAVHWSWRLIGLVLIAALSYLAWRGYQQPELIFDFANFRLC* |
| Ga0120132_10468802 | 3300013832 | Permafrost | VPDGLTLHWPWRVIALVLIAALGYLVWRGYQQPELILDFANMRFC* |
| Ga0120104_11102342 | 3300014829 | Permafrost | MLRWPWRVIALVLIAALGYLVWRGYQQPEMILDFANMRFC* |
| Ga0167633_1145272 | 3300015069 | Glacier Forefield Soil | VPEALAFRWPWRVIALVVVAALSYLAWRGYEQPDLILDFANLRYC* |
| Ga0167636_10240532 | 3300015075 | Glacier Forefield Soils | VPEAVAFRWPWRVIALVVVAALSYLAWRGYEQPDLILDFANLRYC* |
| Ga0167639_10115992 | 3300015080 | Glacier Forefield Soil | VPDGLILHWSWRVIALVLIAALGYLVWRGYQQPELILDFANMRFC* |
| Ga0167634_100005012 | 3300015090 | Glacier Forefield Soil | EALAFRWPWRVIALVVVAALSYLAWRGYEQPDLILDFANLRYC* |
| Ga0167668_10036975 | 3300015193 | Glacier Forefield Soil | VPEALAVRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC* |
| Ga0167668_10042842 | 3300015193 | Glacier Forefield Soil | VPETLAFRWPWRVIALLAVAALSYLVWRGYQQPDFILDFANLRYC* |
| Ga0137403_106680691 | 3300015264 | Vadose Zone Soil | SRVTVWSCRNVPDALLRWPWRLVAVVLLTALGYVIWRGYQQPELILDFASMRLC* |
| Ga0132258_101089818 | 3300015371 | Arabidopsis Rhizosphere | VPEAIAFRWPWRVIALVAVAALSYLVWRGYQQPDFIIDFANLRFC* |
| Ga0132258_138955312 | 3300015371 | Arabidopsis Rhizosphere | VPDALTLHWPWRVIALVVIAALGYLVWRGYQQPELILDFANARLC* |
| Ga0132255_1028130932 | 3300015374 | Arabidopsis Rhizosphere | VPDALVRWPWRLVAVVLMAALLYVIWRGYQQPELIFDFASMRLC* |
| Ga0134083_102897692 | 3300017659 | Grasslands Soil | VPDALLRWPWRLVAVVLLAALGYVIWRGYQQPELILDFAAMRLC |
| Ga0187775_104053082 | 3300017939 | Tropical Peatland | MRLSWRVIALIAIAALGYLVWRGYQQPELILEFGNLRFC |
| Ga0187779_100042434 | 3300017959 | Tropical Peatland | VPETALGWTWRLVALVLLAALGYLAWRGYQQPEFIFDLANMRLC |
| Ga0187779_100200433 | 3300017959 | Tropical Peatland | VLEAAAERFPWRVIALIAIATLGYLVWRGYQQPELILEFGNLRFC |
| Ga0187779_100601082 | 3300017959 | Tropical Peatland | VLEAAAWRFPWRVVALIAITALGFLIWRGYQQPELILEFGNLRFC |
| Ga0187779_109092272 | 3300017959 | Tropical Peatland | VLETAALHWSWRLIALALMAALSYLVWRGYQQPDLIFDFANL |
| Ga0187778_1000009232 | 3300017961 | Tropical Peatland | VLEAAGLSVTWRVVALIAITALAFLVWRGYQQPELILDFANLRFC |
| Ga0187778_110991282 | 3300017961 | Tropical Peatland | VLETAALHWSWRLIALALMAALSYLVWRGYQQPDLIFDFANLRLC |
| Ga0187776_102134953 | 3300017966 | Tropical Peatland | VLEAAVGRFPWRVVALIAITALGFLVWRGYQQPELILEFGNLRFC |
| Ga0187776_106343002 | 3300017966 | Tropical Peatland | VPDTALHWPWRLVALVLIAALGYLAWRGYQQPEFILDFANLRLC |
| Ga0187780_113953031 | 3300017973 | Tropical Peatland | CASSASWATAPRRSPRSVPETAPHWPWRLVALVLIAALGYLAWRGYQQPEFIFDFANLRL |
| Ga0187777_102632403 | 3300017974 | Tropical Peatland | ETALHWPWRLVALVLIAALGYLAWRGYQQPEFIFDFANLRLC |
| Ga0184604_101013552 | 3300018000 | Groundwater Sediment | VPEALAFRWPWRVIALVAVAALSYLVWRGYQQPDLILDFANLRYC |
| Ga0184605_103431411 | 3300018027 | Groundwater Sediment | VLEAVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0187787_101686012 | 3300018029 | Tropical Peatland | VPETALHWPWRLVALVLIAALGYLAWRGYQQPEFILDFANLRLC |
| Ga0184634_103570962 | 3300018031 | Groundwater Sediment | VPDALVRWPWRLVALVLIAALGYVIWRGYQQPELILDFAGMRLC |
| Ga0187766_100773112 | 3300018058 | Tropical Peatland | VLEAAVLRFPWRVIALIAIAALGFLVWRGYQQPELILDFASLRLC |
| Ga0187766_107086992 | 3300018058 | Tropical Peatland | VPDAAIVRVPWRLVALIAIAALGYLVWRGYQQPGLILEFGNLRFC |
| Ga0184619_101129931 | 3300018061 | Groundwater Sediment | VLETVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0187784_107333182 | 3300018062 | Tropical Peatland | VRDTLFHWPWRVIALVLIAALGYLVWRGYQQPELILDFGNMRLC |
| Ga0184618_101296972 | 3300018071 | Groundwater Sediment | VLETVASRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0184632_101684172 | 3300018075 | Groundwater Sediment | MSYPQLRWGCSSVLEAVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0187772_108110992 | 3300018085 | Tropical Peatland | VPDALHRWPWRVIALVLIAALGYLVWRGYQQPELILEFGNLRLC |
| Ga0066667_106706453 | 3300018433 | Grasslands Soil | VLETAIGRFPLRVIALIAITALGYVVWRGYQQPELILDFANLPFC |
| Ga0066669_105289571 | 3300018482 | Grasslands Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC |
| Ga0193723_10104725 | 3300019879 | Soil | MSYPQLRWGCSSVLETVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0193729_11277042 | 3300019887 | Soil | VPEAIAFRWPWRVIALVAVAALSYLAWRGYQQPDLILDFANLRYC |
| Ga0193751_10305733 | 3300019888 | Soil | MSYPQLRWGCSSVLEMVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0193735_11812811 | 3300020006 | Soil | VPEAVAFRWPWRVIALVLVAALSYLVWRGYQQPDFILDFANLRYC |
| Ga0210378_102968332 | 3300021073 | Groundwater Sediment | VRWPWRLVALVLIAALGYVIWRGYQQPELILDFAGMRLC |
| Ga0210384_100076076 | 3300021432 | Soil | VPDALVHWPWRVIALVLVAALGYLIWRGYQQPELILDFANMRLC |
| Ga0210384_107593052 | 3300021432 | Soil | VPEALAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFATLRYC |
| Ga0213878_104245722 | 3300021444 | Bulk Soil | VPDGLIRWPWRVIALVLIAALGYLIWRGYQQPELILDFGNMRLCLGAAAVAAQLSRA |
| Ga0210402_1000030224 | 3300021478 | Soil | VPETVAFRWPWRVIALVVVAALSYLVWRGYQQPDFILDFANLRYC |
| Ga0210402_103975112 | 3300021478 | Soil | VPEAAMLRWPWRVIALVTIAALGYLVWRGYQQPELILDLGNLRFC |
| Ga0126371_101051953 | 3300021560 | Tropical Forest Soil | VPEAVLHWSWRLVALVLMAALSYLVWRGYQQPDLIFDFANLRLC |
| Ga0126371_101689594 | 3300021560 | Tropical Forest Soil | VPEAVLHWSWRLVALVLMAALSYLIWRGYQQPDMIFDFANLRLC |
| Ga0126371_132151742 | 3300021560 | Tropical Forest Soil | VRSHRSVPEAAIHWSWRLIGLVLIAALGYLAWRGYQQPELIFDFANFRLC |
| Ga0207684_106591272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VPDALVRWPWRLVALVLIAALGYVIWRGYQQPELILDFAAMRLC |
| Ga0207700_113684192 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC |
| Ga0209239_10736942 | 3300026310 | Grasslands Soil | VPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANVRYC |
| Ga0209268_10174073 | 3300026314 | Soil | VPDALLRWPWRLVATVLLVALAYVIWRGYQQPELILDFAGMRLC |
| Ga0209686_11185402 | 3300026315 | Soil | VPDALLRWPWRLVATVLLVALAYVIWRGYQQPELILDF |
| Ga0209159_11467102 | 3300026343 | Soil | VPDALLRWPWRLVALVLLAALGYVIWRGYQQPELILDFAGMRLC |
| Ga0209157_13730662 | 3300026537 | Soil | VLDLVAVHWLWRIVALVLITALAYLVWRGYQQPEFIFDFANLRLC |
| Ga0209474_105003772 | 3300026550 | Soil | SVPEAVTFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRYC |
| Ga0209734_10011912 | 3300027535 | Forest Soil | VPEALAFRWPWRVIALVAVAALSYLAWRGYQQPDLILDFATLRYC |
| Ga0209220_10833071 | 3300027587 | Forest Soil | RTVPDALVRWPWRLVALVLVAALGYVIWRGYQQPELILDFASMRLC |
| Ga0209217_10753042 | 3300027651 | Forest Soil | VPEALAFRWPWRVIALVVVAALSYLAWRGYQQPDLILDFANLRFC |
| Ga0209011_10020225 | 3300027678 | Forest Soil | VLEAVAFRWPWRVMALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0209011_10460462 | 3300027678 | Forest Soil | VPEAVAFRWPWRVIALVVVAALSYLVWRGYQQPDFIFDFANLRYC |
| Ga0209448_101352652 | 3300027783 | Bog Forest Soil | VPDVVVRLPWRVIGLVRVAALGYPVWRGYQQPEFILEFGNLRLC |
| Ga0209040_104777052 | 3300027824 | Bog Forest Soil | VPDGLIRWPWRVIALVLIAALGYFIWRGYQQPELILDFGNVRLCLGAGAAAA |
| Ga0209580_103141892 | 3300027842 | Surface Soil | MVGRHRGVPDTLFRWPWRVIALVLVAALSYLVWRGYQQPELILDLANLRLC |
| Ga0209048_1000688510 | 3300027902 | Freshwater Lake Sediment | VPDAFALSWQRRLIALVVIAALGYLSWRGYQQPELLLEFGNLRFC |
| Ga0209488_111004211 | 3300027903 | Vadose Zone Soil | VPEAIAYRWPWRVIALVALATLSYLVWRGYQQPDFIIDFANLRFC |
| Ga0209526_106005662 | 3300028047 | Forest Soil | VPDAAVLRWPWRVVALVVIAALSYLAWRGYQQPELILD |
| Ga0302160_101051752 | 3300028665 | Fen | DAVGLRWQRRLIALVVITALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0307504_100595713 | 3300028792 | Soil | VPDALPRWPWRVIALFVIAALGYLVWRGYQQPELILDFANLRLC |
| Ga0302254_100404551 | 3300028870 | Fen | VPDAVGLRWQRRLIALVVITALGYLSWRGYQQPEM |
| Ga0311347_106067371 | 3300029923 | Fen | SSVPDAVGLRWQRRLIALVVVTALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0311336_113258771 | 3300029990 | Fen | VPDTAGLRWQRRLIALVVITALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0311333_101331212 | 3300030114 | Fen | VPDAVGLRWQRRLIALVVVTALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0311366_101257842 | 3300030943 | Fen | VPDAAGLRWQRRLIALVVITALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0302323_1007082273 | 3300031232 | Fen | NVPDAVALRWQRRLIALVVITALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0318516_108601481 | 3300031543 | Soil | AVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0318534_100110413 | 3300031544 | Soil | VPDTAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0318538_106640821 | 3300031546 | Soil | VLEAAGLSFTWRVVALIAITALAFLVWHGYQQPELILDFANLRFC |
| Ga0307469_100116483 | 3300031720 | Hardwood Forest Soil | VPDAAAHWPWRLIGLVLIAALSYIAWRGYQQPELIFDFANVRLC |
| Ga0307469_113778361 | 3300031720 | Hardwood Forest Soil | SSVLETVAFRWPWRVIALVAVAALSYWVWRGYQQPDFILDFANLRFC |
| Ga0307469_116760602 | 3300031720 | Hardwood Forest Soil | VPEAAMLRWPWRVIALVAIAALGYLVWRGYQQPELILDLGNLRFC |
| Ga0318502_100153461 | 3300031747 | Soil | VERSLHSVPETAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0318502_101610621 | 3300031747 | Soil | VWSLATATGTVARSHRSVPDTAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRL |
| Ga0307473_101905041 | 3300031820 | Hardwood Forest Soil | WRLIGLVLIAALSYIAWRGYQQPELIFDFANFRLC |
| Ga0307473_110996191 | 3300031820 | Hardwood Forest Soil | VPEAAAHWPWRLIGLVLIAALSYIAWRGYQQPELIFDFANVRLC |
| Ga0307473_112020492 | 3300031820 | Hardwood Forest Soil | VPETAISRSWRLIALVLIAALAYLSWRGYQQPEWIFDFANLRLC |
| Ga0318517_103690632 | 3300031835 | Soil | VPDTAIHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0318544_100607331 | 3300031880 | Soil | VARSHRSVPDTAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0306921_126752912 | 3300031912 | Soil | VPETTALHWSWRLIALALMATLSYLVWRGYQQPDLIFDFANLRLC |
| Ga0311367_101670302 | 3300031918 | Fen | VPDAVGLRWQRRLIALVVITALGYLSWRGYQQPEMLLEFGNLRFC |
| Ga0318569_102553541 | 3300032010 | Soil | DTAVHWSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0311301_102146122 | 3300032160 | Peatlands Soil | MEWRRRGVPDTLSRWPWRVIALVLIAALGYLVWRGYQQPELILEFGNMRLC |
| Ga0307470_101862272 | 3300032174 | Hardwood Forest Soil | VREAAVHWSWRLIGLVLIAALSYIAWRGYQQPELIFDFANVRLC |
| Ga0307471_1008580342 | 3300032180 | Hardwood Forest Soil | VREAAVHWSWRLIGLVLIAALSYIAWRGYQQPELIFDFANFRLC |
| Ga0306920_1027618441 | 3300032261 | Soil | CSSVLEAAGLSFTWRVVALIAITALAFLVWHGYQQPELILDFANLRFC |
| Ga0335085_102456381 | 3300032770 | Soil | VPETVLDWTWRLVALVLLAALGYLAWRGYQQPEFIFDLANMRLC |
| Ga0335085_108599453 | 3300032770 | Soil | CVSSVWSPATVPRNLSSVREAAVHWSWRLIGLVLIAALSYIAWRGYQQPELIFDFANFRL |
| Ga0335083_100051913 | 3300032954 | Soil | VWSPATVPRNLSSVREAAVHWSWRLIGLVLIAALSYIAWRGYQQPELIFDFANFRLC |
| Ga0335076_110482092 | 3300032955 | Soil | RRRRGVPDGLVRWPWRVIALVVIAALGYFIWRGYQQPELILDFGNLRLCLGAGAAAA |
| Ga0318519_105545512 | 3300033290 | Soil | WSWRLVGLVLIAALSYLAWRGYQQPELIFDFANFRLC |
| Ga0314862_0011504_1301_1438 | 3300033803 | Peatland | VLEAAVLRIPWRVIALIAITALGFLVWRGYQQPELILDFANLRLC |
| Ga0326723_0305506_200_337 | 3300034090 | Peat Soil | VPEAVTLRWPWRVIALVAIAALGYLVWRGYQQPELILDLGNLRFC |
| Ga0364945_0051137_576_710 | 3300034115 | Sediment | VRAAVADWSWRVIALVLIAALGYLIWRGYQQPELILDFANLRLC |
| Ga0370484_0142738_522_638 | 3300034125 | Untreated Peat Soil | MPEALAFRWPWRVIALVVVAALSYLAWRGYEQPDLILDF |
| Ga0364931_0051772_299_433 | 3300034176 | Sediment | VRAAVADWPWRVIALVLIAALGYLIWRGYQQPELILDFANLRLC |
| Ga0364932_0287830_3_113 | 3300034177 | Sediment | MPDALVRWPWRLVALVLIAALGYVIWRGYQQPELILD |
| ⦗Top⦘ |